Golgi resident protein GCP60

Overview
NameGolgi resident protein GCP60
Smed IDSMED30027907
Length (bp)1256
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgi resident protein GCP60 (SMED30027907) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgi resident protein GCP60 (SMED30027907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgi resident protein GCP60 (SMED30027907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgi resident protein GCP60 (SMED30027907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027907SMESG000069590.1 dd_Smed_v4_2498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027907SMESG000069590.1 dd_Smed_v4_2498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027907SMESG000069590.1 dd_Smed_v4_2498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027907SMESG000069590.1 dd_Smed_v4_2498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgi resident protein GCP60 vs. Ensembl Human
Match: ACBD3 (acyl-CoA binding domain containing 3 [Source:HGNC Symbol;Acc:HGNC:15453])

HSP 1 Score: 168.703 bits (426), Expect = 2.289e-46
Identity = 89/182 (48.90%), Postives = 119/182 (65.38%), Query Frame = 2
Query:  446 ALPLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPT-DELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +LP++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH +G  +FWEFATD YD+GFGVYFEW   P+  ++VH+                 +  S+D EE +++   + ++KK  N P  DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  365 SLPVIAAPSMWTRPQIKDFKEKI-QQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHV-----------------SESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 528          
BLAST of Golgi resident protein GCP60 vs. Ensembl Human
Match: TMED8 (transmembrane p24 trafficking protein family member 8 [Source:HGNC Symbol;Acc:HGNC:18633])

HSP 1 Score: 142.124 bits (357), Expect = 2.872e-38
Identity = 88/193 (45.60%), Postives = 120/193 (62.18%), Query Frame = 2
Query:  419 NADLDG----LFPALPLVPANLWTRKDISEFKADILKHQ-RECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            +ADL G    + P L + P  +WT   + EFK+ + K +     +K G +   T+RVPTHP+G+ V WEFATD YD+GFGVYF+W    S +ITV +S+SSD+E+ EEE              +   D+E+G S+        E++PVYRRDSH +V  GSH YPG G Y+LKFDNSYS+ R+K LY+ +YYT
Sbjct:  142 SADLLGDHRKVSPPL-MAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEV--VTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEP------VPAGDVERG-SRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT 324          
BLAST of Golgi resident protein GCP60 vs. Ensembl Celegans
Match: Y41E3.7 (pep chromosome:WBcel235:IV:15014062:15025499:1 gene:WBGene00012765.1 transcript:Y41E3.7g.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.7)

HSP 1 Score: 211.46 bits (537), Expect = 1.045e-64
Identity = 140/294 (47.62%), Postives = 182/294 (61.90%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVY-----------QRQQIDQLKNIYLQQLEESE----TNSNADLDGLF----PALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQ----DDLEKG----RSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            QI+ ALN QT  Q+  YA EQ P +  +Q  LI+QLQEQ++QQY+SQV+  Q               + QI +  +  +   E  E    ++ +A++ GLF    PA+   PA+LW R+DI+EFKA+I K   E  IK+G   T TVRVPTH +G C+FWEFATD+YD+GFGVYFEW V  S  ++VH+SES DEE+++E   + +                 D+E G    R    N    DE+IPVYRRD H EVY GSH+YPGRG Y+LKFDNSYS+WRSK LYYRVYY+K
Sbjct:   61 QIQEALNAQTFHQFSAYAQEQFPGQPEQQTTLIRQLQEQHYQQYMSQVYAQQSTTPNGAEMNPEESHQHQIRRDDDSDVSDDEAGEDLPLSSIHANM-GLFCHSNPAIS--PASLWNRQDINEFKANIKKDGHEGIIKVGHGETVTVRVPTHENGSCLFWEFATDHYDIGFGVYFEWTVADSNQVSVHVSESDDEEDYDEALEAEQAEAGGGGGGAAGQGGPGDVEAGAMQTRRVDPNKPRQDEIIPVYRRDCHEEVYAGSHRYPGRGIYLLKFDNSYSLWRSKTLYYRVYYSK 351          
BLAST of Golgi resident protein GCP60 vs. Ensembl Celegans
Match: Y41E3.7 (pep chromosome:WBcel235:IV:15014062:15025499:1 gene:WBGene00012765.1 transcript:Y41E3.7c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.7)

HSP 1 Score: 211.075 bits (536), Expect = 1.089e-64
Identity = 134/278 (48.20%), Postives = 175/278 (62.95%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGL--FPALPLV-PANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQ----DDLEKG----RSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            QI+ ALN QT  Q+  YA EQ P +  +Q  LI+QLQEQ++QQY+SQV+  Q           +  +  Q+   + +  +D +     P+ P + PA+LW R+DI+EFKA+I K   E  IK+G   T TVRVPTH +G C+FWEFATD+YD+GFGVYFEW V  S  ++VH+SES DEE+++E   + +                 D+E G    R    N    DE+IPVYRRD H EVY GSH+YPGRG Y+LKFDNSYS+WRSK LYYRVYY+K
Sbjct:   61 QIQEALNAQTFHQFSAYAQEQFPGQPEQQTTLIRQLQEQHYQQYMSQVYAQQSTTPNGAEMNPEESHQHQIRRDDDSDVSDDEAGEDLPSNPAISPASLWNRQDINEFKANIKKDGHEGIIKVGHGETVTVRVPTHENGSCLFWEFATDHYDIGFGVYFEWTVADSNQVSVHVSESDDEEDYDEALEAEQAEAGGGGGGAAGQGGPGDVEAGAMQTRRVDPNKPRQDEIIPVYRRDCHEEVYAGSHRYPGRGIYLLKFDNSYSLWRSKTLYYRVYYSK 338          
BLAST of Golgi resident protein GCP60 vs. Ensembl Celegans
Match: Y41E3.7 (pep chromosome:WBcel235:IV:15019906:15025499:1 gene:WBGene00012765.1 transcript:Y41E3.7c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.7)

HSP 1 Score: 211.075 bits (536), Expect = 1.089e-64
Identity = 134/278 (48.20%), Postives = 175/278 (62.95%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGL--FPALPLV-PANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQ----DDLEKG----RSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            QI+ ALN QT  Q+  YA EQ P +  +Q  LI+QLQEQ++QQY+SQV+  Q           +  +  Q+   + +  +D +     P+ P + PA+LW R+DI+EFKA+I K   E  IK+G   T TVRVPTH +G C+FWEFATD+YD+GFGVYFEW V  S  ++VH+SES DEE+++E   + +                 D+E G    R    N    DE+IPVYRRD H EVY GSH+YPGRG Y+LKFDNSYS+WRSK LYYRVYY+K
Sbjct:   61 QIQEALNAQTFHQFSAYAQEQFPGQPEQQTTLIRQLQEQHYQQYMSQVYAQQSTTPNGAEMNPEESHQHQIRRDDDSDVSDDEAGEDLPSNPAISPASLWNRQDINEFKANIKKDGHEGIIKVGHGETVTVRVPTHENGSCLFWEFATDHYDIGFGVYFEWTVADSNQVSVHVSESDDEEDYDEALEAEQAEAGGGGGGAAGQGGPGDVEAGAMQTRRVDPNKPRQDEIIPVYRRDCHEEVYAGSHRYPGRGIYLLKFDNSYSLWRSKTLYYRVYYSK 338          
BLAST of Golgi resident protein GCP60 vs. Ensembl Celegans
Match: Y41E3.7 (pep chromosome:WBcel235:IV:15014042:15025499:1 gene:WBGene00012765.1 transcript:Y41E3.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.7)

HSP 1 Score: 211.846 bits (538), Expect = 2.435e-64
Identity = 134/278 (48.20%), Postives = 175/278 (62.95%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGL--FPALPLV-PANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQ----DDLEKG----RSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            QI+ ALN QT  Q+  YA EQ P +  +Q  LI+QLQEQ++QQY+SQV+  Q           +  +  Q+   + +  +D +     P+ P + PA+LW R+DI+EFKA+I K   E  IK+G   T TVRVPTH +G C+FWEFATD+YD+GFGVYFEW V  S  ++VH+SES DEE+++E   + +                 D+E G    R    N    DE+IPVYRRD H EVY GSH+YPGRG Y+LKFDNSYS+WRSK LYYRVYY+K
Sbjct:  119 QIQEALNAQTFHQFSAYAQEQFPGQPEQQTTLIRQLQEQHYQQYMSQVYAQQSTTPNGAEMNPEESHQHQIRRDDDSDVSDDEAGEDLPSNPAISPASLWNRQDINEFKANIKKDGHEGIIKVGHGETVTVRVPTHENGSCLFWEFATDHYDIGFGVYFEWTVADSNQVSVHVSESDDEEDYDEALEAEQAEAGGGGGGAAGQGGPGDVEAGAMQTRRVDPNKPRQDEIIPVYRRDCHEEVYAGSHRYPGRGIYLLKFDNSYSLWRSKTLYYRVYYSK 396          
BLAST of Golgi resident protein GCP60 vs. Ensembl Celegans
Match: Y41E3.7 (pep chromosome:WBcel235:IV:15014042:15025513:1 gene:WBGene00012765.1 transcript:Y41E3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.7)

HSP 1 Score: 211.46 bits (537), Expect = 9.263e-64
Identity = 134/278 (48.20%), Postives = 175/278 (62.95%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGL--FPALPLV-PANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQ----DDLEKG----RSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            QI+ ALN QT  Q+  YA EQ P +  +Q  LI+QLQEQ++QQY+SQV+  Q           +  +  Q+   + +  +D +     P+ P + PA+LW R+DI+EFKA+I K   E  IK+G   T TVRVPTH +G C+FWEFATD+YD+GFGVYFEW V  S  ++VH+SES DEE+++E   + +                 D+E G    R    N    DE+IPVYRRD H EVY GSH+YPGRG Y+LKFDNSYS+WRSK LYYRVYY+K
Sbjct:  158 QIQEALNAQTFHQFSAYAQEQFPGQPEQQTTLIRQLQEQHYQQYMSQVYAQQSTTPNGAEMNPEESHQHQIRRDDDSDVSDDEAGEDLPSNPAISPASLWNRQDINEFKANIKKDGHEGIIKVGHGETVTVRVPTHENGSCLFWEFATDHYDIGFGVYFEWTVADSNQVSVHVSESDDEEDYDEALEAEQAEAGGGGGGAAGQGGPGDVEAGAMQTRRVDPNKPRQDEIIPVYRRDCHEEVYAGSHRYPGRGIYLLKFDNSYSLWRSKTLYYRVYYSK 435          
BLAST of Golgi resident protein GCP60 vs. Ensembl Fly
Match: CG14232 (gene:FBgn0031061 transcript:FBtr0074813)

HSP 1 Score: 167.933 bits (424), Expect = 7.280e-47
Identity = 83/182 (45.60%), Postives = 116/182 (63.74%), Query Frame = 2
Query:  455 LVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNT-----PTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            + PA +WTR DI +FK ++     +  I IG   T TVRVPT+ +G+C+FWEFATD YD+GFG+YFEW    +  +TVH+S+S ++E+  +E            E+++   L + R    N T     P   ++P+YRR+ + EVY GSH YPG G Y+LKFDNSYS+WR+K LYYRVYY +
Sbjct:  305 ICPAKIWTRPDIEQFKTEVSAGDGDGVITIGHGDTVTVRVPTNMNGKCIFWEFATDSYDIGFGIYFEWAKPVTNEVTVHVSDSDEDEDCVDEDYLSTT------EDLESGSLSQERGAVNNPTAAPKAPISIIVPIYRRECYNEVYVGSHSYPGEGVYLLKFDNSYSIWRNKTLYYRVYYER 480          
BLAST of Golgi resident protein GCP60 vs. Ensembl Fly
Match: CG14232 (gene:FBgn0031061 transcript:FBtr0309218)

HSP 1 Score: 167.933 bits (424), Expect = 7.280e-47
Identity = 83/182 (45.60%), Postives = 116/182 (63.74%), Query Frame = 2
Query:  455 LVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNT-----PTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            + PA +WTR DI +FK ++     +  I IG   T TVRVPT+ +G+C+FWEFATD YD+GFG+YFEW    +  +TVH+S+S ++E+  +E            E+++   L + R    N T     P   ++P+YRR+ + EVY GSH YPG G Y+LKFDNSYS+WR+K LYYRVYY +
Sbjct:  305 ICPAKIWTRPDIEQFKTEVSAGDGDGVITIGHGDTVTVRVPTNMNGKCIFWEFATDSYDIGFGIYFEWAKPVTNEVTVHVSDSDEDEDCVDEDYLSTT------EDLESGSLSQERGAVNNPTAAPKAPISIIVPIYRRECYNEVYVGSHSYPGEGVYLLKFDNSYSIWRNKTLYYRVYYER 480          
BLAST of Golgi resident protein GCP60 vs. Ensembl Zebrafish
Match: zgc:162964 (zgc:162964 [Source:ZFIN;Acc:ZDB-GENE-030131-9798])

HSP 1 Score: 186.422 bits (472), Expect = 1.835e-53
Identity = 112/296 (37.84%), Postives = 169/296 (57.09%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQL---------------------------EESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQD--DLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            QI + LN QT +Q++QYA +Q+P    +Q+ LI+QLQEQ+FQQY+ Q   +Q++  ++Q ++   I   +                            ++ + NS+  ++G    +P+V  ++WTR  I EFK  +L H  +  I +G     T+RVPTHPDG  +FWEFATD+YD+GFG++FEW     +++T                P+  N+  E   E ++     E+ ++++G     +E+ PV RRDSH EVY GSHQYPG G ++LKFDNSYS+WR K +YYRVYYT+
Sbjct:  221 QIMAVLNAQTAVQFQQYAKQQYPDNPEQQQLLIRQLQEQHFQQYVQQALRLQQMASQKQQEESTVIQTSEALPAPISNEAVSICNPNSQSNSLDNHKQQKDQKNSHLVVEGETGVVPIVAPSMWTRPQIKEFKEKVL-HDEDSVITVGRGEVLTIRVPTHPDGSYLFWEFATDHYDIGFGLHFEW-----KDLTA---------------PTSSNNGGESTTETKEGTAQAEEEKTEQGRIPLVNEVAPVSRRDSHEEVYAGSHQYPGEGVHLLKFDNSYSLWRPKVVYYRVYYTR 495          
BLAST of Golgi resident protein GCP60 vs. Ensembl Zebrafish
Match: tmed8 (transmembrane p24 trafficking protein 8 [Source:ZFIN;Acc:ZDB-GENE-050522-283])

HSP 1 Score: 152.91 bits (385), Expect = 4.058e-43
Identity = 86/177 (48.59%), Postives = 115/177 (64.97%), Query Frame = 2
Query:  452 PLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            P+ PA+ WT   + + K   L+ +++  + +      TV VPT P+ + V WEFATD YD+GFGVYF+W+   S  ITVHISESSD+E+ ++E              +   D+EKG SK   NT   E++PVYR+DSHL V  GSH +PG GTY+LKFDNSYS+WR+K LYYRVYY+
Sbjct:   99 PMKPASTWTSVALKDLKTK-LRQEKDSVVTVYRGDIMTVHVPTVPEAKRVCWEFATDGYDIGFGVYFDWSPVTSRAITVHISESSDDEDEDDELEG----------PVVPGDVEKG-SKSSANTNLGEILPVYRQDSHLAVQGGSHDFPGEGTYLLKFDNSYSLWRNKTLYYRVYYS 263          
BLAST of Golgi resident protein GCP60 vs. Ensembl Zebrafish
Match: tmed8 (transmembrane p24 trafficking protein 8 [Source:ZFIN;Acc:ZDB-GENE-050522-283])

HSP 1 Score: 152.91 bits (385), Expect = 4.058e-43
Identity = 86/177 (48.59%), Postives = 115/177 (64.97%), Query Frame = 2
Query:  452 PLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            P+ PA+ WT   + + K   L+ +++  + +      TV VPT P+ + V WEFATD YD+GFGVYF+W+   S  ITVHISESSD+E+ ++E              +   D+EKG SK   NT   E++PVYR+DSHL V  GSH +PG GTY+LKFDNSYS+WR+K LYYRVYY+
Sbjct:   99 PMKPASTWTSVALKDLKTK-LRQEKDSVVTVYRGDIMTVHVPTVPEAKRVCWEFATDGYDIGFGVYFDWSPVTSRAITVHISESSDDEDEDDELEG----------PVVPGDVEKG-SKSSANTNLGEILPVYRQDSHLAVQGGSHDFPGEGTYLLKFDNSYSLWRNKTLYYRVYYS 263          
BLAST of Golgi resident protein GCP60 vs. Ensembl Zebrafish
Match: tmed8 (transmembrane p24 trafficking protein 8 [Source:ZFIN;Acc:ZDB-GENE-050522-283])

HSP 1 Score: 152.525 bits (384), Expect = 5.175e-43
Identity = 86/177 (48.59%), Postives = 115/177 (64.97%), Query Frame = 2
Query:  452 PLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            P+ PA+ WT   + + K   L+ +++  + +      TV VPT P+ + V WEFATD YD+GFGVYF+W+   S  ITVHISESSD+E+ ++E              +   D+EKG SK   NT   E++PVYR+DSHL V  GSH +PG GTY+LKFDNSYS+WR+K LYYRVYY+
Sbjct:  103 PMKPASTWTSVALKDLKTK-LRQEKDSVVTVYRGDIMTVHVPTVPEAKRVCWEFATDGYDIGFGVYFDWSPVTSRAITVHISESSDDEDEDDELEG----------PVVPGDVEKG-SKSSANTNLGEILPVYRQDSHLAVQGGSHDFPGEGTYLLKFDNSYSLWRNKTLYYRVYYS 267          
BLAST of Golgi resident protein GCP60 vs. Ensembl Zebrafish
Match: acbd3 (acyl-Coenzyme A binding domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1930])

HSP 1 Score: 157.532 bits (397), Expect = 1.721e-42
Identity = 92/179 (51.40%), Postives = 118/179 (65.92%), Query Frame = 2
Query:  452 PLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            P++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH +G  +FWEFATDYYD+GFGV+FEW    + +++VH+SESSDEEE EE     E  K++               K+      DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  361 PVIAAPSMWTRPQIKDFKVKI-RQDVDSVITVGRGEVVTVRVPTHEEGSYLFWEFATDYYDIGFGVFFEWTDSTNASVSVHVSESSDEEEEEEGEAQSEEEKAK---------------KESGKPQVDEIVPVYRRDCHEEVYAGSHQYPGRGIYLLKFDNSYSLWRSKTVYYRVYYTR 523          
BLAST of Golgi resident protein GCP60 vs. Ensembl Xenopus
Match: acbd3 (acyl-CoA binding domain containing 3 [Source:NCBI gene;Acc:100124747])

HSP 1 Score: 170.629 bits (431), Expect = 2.676e-47
Identity = 99/199 (49.75%), Postives = 131/199 (65.83%), Query Frame = 2
Query:  401 ESETNSNADL--DGLFPALPLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTP-TDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            E E++   DL  +G   + P++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH +G  +FWEFATD YD+GFGVYFEW   P+  ++VH+SESS++EE +E +    N  SE+            ++KK  N P  DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  336 EMESDPLEDLLENGPKESAPVIAAPSMWTRPQIKDFKEKI-RQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSEDEEEDEGNE---NPNSEE------------KAKKNANKPQLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 518          
BLAST of Golgi resident protein GCP60 vs. Ensembl Xenopus
Match: fut9 (fucosyltransferase 9 (alpha (1,3) fucosyltransferase) [Source:Xenbase;Acc:XB-GENE-966137])

HSP 1 Score: 132.88 bits (333), Expect = 9.749e-35
Identity = 74/175 (42.29%), Postives = 102/175 (58.29%), Query Frame = 2
Query:  473 WTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKG-----RSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            WT  ++ EFK  + K ++   + +      TVRVPTHPDG+ + WEFATD YD+GFG+YF+W    S  +T+            E S   +  + E P   ++ D+E+G     RS+ G      E++ VYRRDSH EV  GSH+YPG G Y+LK DNSYS+ R+K LY  VYY+
Sbjct:  170 WTSANLREFKNRMAK-EKHGVLTVRRGEVLTVRVPTHPDGKRLCWEFATDDYDIGFGIYFDWTTVTSTAVTLQ---------ISESSDEEDEEEIESPWHGREGDVERGSMYRLRSRYG------EIVQVYRRDSHREVQAGSHEYPGEGIYMLKLDNSYSLLRNKTLYLHVYYS 328          
BLAST of Golgi resident protein GCP60 vs. Ensembl Mouse
Match: Acbd3 (acyl-Coenzyme A binding domain containing 3 [Source:MGI Symbol;Acc:MGI:2181074])

HSP 1 Score: 167.162 bits (422), Expect = 4.901e-46
Identity = 97/182 (53.30%), Postives = 122/182 (67.03%), Query Frame = 2
Query:  446 ALPLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPT-DELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +LP++ A ++WTR  I +FK  I +   +  I +      TVRVPTH +G  +FWEFATD YD+GFGVYFEW   P+  ++VH+SESSDEEE EEE     N   E+            ++KK  N P  DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  362 SLPVIAAPSMWTRPQIKDFKEKI-RQDADSVITVRRGEVVTVRVPTHEEGSYLFWEFATDSYDIGFGVYFEWTDSPNAAVSVHVSESSDEEEEEEE-----NVTCEE------------KAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 525          
BLAST of Golgi resident protein GCP60 vs. Ensembl Mouse
Match: Tmed8 (transmembrane p24 trafficking protein 8 [Source:MGI Symbol;Acc:MGI:1923480])

HSP 1 Score: 142.51 bits (358), Expect = 1.818e-38
Identity = 87/193 (45.08%), Postives = 120/193 (62.18%), Query Frame = 2
Query:  419 NADLDG----LFPALPLVPANLWTRKDISEFKADILKHQ-RECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            +ADL G    + P L + P  +WT   + EFK+ + K +     +K G +   T+RVPTHP+G+ V WEFATD YD+GFGVYF+W    S +ITV +S+SS++EE EE+              +   D+E+G S+        E++PVYRRDSH +V  GSH YPG G Y+LKFDNSYS+ R+K LY+ +YYT
Sbjct:  143 SADLLGDHRKVSPPL-MAPPCVWTFAKVKEFKSKLGKEKNSRLVVKRGEV--VTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSEDEEEEEDEEEEIEEP------VPVGDVERG-SRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT 325          
BLAST of Golgi resident protein GCP60 vs. UniProt/SwissProt
Match: sp|Q9H3P7|GCP60_HUMAN (Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4)

HSP 1 Score: 168.703 bits (426), Expect = 1.099e-45
Identity = 89/182 (48.90%), Postives = 119/182 (65.38%), Query Frame = 2
Query:  446 ALPLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPT-DELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +LP++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH +G  +FWEFATD YD+GFGVYFEW   P+  ++VH+                 +  S+D EE +++   + ++KK  N P  DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  365 SLPVIAAPSMWTRPQIKDFKEKI-QQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHV-----------------SESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 528          
BLAST of Golgi resident protein GCP60 vs. UniProt/SwissProt
Match: sp|Q8BMP6|GCP60_MOUSE (Golgi resident protein GCP60 OS=Mus musculus OX=10090 GN=Acbd3 PE=1 SV=3)

HSP 1 Score: 167.162 bits (422), Expect = 3.429e-45
Identity = 97/182 (53.30%), Postives = 122/182 (67.03%), Query Frame = 2
Query:  446 ALPLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPT-DELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +LP++ A ++WTR  I +FK  I +   +  I +      TVRVPTH +G  +FWEFATD YD+GFGVYFEW   P+  ++VH+SESSDEEE EEE     N   E+            ++KK  N P  DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  362 SLPVIAAPSMWTRPQIKDFKEKI-RQDADSVITVRRGEVVTVRVPTHEEGSYLFWEFATDSYDIGFGVYFEWTDSPNAAVSVHVSESSDEEEEEEE-----NVTCEE------------KAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 525          
BLAST of Golgi resident protein GCP60 vs. UniProt/SwissProt
Match: sp|Q7TNY6|GCP60_RAT (Golgi resident protein GCP60 OS=Rattus norvegicus OX=10116 GN=Acbd3 PE=1 SV=3)

HSP 1 Score: 166.392 bits (420), Expect = 7.047e-45
Identity = 95/182 (52.20%), Postives = 119/182 (65.38%), Query Frame = 2
Query:  446 ALPLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPT-DELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +LP++ A ++WTR  I +FK  I +   +  I +      TVRVPTH +G  +FWEFATD YD+GFGVYFEW   P+  ++VH+SESSD+EE EEE       K+                KK  N P  DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  362 SLPVIAAPSMWTRPQIKDFKEKI-RQDADSVITVRRGEVVTVRVPTHEEGSYLFWEFATDSYDIGFGVYFEWTDSPNAAVSVHVSESSDDEEEEEEENVTCEEKA----------------KKNVNKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 526          
BLAST of Golgi resident protein GCP60 vs. UniProt/SwissProt
Match: sp|Q3UHI4|TMED8_MOUSE (Protein TMED8 OS=Mus musculus OX=10090 GN=Tmed8 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.272e-37
Identity = 87/193 (45.08%), Postives = 120/193 (62.18%), Query Frame = 2
Query:  419 NADLDG----LFPALPLVPANLWTRKDISEFKADILKHQ-RECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            +ADL G    + P L + P  +WT   + EFK+ + K +     +K G +   T+RVPTHP+G+ V WEFATD YD+GFGVYF+W    S +ITV +S+SS++EE EE+              +   D+E+G S+        E++PVYRRDSH +V  GSH YPG G Y+LKFDNSYS+ R+K LY+ +YYT
Sbjct:  143 SADLLGDHRKVSPPL-MAPPCVWTFAKVKEFKSKLGKEKNSRLVVKRGEV--VTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSEDEEEEEDEEEEIEEP------VPVGDVERG-SRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT 325          
BLAST of Golgi resident protein GCP60 vs. UniProt/SwissProt
Match: sp|Q6PL24|TMED8_HUMAN (Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.379e-37
Identity = 88/193 (45.60%), Postives = 120/193 (62.18%), Query Frame = 2
Query:  419 NADLDG----LFPALPLVPANLWTRKDISEFKADILKHQ-RECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            +ADL G    + P L + P  +WT   + EFK+ + K +     +K G +   T+RVPTHP+G+ V WEFATD YD+GFGVYF+W    S +ITV +S+SSD+E+ EEE              +   D+E+G S+        E++PVYRRDSH +V  GSH YPG G Y+LKFDNSYS+ R+K LY+ +YYT
Sbjct:  142 SADLLGDHRKVSPPL-MAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEV--VTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEP------VPAGDVERG-SRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT 324          
BLAST of Golgi resident protein GCP60 vs. TrEMBL
Match: A0A4Z2D0Z0 (Golgi resident protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005931 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.009e-89
Identity = 165/311 (53.05%), Postives = 214/311 (68.81%), Query Frame = 2
Query:   68 NLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNH------KSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            NL  E NE+        + +NE    D     D ++ E++I+SAL QQT   Y QYA EQ PK+  KQ+ELI ++QEQYF  Y S+V+  Q  +Q+QQ+DQL+ +        + N+N++ D   P LPL+PA +WTRK+I+EFK +IL  Q+ECCIKI SL+TATVRVPTHP+G+ + WEFATD+YDLGFG+YFEW+++P ENI+V+ISESSDEE  E+E     N+       S +  E    DLE GR       PTDELIP+YRRD H EVYCGSHQYPG G Y+ KFDNS+S+WRSKWLYYR++YT
Sbjct:   24 NLSDEMNETS-------VCVNERCYGDQG---DLNQKENEIKSALVQQTKDLYEQYAREQFPKDPDKQKELIAEMQEQYFDHYFSEVYRFQLAHQQQQLDQLRAMKSIAKNTDDENANSERDSPEP-LPLIPATIWTRKEIAEFKKEILDVQKECCIKISSLATATVRVPTHPNGKAICWEFATDHYDLGFGLYFEWDIEPPENISVNISESSDEEGAEDEDEEGHNNGDSVEQASRNENEETPHDLELGRKSSQPRVPTDELIPIYRRDCHTEVYCGSHQYPGVGVYVFKFDNSFSLWRSKWLYYRIFYT 323          
BLAST of Golgi resident protein GCP60 vs. TrEMBL
Match: A0A4E0RC49 (Protein involved in maintenance of golgi structure and er-golgi transport OS=Fasciola hepatica OX=6192 GN=D915_009667 PE=4 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 4.015e-89
Identity = 155/307 (50.49%), Postives = 210/307 (68.40%), Query Frame = 2
Query:  116 DLSLNENPLNDNNP--ITDSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIY----LQQLEESETNSNADLDG-LFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHI-----XXXXXXXXXXXXXXXXXNHKSEDPEEIQ-----QDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            D  L+ NP  D  P  + +  ++   IR AL+ QT I Y QYA EQ+PK   KQ+EL+ ++QEQYFQ+Y+++V+  Q ++Q+QQ +Q + ++     +   E +T + A  D  L   LPL+PA LWTRKDI EFK +ILK Q ECCIKIGSL+TATVRVPTHPDG  +FWEFATD+YDLGFG+YFEW+++P + ITV +      +  ++E+ + + P    H S+D  ++       +DLE+G     +  PTDELIP+YRRD H EVYCGSHQYPG G Y+ KFDNS+S+WRSKWLYYR+YY +
Sbjct:   27 DPKLSPNPEIDETPKEVEEHLKLHETIRRALDDQTSILYEQYAREQYPKNPQKQKELVLEMQEQYFQKYMNKVYTSQLLHQQQQFEQWRTLHETEPSKDANEGDTGNEAPSDPPLSHVLPLIPATLWTRKDICEFKQEILKTQNECCIKIGSLATATVRVPTHPDGTSIFWEFATDHYDLGFGLYFEWDLEPQKQITVSVSESSDEDDGEDEDNDVDDPETGTHPSQDIRDLDDRSLPAEDLERGCHSSNSRVPTDELIPIYRRDCHTEVYCGSHQYPGVGVYVFKFDNSFSLWRSKWLYYRIYYAQ 333          
BLAST of Golgi resident protein GCP60 vs. TrEMBL
Match: A0A504YL61 (Protein involved in maintenance of golgi structure and er-golgi transport OS=Fasciola gigantica OX=46835 GN=FGIG_09739 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 7.687e-89
Identity = 158/321 (49.22%), Postives = 214/321 (66.67%), Query Frame = 2
Query:   77 TESNESGFIEQMS-DLSLNENPLNDNNP--ITDSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIY----LQQLEESETNSNADLDG-LFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHI-----XXXXXXXXXXXXXXXXXNHKSEDPEEIQ-----QDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            T+   +  +E  S D  L+ NP     P    +  ++   IR AL+ QT I Y QYA EQ+PK   KQ+EL+ ++QEQYFQ+Y+S+V+  Q ++Q+QQ +Q + ++     +   E +T + A  D  L   LPL+PA LWTRKDI EFK +ILK Q ECCIKIGSL+TATVRVPTHPDG  +FWEFATD+YDLGFG+YFEW+++P + ITV +      +  ++E+ + + P    H S+D  ++       +DLE+G     +  PTDELIP+YRRD H EVYCGSHQYPG G Y+ KFDNS+S+WRSKWLYYR+YY +
Sbjct:   13 TKRGSTSVLETASVDPKLSPNPEMHETPKEFEEHLKLHETIRRALDDQTNILYEQYAREQYPKNPQKQKELVLEMQEQYFQKYMSKVYTSQLLHQQQQFEQWRTLHETEPSKDANEGDTGNEAPSDPPLSHVLPLIPATLWTRKDICEFKQEILKTQNECCIKIGSLATATVRVPTHPDGTSIFWEFATDHYDLGFGLYFEWDLEPQKQITVSVSESSDEDDGEDEDNDVDDPETGTHPSQDIRDLDDRSLPAEDLERGCHSSNSRVPTDELIPIYRRDCHTEVYCGSHQYPGVGVYVFKFDNSFSLWRSKWLYYRIYYAQ 333          
BLAST of Golgi resident protein GCP60 vs. TrEMBL
Match: G4V7E5 (GOLD domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_167230 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 2.383e-88
Identity = 166/318 (52.20%), Postives = 220/318 (69.18%), Query Frame = 2
Query:   50 FKMSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFP-ALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXN------HKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            F+   +N P++SNE   I + S + + E   +D     D  + E +I+SAL QQT   Y QYA EQ PK+L KQ+ LI ++Q+QYF+ Y+S+V+  Q V+QRQQ++QL+ +     +  + N+ +D D  FP  LPL+PA +WTRK+I+EFK +IL  Q+ECCIKI SL+TATVRVPTHP+GR + WEFATD YDLGFG+YFEW+++P ENI+V+ISESSDEE  E+E     N        S   E  +  DLE G+       P DELIP+YRRD H EVYCG+HQYPG G Y+ KFDNS+S+WRSKWLYYR++YT
Sbjct:   14 FETLSLNDPSDSNE---IHETS-VRVKEGFCDDQG---DLGQKEIEIKSALVQQTKDLYEQYAREQFPKDLEKQKALITEMQDQYFEHYLSEVYRFQLVHQRQQLEQLRAVKSAVKDPHDENAESDKD--FPEPLPLIPATVWTRKNIAEFKREILDVQKECCIKISSLATATVRVPTHPNGRAICWEFATDNYDLGFGLYFEWDLEPPENISVNISESSDEEGGEDEDEEGPNSGNSVEQTSPKNENKESHDLELGKKSLQQRLPIDELIPIYRRDCHTEVYCGTHQYPGVGVYVFKFDNSFSLWRSKWLYYRIFYT 322          
BLAST of Golgi resident protein GCP60 vs. TrEMBL
Match: A0A0V0J5B4 (Golgi resident protein GCP60 OS=Schistocephalus solidus OX=70667 GN=GCP60 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 7.080e-88
Identity = 161/285 (56.49%), Postives = 204/285 (71.58%), Query Frame = 2
Query:  164 DSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETN----SNADLDGLFPA--LPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLE-----KGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +S+  E+ IRS L+QQ+IIQ+RQYA EQHPKE  KQ+ELI Q+QEQYFQ YI  V   Q ++Q++QI+QL ++      E+  N    S  D D +     LPL+PA+LWTRKDI EFK +IL  QRECCIK+GSL++AT+RVPTH +G  +FWEFATD YD+GFG++FEW++ P E+IT+ ISESSDEE+  E++    +     P +   DD       +G  +     PTDELIP+YRRDSHLEVYCGSHQYPG G YI KFDNS+S+WRSKWLYYRVYY K
Sbjct:   60 ESARQEAAIRSILDQQSIIQFRQYAQEQHPKEPEKQKELIAQMQEQYFQYYIENVQHSQGIHQQRQIEQLIDLQKAARAEAAANGKELSPEDEDAIAEPIPLPLIPASLWTRKDIVEFKKEILSMQRECCIKVGSLASATLRVPTHEEGTSIFWEFATDSYDIGFGLFFEWSLSPPESITMTISESSDEEDEYEDNEEEGSEAPPRPRQRSADDGSVNGDVEGGGRDLGGPPTDELIPIYRRDSHLEVYCGSHQYPGCGVYIFKFDNSFSLWRSKWLYYRVYYGK 344          
BLAST of Golgi resident protein GCP60 vs. Ensembl Cavefish
Match: zgc:162964 (Golgi resident protein GCP60 [Source:NCBI gene;Acc:103047560])

HSP 1 Score: 169.088 bits (427), Expect = 1.727e-47
Identity = 114/286 (39.86%), Postives = 166/286 (58.04%), Query Frame = 2
Query:  188 IRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEV---------QKVYQRQQI----DQLKNIYLQQLEESETNS------NADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTP-TDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            I +ALN QT +Q+ +YA +Q P    +Q+ LI+QLQEQ+++QYI Q ++V           V Q  Q+    D ++++    + +SE+ S      +  LD     + ++  ++WTR  I EFK + +    E  I +G     TVRVPTH DG  +FWEFATD+YD+GFG++FEW    S+ +T      S  E          N ++   EE    + ++  S  G + P   E++P+YRRDSH EVY GSH YPG+G Y+L+FDNSYS+WRSK +YYRVYYT+
Sbjct:  178 IMAALNAQTTVQFLRYAQQQFPDSPEQQQLLIQQLQEQHYRQYIQQAYQVQQVEQKQQDSAVTQAAQVTSHSDDMESVK-NAINQSESQSPEPKPCHLFLDRSPGEVAVLAPSMWTRPQIKEFK-EKMAQDAESVITVGRGEVLTVRVPTHEDGAYLFWEFATDHYDIGFGLHFEW--PNSDGMTARTLPESASE----------NQQAGGAEE----EKDQSESCNGTSVPNVTEVVPIYRRDSHEEVYAGSHHYPGQGVYLLRFDNSYSLWRSKVVYYRVYYTR 445          
BLAST of Golgi resident protein GCP60 vs. Ensembl Cavefish
Match: zgc:162964 (Golgi resident protein GCP60 [Source:NCBI gene;Acc:103047560])

HSP 1 Score: 168.703 bits (426), Expect = 5.769e-47
Identity = 116/288 (40.28%), Postives = 166/288 (57.64%), Query Frame = 2
Query:  188 IRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEV---------QKVYQRQQI----DQLKNIYLQQLEESETNS------NADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPT---DELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            I +ALN QT +Q+ +YA +Q P    +Q+ LI+QLQEQ+++QYI Q ++V           V Q  Q+    D ++++    + +SE+ S      +  LD     + ++  ++WTR  I EFK + +    E  I +G     TVRVPTH DG  +FWEFATD+YD+GFG++FEW    S+ +T      S  E          N ++   EE      EK +S+  N T      E++P+YRRDSH EVY GSH YPG+G Y+L+FDNSYS+WRSK +YYRVYYT+
Sbjct:  225 IMAALNAQTTVQFLRYAQQQFPDSPEQQQLLIQQLQEQHYRQYIQQAYQVQQVEQKQQDSAVTQAAQVTSHSDDMESVK-NAINQSESQSPEPKPCHLFLDRSPGEVAVLAPSMWTRPQIKEFK-EKMAQDAESVITVGRGEVLTVRVPTHEDGAYLFWEFATDHYDIGFGLHFEW--PNSDGMTARTLPESASE----------NQQAGGAEE------EKDQSESCNGTSVPNVTEVVPIYRRDSHEEVYAGSHHYPGQGVYLLRFDNSYSLWRSKVVYYRVYYTR 492          
BLAST of Golgi resident protein GCP60 vs. Ensembl Cavefish
Match: zgc:162964 (Golgi resident protein GCP60 [Source:NCBI gene;Acc:103047560])

HSP 1 Score: 162.155 bits (409), Expect = 7.468e-45
Identity = 108/286 (37.76%), Postives = 154/286 (53.85%), Query Frame = 2
Query:  188 IRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEV---------QKVYQRQQI----DQLKNIYLQQLEESETNS------NADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTP-TDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            I +ALN QT +Q+ +YA +Q P    +Q+ LI+QLQEQ+++QYI Q ++V           V Q  Q+    D ++++    + +SE+ S      +  LD     + ++  ++WTR  I EFK + +    E  I +G     TVRVPTH DG  +FWEFATD+YD+GFG++FEW                                          D    R+  G + P   E++P+YRRDSH EVY GSH YPG+G Y+L+FDNSYS+WRSK +YYRVYYT+
Sbjct:  207 IMAALNAQTTVQFLRYAQQQFPDSPEQQQLLIQQLQEQHYRQYIQQAYQVQQVEQKQQDSAVTQAAQVTSHSDDMESV-KNAINQSESQSPEPKPCHLFLDRSPGEVAVLAPSMWTRPQIKEFK-EKMAQDAESVITVGRGEVLTVRVPTHEDGAYLFWEFATDHYDIGFGLHFEW---------------------------------------PNSDGMTARTCNGTSVPNVTEVVPIYRRDSHEEVYAGSHHYPGQGVYLLRFDNSYSLWRSKVVYYRVYYTR 451          
BLAST of Golgi resident protein GCP60 vs. Ensembl Cavefish
Match: acbd3 (acyl-CoA binding domain containing 3 [Source:NCBI gene;Acc:103034545])

HSP 1 Score: 157.147 bits (396), Expect = 1.918e-42
Identity = 92/179 (51.40%), Postives = 119/179 (66.48%), Query Frame = 2
Query:  452 PLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            P++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH +G  +FWEFATDYYD+GFGV+FEW    + +++VH+SESSDE+E EE  P  E  K++               K+      DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  366 PVIAAPSMWTRPQIKDFKEKI-RQDVDSVITVGRGEVVTVRVPTHEEGSYLFWEFATDYYDIGFGVFFEWTDSTNASVSVHVSESSDEDEDEEAEPQSEEEKAK---------------KEAGKPQVDEIVPVYRRDCHEEVYAGSHQYPGRGIYLLKFDNSYSLWRSKSVYYRVYYTR 528          
BLAST of Golgi resident protein GCP60 vs. Ensembl Cavefish
Match: acbd3 (acyl-CoA binding domain containing 3 [Source:NCBI gene;Acc:103034545])

HSP 1 Score: 153.295 bits (386), Expect = 3.017e-41
Identity = 85/179 (47.49%), Postives = 110/179 (61.45%), Query Frame = 2
Query:  452 PLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            P++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH +G  +FWEFATDYYD+GFGV+FEW    S N +V +  S   +E E+E       ++  P+                    DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  341 PVIAAPSMWTRPQIKDFKEKI-RQDVDSVITVGRGEVVTVRVPTHEEGSYLFWEFATDYYDIGFGVFFEWT--DSTNASVSVHVSESSDEDEDEEEEKAKKEAGKPQ-------------------VDEIVPVYRRDCHEEVYAGSHQYPGRGIYLLKFDNSYSLWRSKSVYYRVYYTR 497          
BLAST of Golgi resident protein GCP60 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008311.1 (pep scaffold:Pmarinus_7.0:GL476355:227612:229659:-1 gene:ENSPMAG00000007523.1 transcript:ENSPMAT00000008311.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 8.481e-18
Identity = 34/77 (44.16%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  455 LVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENIT 685
            +VP  LWT  ++ +FK  + + +    ++IG     TVRVPT P    + WEFATD YDL FG+YFEWN +P  ++T
Sbjct:    8 MVPPVLWTSSELRQFKTRVAQ-EPHGVLRIGCGEVGTVRVPTRPGASHLCWEFATDSYDLAFGLYFEWNEEPGCDVT 83          
BLAST of Golgi resident protein GCP60 vs. Ensembl Nematostella
Match: EDO39149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAW2])

HSP 1 Score: 156.377 bits (394), Expect = 3.180e-46
Identity = 84/179 (46.93%), Postives = 104/179 (58.10%), Query Frame = 2
Query:  455 LVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDP-EEIQQDDLEKGRSKKGNNTP-TDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            + PA+LWTR  + EF   + K      + +G   T TVRVPTH  G C+FWEFAT+ YDLGFGV FEW+   S+NITV +                 N   ED   E  +   E   +  G   P  DE++PV RR  H EV  GSH YPGRG Y+LKFDNSYS++RSK L+YRVYYT+
Sbjct:    1 MAPASLWTRPKVMEFIQHV-KSDPSSVLVVGRGETMTVRVPTHDSGTCLFWEFATELYDLGFGVSFEWSQPNSKNITVAV-----------------NESDEDEFTEDSEKSAEAEAATVGAAKPRVDEILPVVRRPCHEEVIVGSHMYPGRGVYLLKFDNSYSLFRSKTLFYRVYYTR 161          
BLAST of Golgi resident protein GCP60 vs. Ensembl Medaka
Match: tmed8 (transmembrane p24 trafficking protein family member 8 [Source:NCBI gene;Acc:101162562])

HSP 1 Score: 156.377 bits (394), Expect = 1.857e-44
Identity = 90/177 (50.85%), Postives = 120/177 (67.80%), Query Frame = 2
Query:  452 PLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYT 982
            PL PA+ WT   + E KA  L+ +++  + +      TV VPT P+ + V WEFATD YD+GFG+YF+W+   + +ITVHISESSD+E+ EEE         E P  +   D+EKG SK   N+   E++PVYR+DSHL V+ GSH +PG GTY+LKFDNSYS+WR+K LYYRVYY+
Sbjct:  106 PLQPAHTWTSAAVKELKAK-LRPEKDSVVTVYRGDIMTVNVPTVPEAKKVCWEFATDGYDIGFGIYFDWSPVTNRSITVHISESSDDEDEEEEL--------EGP--VSNGDVEKG-SKSQTNSNLAEILPVYRQDSHLSVHGGSHDFPGEGTYLLKFDNSYSLWRNKTLYYRVYYS 270          
BLAST of Golgi resident protein GCP60 vs. Ensembl Medaka
Match: acbd3 (acyl-CoA binding domain containing 3 [Source:NCBI gene;Acc:101162649])

HSP 1 Score: 159.458 bits (402), Expect = 3.592e-43
Identity = 85/179 (47.49%), Postives = 110/179 (61.45%), Query Frame = 2
Query:  452 PLVPA-NLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            P++ A ++WTR  I +FK  I +   +  I +G     TVRVPTH  G  +FWEFATDYYD+GFGV+FEW            + +S      E S   E+   + P E ++   E G+ +       DE++PVYRRD H EVY GSHQYPGRG Y+LKFDNSYS+WRSK +YYRVYYT+
Sbjct:  384 PVIAAPSMWTRPQIKDFKEKI-RQDADSVITVGRGEVVTVRVPTHEQGSYLFWEFATDYYDIGFGVFFEW---------TDSASASVSVHVSESSDEDEDEDGDPPTEEEKAKKEAGKPQ------VDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 546          
BLAST of Golgi resident protein GCP60 vs. Ensembl Medaka
Match: tmed8 (transmembrane p24 trafficking protein family member 8 [Source:NCBI gene;Acc:101162562])

HSP 1 Score: 106.686 bits (265), Expect = 7.309e-26
Identity = 68/149 (45.64%), Postives = 94/149 (63.09%), Query Frame = 2
Query:  452 PLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYP 898
            PL PA+ WT   + E KA  L+ +++  + +      TV VPT P+ + V WEFATD YD+GFG+YF+W+   + +ITVHISESSD+E+ EEE         E P  +   D+EKG SK   N+   E++PVYR+DSHL V+ GSH +P
Sbjct:  106 PLQPAHTWTSAAVKELKAK-LRPEKDSVVTVYRGDIMTVNVPTVPEAKKVCWEFATDGYDIGFGIYFDWSPVTNRSITVHISESSDDEDEEEEL--------EGP--VSNGDVEKG-SKSQTNSNLAEILPVYRQDSHLSVHGGSHDFP 242          
BLAST of Golgi resident protein GCP60 vs. Planmine SMEST
Match: SMESG000069590.1 (SMESG000069590.1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 312/313 (99.68%), Postives = 313/313 (100.00%), Query Frame = 2
Query:   47 NFKMSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            +FKMSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPKELHKQEELIKQLQEQYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHISESSDEEEFEEESPSVENHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK
Sbjct:    3 SFKMSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPKELHKQEELIKQLQEQYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHISESSDEEEFEEESPSVENHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 315          
BLAST of Golgi resident protein GCP60 vs. Planmine SMEST
Match: SMESG000069590.1 (SMESG000069590.1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 310/310 (100.00%), Postives = 310/310 (100.00%), Query Frame = 2
Query:   56 MSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            MSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPKELHKQEELIKQLQEQYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHISESSDEEEFEEESPSVENHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK
Sbjct:    1 MSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALNQQTIIQYRQYAAEQHPKELHKQEELIKQLQEQYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHISESSDEEEFEEESPSVENHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 310          
BLAST of Golgi resident protein GCP60 vs. Planmine SMEST
Match: SMESG000035132.1 (SMESG000035132.1)

HSP 1 Score: 259.996 bits (663), Expect = 4.928e-84
Identity = 151/282 (53.55%), Postives = 190/282 (67.38%), Query Frame = 2
Query:  185 QIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKVYQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPE----EIQQDDLEK--GRSK-----KGNN----TPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSKWLYYRVYYTK 985
            ++R ALN+QT+IQYRQYA E++PKE  KQEELI +LQ Q+F+ Y + V      +Q +QI+Q K + L +  E+E  SN  +  + P +  VPA+LWTRKDI EFK +I+   R  CIKI SLSTATV+VPTH DGRC+FWEFATDYYD+GFG+ FEWN+ P+ENI V IS                  +S D E    EI+ +D E   G +K      G+N    + TDELI  YRR+ H+EVYCGSH++PG G YILKFDNSYSVWRSKWLYY VY+TK
Sbjct:   49 RVREALNRQTLIQYRQYALEKYPKEFIKQEELIAELQNQHFKNYWANVHLEMIRHQNEQIEQRKAMMLSENSETEVISNLKISKVIPNV--VPASLWTRKDIVEFKTNIISTNRSNCIKIQSLSTATVKVPTHKDGRCIFWEFATDYYDIGFGLLFEWNLNPTENIVVTIS------------------ESSDEEYGEDEIKSNDEEGKVGENKTNSDISGSNVEKKSQTDELITTYRRECHMEVYCGSHEHPGIGYYILKFDNSYSVWRSKWLYYNVYHTK 310          
BLAST of Golgi resident protein GCP60 vs. Planmine SMEST
Match: SMESG000008119.1 (SMESG000008119.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.751e-26
Identity = 85/292 (29.11%), Postives = 129/292 (44.18%), Query Frame = 2
Query:  173 EIESQIRSALNQQTIIQYRQYAAEQHPXXXXXXXXXXXXXXXXYFQQYISQVFEVQKV----------------YQRQQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKADILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFEWNVQPSENITVHIXXXXXXXXXXXXXXXXXNHKSEDPEEIQQDDLEKGRSKKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGT------YILKFDNSYSVWRSKWLYYRVYYT 982
            E E+++RS LNQQT  Q+  YA +QHP++   QE+LI QLQ+ +F QY+  ++E  +                  +++ I+ L    L ++E  E     + +       +V   +W    I+EFK    K + +  +KIGS    T+RVP       + W+F TD  D+GFGV     V    N T                                                 E++PV RRDSH +++CG  +     +      ++L+FDNSYS+WR KWLYYRV Y+
Sbjct:  165 EEENKLRSILNQQTFPQFHNYAVQQHPEDSKSQEQLIAQLQQHHFHQYMLAIYERNRTTSETNGDIPRQSTNASLEKEPIEDLHEQSLVEIEIKENGYAYEHENASYTADMVE--MWCESAINEFKTS-FKTEPDSVMKIGSGEVVTIRVPASATNNYLIWQFVTDECDIGFGVSVSSEVSGQPNTT-------------------------------------------------EIVPVLRRDSHKQIFCGKIKLLKNSSGKDQLFFLLRFDNSYSLWRHKWLYYRVCYS 404          
The following BLAST results are available for this feature:
BLAST of Golgi resident protein GCP60 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ACBD32.289e-4648.90acyl-CoA binding domain containing 3 [Source:HGNC ... [more]
TMED82.872e-3845.60transmembrane p24 trafficking protein family membe... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y41E3.71.045e-6447.62pep chromosome:WBcel235:IV:15014062:15025499:1 gen... [more]
Y41E3.71.089e-6448.20pep chromosome:WBcel235:IV:15014062:15025499:1 gen... [more]
Y41E3.71.089e-6448.20pep chromosome:WBcel235:IV:15019906:15025499:1 gen... [more]
Y41E3.72.435e-6448.20pep chromosome:WBcel235:IV:15014042:15025499:1 gen... [more]
Y41E3.79.263e-6448.20pep chromosome:WBcel235:IV:15014042:15025513:1 gen... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG142327.280e-4745.60gene:FBgn0031061 transcript:FBtr0074813[more]
CG142327.280e-4745.60gene:FBgn0031061 transcript:FBtr0309218[more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1629641.835e-5337.84zgc:162964 [Source:ZFIN;Acc:ZDB-GENE-030131-9798][more]
tmed84.058e-4348.59transmembrane p24 trafficking protein 8 [Source:ZF... [more]
tmed84.058e-4348.59transmembrane p24 trafficking protein 8 [Source:ZF... [more]
tmed85.175e-4348.59transmembrane p24 trafficking protein 8 [Source:ZF... [more]
acbd31.721e-4251.40acyl-Coenzyme A binding domain containing 3 [Sourc... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acbd32.676e-4749.75acyl-CoA binding domain containing 3 [Source:NCBI ... [more]
fut99.749e-3542.29fucosyltransferase 9 (alpha (1,3) fucosyltransfera... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Acbd34.901e-4653.30acyl-Coenzyme A binding domain containing 3 [Sourc... [more]
Tmed81.818e-3845.08transmembrane p24 trafficking protein 8 [Source:MG... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H3P7|GCP60_HUMAN1.099e-4548.90Golgi resident protein GCP60 OS=Homo sapiens OX=96... [more]
sp|Q8BMP6|GCP60_MOUSE3.429e-4553.30Golgi resident protein GCP60 OS=Mus musculus OX=10... [more]
sp|Q7TNY6|GCP60_RAT7.047e-4552.20Golgi resident protein GCP60 OS=Rattus norvegicus ... [more]
sp|Q3UHI4|TMED8_MOUSE1.272e-3745.08Protein TMED8 OS=Mus musculus OX=10090 GN=Tmed8 PE... [more]
sp|Q6PL24|TMED8_HUMAN1.379e-3745.60Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D0Z01.009e-8953.05Golgi resident protein OS=Schistosoma japonicum OX... [more]
A0A4E0RC494.015e-8950.49Protein involved in maintenance of golgi structure... [more]
A0A504YL617.687e-8949.22Protein involved in maintenance of golgi structure... [more]
G4V7E52.383e-8852.20GOLD domain-containing protein OS=Schistosoma mans... [more]
A0A0V0J5B47.080e-8856.49Golgi resident protein GCP60 OS=Schistocephalus so... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1629641.727e-4739.86Golgi resident protein GCP60 [Source:NCBI gene;Acc... [more]
zgc:1629645.769e-4740.28Golgi resident protein GCP60 [Source:NCBI gene;Acc... [more]
zgc:1629647.468e-4537.76Golgi resident protein GCP60 [Source:NCBI gene;Acc... [more]
acbd31.918e-4251.40acyl-CoA binding domain containing 3 [Source:NCBI ... [more]
acbd33.017e-4147.49acyl-CoA binding domain containing 3 [Source:NCBI ... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008311.18.481e-1844.16pep scaffold:Pmarinus_7.0:GL476355:227612:229659:-... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO391493.180e-4646.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmed81.857e-4450.85transmembrane p24 trafficking protein family membe... [more]
acbd33.592e-4347.49acyl-CoA binding domain containing 3 [Source:NCBI ... [more]
tmed87.309e-2645.64transmembrane p24 trafficking protein family membe... [more]
back to top
BLAST of Golgi resident protein GCP60 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000069590.10.000e+099.68SMESG000069590.1[more]
SMESG000069590.10.000e+0100.00SMESG000069590.1[more]
SMESG000035132.14.928e-8453.55SMESG000035132.1[more]
SMESG000008119.11.751e-2629.11SMESG000008119.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027907 ID=SMED30027907|Name=Golgi resident protein GCP60|organism=Schmidtea mediterranea sexual|type=transcript|length=1256bp
TTATAATGTATCTTTAGTTTACATTCATCAAATATTTTAGTGATAAAATT
TCAAAATGTCTGAAGTTAATTTACCAACTGAATCGAATGAAAGCGGTTTT
ATTGAGCAAATGAGTGATTTATCGTTGAATGAAAACCCATTAAATGATAA
TAACCCAATAACTGATTCTTCTGAAATAGAATCTCAAATAAGATCAGCAT
TAAATCAGCAAACTATTATTCAGTATCGTCAATATGCTGCTGAGCAACAT
CCGAAAGAATTGCATAAACAAGAAGAGTTAATTAAACAGTTACAAGAACA
ATATTTTCAACAATATATTAGTCAAGTATTTGAAGTTCAGAAAGTATATC
AGCGTCAACAAATCGACCAGTTGAAGAATATATATTTACAACAACTGGAA
GAATCGGAAACTAATTCAAATGCAGATCTCGACGGTTTATTTCCGGCTTT
ACCACTTGTTCCAGCGAACTTGTGGACTAGGAAAGATATATCGGAATTCA
AAGCCGACATATTAAAGCATCAAAGAGAATGCTGCATAAAAATAGGATCT
TTATCAACAGCCACAGTTCGAGTACCGACTCATCCTGATGGTCGGTGTGT
TTTCTGGGAATTTGCTACAGATTATTATGATCTTGGATTTGGTGTGTACT
TTGAGTGGAACGTCCAGCCGTCTGAAAACATTACTGTACATATCTCCGAA
TCCAGCGATGAAGAAGAATTCGAAGAAGAATCACCATCAGTTGAAAACCA
TAAATCCGAAGACCCTGAAGAAATTCAACAAGATGATCTGGAAAAAGGCC
GATCGAAAAAAGGCAATAATACACCGACAGACGAGTTGATTCCCGTCTAT
CGCAGAGACTCTCATCTAGAGGTTTATTGTGGCAGTCACCAATATCCAGG
AAGGGGAACTTATATATTGAAGTTTGATAACTCCTATTCGGTTTGGCGGT
CCAAGTGGCTTTATTATCGAGTATATTATACCAAATAGATTAGCACACAA
CTATCAGACAGAAAACAATGCAGACTCGGTTGTCATTCTTTGTGACAATT
GATTCATTGTTTTTATTTCATTTGTATAAGCATATACAAATTTACTTAAC
ATTCATTGGTTGGTTGTTTGATTGATTGAATTTTTGGTTAATTGATTGAT
TAGTTGGTTGATTGATTGGCTGATCGATTAGTTGGTTAATTGATTAGCTT
GTTAATTGATTGGCTGATTGATTGATTTGTTAATTGATTGATTGGCTGAT
CGATTA
back to top

protein sequence of SMED30027907-orf-1

>SMED30027907-orf-1 ID=SMED30027907-orf-1|Name=SMED30027907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MSEVNLPTESNESGFIEQMSDLSLNENPLNDNNPITDSSEIESQIRSALN
QQTIIQYRQYAAEQHPKELHKQEELIKQLQEQYFQQYISQVFEVQKVYQR
QQIDQLKNIYLQQLEESETNSNADLDGLFPALPLVPANLWTRKDISEFKA
DILKHQRECCIKIGSLSTATVRVPTHPDGRCVFWEFATDYYDLGFGVYFE
WNVQPSENITVHISESSDEEEFEEESPSVENHKSEDPEEIQQDDLEKGRS
KKGNNTPTDELIPVYRRDSHLEVYCGSHQYPGRGTYILKFDNSYSVWRSK
WLYYRVYYTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000062fatty-acyl-CoA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036598GOLD_dom_sf
IPR009038GOLD_dom
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 62..82
NoneNo IPR availableGENE3DG3DSA:2.60.120.680coord: 130..232
e-value: 1.0E-22
score: 82.3
coord: 240..310
e-value: 1.1E-21
score: 78.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..254
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 214..260
NoneNo IPR availablePANTHERPTHR22973FAMILY NOT NAMEDcoord: 38..310
IPR009038GOLD domainPFAMPF13897GOLD_2coord: 168..309
e-value: 3.2E-60
score: 202.6
IPR009038GOLD domainPROSITEPS50866GOLDcoord: 142..308
score: 8.607
IPR036598GOLD domain superfamilySUPERFAMILYSSF101576Supernatant protein factor (SPF), C-terminal domaincoord: 161..309