pre-mRNA-processing factor 19

Overview
Namepre-mRNA-processing factor 19
Smed IDSMED30027904
Length (bp)1730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of pre-mRNA-processing factor 19 (SMED30027904) t-SNE clustered cells

Violin plots show distribution of expression levels for pre-mRNA-processing factor 19 (SMED30027904) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of pre-mRNA-processing factor 19 (SMED30027904) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for pre-mRNA-processing factor 19 (SMED30027904) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Human
Match: PRPF19 (pre-mRNA processing factor 19 [Source:HGNC Symbol;Acc:HGNC:17896])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 276/515 (53.59%), Postives = 376/515 (73.01%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S+ QI+ TLKGHTKKV+ VV+H S ++  +ASPD+TIR+W + +ASC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Human
Match: PRPF19 (pre-mRNA processing factor 19 [Source:HGNC Symbol;Acc:HGNC:17896])

HSP 1 Score: 273.478 bits (698), Expect = 8.379e-88
Identity = 135/254 (53.15%), Postives = 183/254 (72.05%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFN 857
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG    ++ PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TG  D    +++
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAG----LIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGTMDSQIKIWD 250          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Human
Match: PRPF19 (pre-mRNA processing factor 19 [Source:HGNC Symbol;Acc:HGNC:17896])

HSP 1 Score: 111.694 bits (278), Expect = 8.868e-29
Identity = 59/108 (54.63%), Postives = 78/108 (72.22%), Query Frame = 3
Query:  351 MLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKK 674
            ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG    ++ PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKK
Sbjct:    1 MLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAG----LIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKK 104          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Human
Match: KATNB1 (katanin regulatory subunit B1 [Source:HGNC Symbol;Acc:HGNC:6217])

HSP 1 Score: 106.301 bits (264), Expect = 2.305e-23
Identity = 72/254 (28.35%), Postives = 115/254 (45.28%), Query Frame = 3
Query:  777 IVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTL--SPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVYLSKQWE 1529
            + +L + K     + TGG+D    +++ +    + +L GHT  V  V  +  +E+ V  S   +IRVW ++ A     +  H  N+  L  H  G +V S S D      DI     + R++  H+     Q++ C++  PDG   A+  +D  V +W+L   K ++  P  T G V  + F  N + LA+G SD  I+ WDL K +    +   PG  R+        F+  G  L     D +RVY    WE
Sbjct:   23 VSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRG-HS-----QAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT-GPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVL------FNPDGCCLYSGCQDSLRVY---GWE 260          

HSP 2 Score: 71.2478 bits (173), Expect = 2.923e-12
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  951 ASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSL-HATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            A+P  T   WK+ +      I AH  NV+ L L  A+G  + +  +D       I     IM   SL   T  ++S+    + P+ LI A G++ G + +W+L+  K +   + H  N  + +L F   G ++A+G  D  IKLWD+R+   V  ++    G  +A   +  L F   G +L  A  D  V+++     + +  F  H+G    V F  N   + S S DRT++ +
Sbjct:    2 ATPVVTKTAWKLQE------IVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIM---SLTGHTSPVESVRL--NTPEELIVA-GSQSGSIRVWDLEAAKILRTLMGHKAN--ICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYR----GHSQA---VRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Human
Match: PRPF19 (pre-mRNA processing factor 19 [Source:HGNC Symbol;Acc:HGNC:17896])

HSP 1 Score: 96.2857 bits (238), Expect = 3.380e-23
Identity = 59/183 (32.24%), Postives = 84/183 (45.90%), Query Frame = 3
Query: 1092 YWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            YWAFSDI TG+V+ +   + ++T    SLTC + HPD                                           G    TG  D  IK+WDL+                  +  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 YWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPD-------------------------------------------GLIFGTGTMDSQIKIWDLK------------------VKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 118          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Celegans
Match: prp-19 (Pre-mRNA-processing factor 19 [Source:UniProtKB/Swiss-Prot;Acc:Q10051])

HSP 1 Score: 442.195 bits (1136), Expect = 1.856e-150
Identity = 229/516 (44.38%), Postives = 332/516 (64.34%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVP-MHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MS +C IS E+ E PV++++SGH++++RLI K++  +  DP++  + S D L+ +K       P+  S TSIP+LLK  QDEWD +ML  F+++Q+ Q  ++ELSH+LYQ+DA+CRV++RL+KE+TAAREALSTLKP    TS  V    S  E E            +  G+S+ I  +L+EKS+ LT+ERK+RGK +PE LA+   +       + TG+HS   PGI ALD+    S   +TGG DK  V+++    Q++ T KGH KK++ VV H  +  A++AS DS IRVW   D+S + +I  H   VT +SL+A+G+Y+LS+S+D YWAFSDI +GK + +         A+ S+   + HPDGLI  TG  D  V IW+LK     A  P  T  +VR++AFSENG+YLATG  DG +KLWDLRK+++ KT +   +     IN L FD +G++LG+ G  V+V   K W  VVS SDHSG  TGVRFGENA ++++ S+D+++++++
Sbjct:    1 MSFVCGISGELTEDPVVSQVSGHIFDRRLIVKFIAENGTDPISHGELSEDQLVSLKSGGTGSAPRNVSGTSIPSLLKMLQDEWDTVMLNSFSLRQQLQIARQELSHSLYQHDAACRVISRLSKELTAAREALSTLKPH---TSAKVDDDVSIDESE------------DQQGLSEAILAKLEEKSKSLTAERKQRGKNLPEGLAKTEELAELKQTASHTGIHSTGTPGITALDIKGNLS---LTGGIDKTVVLYDYEKEQVMQTFKGHNKKINAVVLHPDNITAISASADSHIRVWSATDSSSKAIIDVHQAPVTDISLNASGDYILSASDDSYWAFSDIRSGKSLCKVSVEPGSQIAVHSI---EFHPDGLIFGTGAADAVVKIWDLKNQTVAAAFPGHT-AAVRSIAFSENGYYLATGSEDGEVKLWDLRKLKNLKTFA---NEEKQPINSLSFDMTGTFLGIGGQKVQVLHVKSWSEVVSLSDHSGPVTGVRFGENARSLVTCSLDKSLRVFS 491          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Celegans
Match: prp-4 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q93339])

HSP 1 Score: 107.071 bits (266), Expect = 2.161e-24
Identity = 88/359 (24.51%), Postives = 157/359 (43.73%), Query Frame = 3
Query:  621 IEIQLQEKSQMLTSERKK--RGKQMPEDLARPSSMESFVVKNT-----QTGLHSASIPGI--VALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHN--------SDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            IE+++   S    S RK   R  +  E+ ARP+  ++   +       Q  LH++ +     VA      DS  I+T G   +  V+            GH+ +  C  +H         S    V+ S D T+ +W +   S    +  H   V+ ++ H  G+++ ++  D  W   D+ T K ++ +Q  H+K+ A  +      HPDG +  TG  D    +W+++  + + FL   T   + ++ +  NG+ + TG SD  +K+WDLR  R+  T+       T  +  +  D +G YL  A  D  ++++ +  W+ +     H      V    +   + SS+ DRT KL+A
Sbjct:  145 IELRMARVSIADFSLRKAKLRLDKAREEAARPAHEKALARQEAHKWVQQINLHASQVADTRPVAFCEFSADSEHIVTAGWSGSVAVWKREQCAQEIKFIGHSSQAGCARFHPGAFTQNDYSSLNVVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELL-YQEGHSKSVADVAF-----HPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTK-EIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPAH----TSVVTRVRADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWMCSSAFDRTFKLWA 492          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 87.4261 bits (215), Expect = 2.134e-18
Identity = 65/274 (23.72%), Postives = 123/274 (44.89%), Query Frame = 3
Query:  717 MESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGG--------NDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYL 1514
            ++   V N   G  SA  P      +S  + +     G        N   A    ++N +++CTL+GHTK +S   +    +   T+S D T+++W +D   CE  +  H   V  ++  +    V+S+S+D      +I T ++    +  +N       + C   +P   +  +G+ D  V IW++K    +  LP  ++  V  ++F+ +G  +A+G  DGL+++WD    +  KTL    D     +  ++F  +G Y+  +  D  + L
Sbjct:   19 IDQLTVPNAPDGGSSAPAPSTSPNSISPSNPTGTPAPGASAQTPNPNAAGASASGSANYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNY------VFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSD-PVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLV---DDENPPVAFVKFSPNGKYILASNLDSTLKL 282          

HSP 2 Score: 68.1662 bits (165), Expect = 4.091e-12
Identity = 53/227 (23.35%), Postives = 97/227 (42.73%), Query Frame = 3
Query:  714 SMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFS-ENGFYLATGGSDGLIKLWDLR 1388
            +M+  + + T TG H   +  I        DS  +++  +DK   +F    +++  TLKGH   V C  ++    + V+ S D ++R+W +    C   + AH+  V+ +S +  G+ + S S DG     D   G+ I       N   A      +K  P+G        D  + +W+  + K +  +  H  +       FS   G ++ +G  D  I +W+L+
Sbjct:  115 NMDHMICERTLTG-HKLGVNDIAW----SSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAF-----VKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQ 331          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 87.4261 bits (215), Expect = 2.134e-18
Identity = 65/274 (23.72%), Postives = 123/274 (44.89%), Query Frame = 3
Query:  717 MESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGG--------NDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYL 1514
            ++   V N   G  SA  P      +S  + +     G        N   A    ++N +++CTL+GHTK +S   +    +   T+S D T+++W +D   CE  +  H   V  ++  +    V+S+S+D      +I T ++    +  +N       + C   +P   +  +G+ D  V IW++K    +  LP  ++  V  ++F+ +G  +A+G  DGL+++WD    +  KTL    D     +  ++F  +G Y+  +  D  + L
Sbjct:   19 IDQLTVPNAPDGGSSAPAPSTSPNSISPSNPTGTPAPGASAQTPNPNAAGASASGSANYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNY------VFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSD-PVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLV---DDENPPVAFVKFSPNGKYILASNLDSTLKL 282          

HSP 2 Score: 68.1662 bits (165), Expect = 4.091e-12
Identity = 53/227 (23.35%), Postives = 97/227 (42.73%), Query Frame = 3
Query:  714 SMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFS-ENGFYLATGGSDGLIKLWDLR 1388
            +M+  + + T TG H   +  I        DS  +++  +DK   +F    +++  TLKGH   V C  ++    + V+ S D ++R+W +    C   + AH+  V+ +S +  G+ + S S DG     D   G+ I       N   A      +K  P+G        D  + +W+  + K +  +  H  +       FS   G ++ +G  D  I +W+L+
Sbjct:  115 NMDHMICERTLTG-HKLGVNDIAW----SSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAF-----VKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQ 331          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 80.4925 bits (197), Expect = 1.128e-15
Identity = 68/257 (26.46%), Postives = 122/257 (47.47%), Query Frame = 3
Query:  885 LKGHTKKV-SCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYL--GVAGTDVRVY---LSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            L+GH   V +C+  H  D++ VT S D+T++VW ID     + +  HTG V    +   G Y++S S D          G +      LH       ++ CM     G I  TG+ D  + +W+++  + +A L H  + +VR + F  +G  + +GG D  +K+W+    R  +TL+  ++R    +  L F++  S +  G   T +RV+     +  E V     H+ L +G++     N ++S + D  V+++
Sbjct:  249 LRGHEDHVITCMQIH--DDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSL------LHTLQGHTSTVRCMAMA--GSILVTGSRDTTLRVWDVESGRHLATL-HGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNR----VYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQL--RGNILVSCNADSHVRVW 486          

HSP 2 Score: 67.781 bits (164), Expect = 1.049e-11
Identity = 49/197 (24.87%), Postives = 95/197 (48.22%), Query Frame = 3
Query:  732 VKNTQTGLHSASIPGI-VALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKI---DDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKE---VKKVAFLPHTTNG 1301
            V + ++G H A++ G   A+   + D + +++GG D    ++N    + + TL GH  +V  +++ +   I  + S D++IRVW     +   C  +++ HT   +G+ L   GN ++S + D +    DI+ G  +     L     AI SL     +    + AT ++DG V +W+++    ++ +  L    NG
Sbjct:  360 VWDVESGRHLATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLR--GNILVSCNADSHVRVWDIHEGTCV---HMLSGHRSAITSLQWFGRN----MVATSSDDGTVKLWDIERGALIRDLVTLDSGGNG 547          

HSP 3 Score: 65.0846 bits (157), Expect = 8.833e-11
Identity = 72/284 (25.35%), Postives = 123/284 (43.31%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---------VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVR-FGENANTIISSSVDRTVKLY 1637
            ++TG +D    V+     +++ TL GHT  V            V+ S D T++VW   D S  H ++ HT  V  +++   G+ +++ S D      D+ +G+ +    +LH    A++   C++   DG    +G  D  V IWN    + +  L    N  V +L F      + +G  D  I++WD  +         ++   +L+ G      + N L   N+ S+       VRV+   +   V   S H    T ++ FG N   + +SS D TVKL+
Sbjct:  267 LVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAM--AGSILVTGSRDTTLRVWDVESGRHL---ATLHGHHAAVR---CVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLT-GHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSG---MQLRGNILVSCNADSH-------VRVWDIHEGTCVHMLSGHRSAITSLQWFGRNM--VATSSDDGTVKLW 527          

HSP 4 Score: 60.4622 bits (145), Expect = 2.414e-9
Identity = 52/210 (24.76%), Postives = 83/210 (39.52%), Query Frame = 3
Query:  810 SKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDG---YWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPG 1421
            S ++TG  D    V++  + + + TL GH   V CV +  +    V+   D T+++W      C   +  H   V  L   +  + V S S D     W F+     + +   Q   + T  +Q          G I  +   D  V +W++ E   V  L    +       F  N   +AT   DG +KLWD+ +   +RD  TL  G
Sbjct:  347 SILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFDGT--TVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQ--------LRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQWFGRN--MVATSSDDGTVKLWDIERGALIRDLVTLDSG 544          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Fly
Match: Prp19 (gene:FBgn0261119 transcript:FBtr0086723)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 269/515 (52.23%), Postives = 369/515 (71.65%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            M+L+C+++NE+PE PV++  SG V+EKR+IEKYL  +  DP++G +   ++LIEIK P  VKPKPPS TSIPA LK+ QDEWDALM+  FT +Q+ Q  ++ELSHALYQ+DA+CRV+ RL KEV AAREAL+TLKPQAGI +   P    Q     E   +  H +++A GMS E+  +LQ+K+ +LT ERKKRG+ +PEDL     +++F+   +  GLHSAS+PGI+ALD++  D SKI+TGGNDKNA VFN    Q+V  LKGHTKK++ V+YH +++  +T SPD  IR+W +  +  + ++R H G VTGLSLH TG+Y+LS+S+D +WAFSDI TG+++ +   + +  E    LT  + HPDGLI  TGT D +V IW+LKE   VA  P  T G +  ++FSENG+YLAT   D  +KLWDLRK+++FKT+   D    Y++ DL FD SG+YL +AG+DVRVYL KQW+ +  F+DH+ LATGVRFG++A  + S+S+DRT+KLYA
Sbjct:    1 MALVCALTNEVPETPVVSPHSGAVFEKRVIEKYLLENGCDPISGKELKPEELIEIKTPAVVKPKPPSATSIPATLKTMQDEWDALMIHSFTQRQQLQTTRQELSHALYQHDAACRVIARLNKEVAAAREALATLKPQAGIAN--APTAIPQPALASEAGGAAAHPMEQA-GMSAEVIQKLQDKATVLTQERKKRGRTVPEDLVTTDQVKNFLTVASHPGLHSASVPGILALDINSADHSKILTGGNDKNATVFNKDTEQMVAILKGHTKKITKVIYHPNEDTVITGSPDMNIRIWHVPTSQTQLLLRCHEGPVTGLSLHPTGDYLLSTSSDKHWAFSDIRTGRLLTK---VIDTAEV--GLTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANFPGHT-GPISAISFSENGYYLATAADDACVKLWDLRKLKNFKTIQLDDG---YEVKDLCFDQSGTYLAIAGSDVRVYLCKQWQELKVFNDHTALATGVRFGKHAQYLASTSMDRTLKLYA 503          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Fly
Match: U4-U6-60K (gene:FBgn0036733 transcript:FBtr0075209)

HSP 1 Score: 99.7525 bits (247), Expect = 9.384e-22
Identity = 71/277 (25.63%), Postives = 130/277 (46.93%), Query Frame = 3
Query:  849 VFNTSNNQIVCTLKGHTKKVSCVVYH---NSDEIAVTASP----DSTIRVWKIDDASCEHVIRAHTGN-VTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNS-GSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            +++  + ++  TL+GH   V  V       +DE  V A      D  +++W  ++      I  H  + V+ ++ H +G ++ ++  D  W   D+     ++ HQ  H K      + C+  H DG +  TG  D    +W+L+  + + FL     G+V  + FS NGF++ATG  D   K+WDLR+ +   T+       T  I+D+++    GS+L     D   +++ +K W+ + +   H      V    N+  I ++S DRT KL++ +
Sbjct:  287 LWSVPDCELKQTLRGHASYVGGVALRPGVKADEENVVAMASGGHDGAVKLWGFNNEESIADITGHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVL-HQEGHAK-----PVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHL-GAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPA----HTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPD 552          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Fly
Match: kat80 (gene:FBgn0040207 transcript:FBtr0074246)

HSP 1 Score: 87.4261 bits (215), Expect = 1.319e-17
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 3
Query:  852 FNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKI-DDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGL 1367
            ++ ++ +I  TL GH K V  + ++ S E  V+ S D+T+R+W + ++ +C  V R H  +V  +     G ++ S+  +G     DI   K IM   +       + ++TC++ HP   + A G  DG VSI++L+  + V+   H    ++R + FS+NG  L  G S G+
Sbjct:   87 WDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIA----DPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGI 255          

HSP 2 Score: 84.7297 bits (208), Expect = 9.973e-17
Identity = 48/191 (25.13%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDL 1385
            ++TGG D+N  ++    N+   +L GH + + CV +   D    +A     IR W ++       +  H  +V  L  + +G YV+S SND      D+      ++    H     +  +  +K  PDGL  A+   +G + IW++++ K++  F+      ++  + F    F LA G  DG + ++DL
Sbjct:   33 LVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGH-----MSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL 218          

HSP 3 Score: 63.5438 bits (153), Expect = 3.489e-10
Identity = 41/195 (21.03%), Postives = 87/195 (44.62%), Query Frame = 3
Query:  885 LKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEF 1460
            +K H  +V+ +    +  + VT   D  + +W I    C   +  H  ++  +      N+V S+ + G     D+ + K+   + +L+   +++++L     +P G    +G+ D  V +W+++       +       V ++ FS +G ++A+ G +G I +WD+RK   + +F    P       Q +  EF
Sbjct:   14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKI---YSTLNGHMKSVRTLDF---NPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEF 202          

HSP 4 Score: 53.1434 bits (126), Expect = 5.876e-7
Identity = 54/220 (24.55%), Postives = 105/220 (47.73%), Query Frame = 3
Query: 1011 IRAHTGNVTGLSLHATGNYVLSSSND---GYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMK-SHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNG---SVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSF-SDHSGLA-TGVRFGENANTIISSSVDRTVKLY 1637
            I+AH   VT L L  TG  +++   D     WA         I +++   + T   +S+ C++ ++ D  +  +  + G +  W+L   K  +    T NG   SVRTL F+ +G Y+ +G +D  ++LWD++   +   +  G       +N ++F   G ++  AG +  + ++  ++ ++++ F +D    A T V+F      + +  VD TV +Y
Sbjct:   14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWA---------IGQNECFMSLTGHNRSIDCVRFAYKDNFV-YSADDIGIIRRWDLNSQKIYS----TLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGH---MSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIY 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Fly
Match: kat80 (gene:FBgn0040207 transcript:FBtr0074247)

HSP 1 Score: 87.4261 bits (215), Expect = 1.319e-17
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 3
Query:  852 FNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKI-DDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGL 1367
            ++ ++ +I  TL GH K V  + ++ S E  V+ S D+T+R+W + ++ +C  V R H  +V  +     G ++ S+  +G     DI   K IM   +       + ++TC++ HP   + A G  DG VSI++L+  + V+   H    ++R + FS+NG  L  G S G+
Sbjct:   87 WDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIA----DPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGI 255          

HSP 2 Score: 84.7297 bits (208), Expect = 9.973e-17
Identity = 48/191 (25.13%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDL 1385
            ++TGG D+N  ++    N+   +L GH + + CV +   D    +A     IR W ++       +  H  +V  L  + +G YV+S SND      D+      ++    H     +  +  +K  PDGL  A+   +G + IW++++ K++  F+      ++  + F    F LA G  DG + ++DL
Sbjct:   33 LVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGH-----MSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL 218          

HSP 3 Score: 63.5438 bits (153), Expect = 3.489e-10
Identity = 41/195 (21.03%), Postives = 87/195 (44.62%), Query Frame = 3
Query:  885 LKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEF 1460
            +K H  +V+ +    +  + VT   D  + +W I    C   +  H  ++  +      N+V S+ + G     D+ + K+   + +L+   +++++L     +P G    +G+ D  V +W+++       +       V ++ FS +G ++A+ G +G I +WD+RK   + +F    P       Q +  EF
Sbjct:   14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKI---YSTLNGHMKSVRTLDF---NPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEF 202          

HSP 4 Score: 53.1434 bits (126), Expect = 5.876e-7
Identity = 54/220 (24.55%), Postives = 105/220 (47.73%), Query Frame = 3
Query: 1011 IRAHTGNVTGLSLHATGNYVLSSSND---GYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMK-SHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNG---SVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSF-SDHSGLA-TGVRFGENANTIISSSVDRTVKLY 1637
            I+AH   VT L L  TG  +++   D     WA         I +++   + T   +S+ C++ ++ D  +  +  + G +  W+L   K  +    T NG   SVRTL F+ +G Y+ +G +D  ++LWD++   +   +  G       +N ++F   G ++  AG +  + ++  ++ ++++ F +D    A T V+F      + +  VD TV +Y
Sbjct:   14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWA---------IGQNECFMSLTGHNRSIDCVRFAYKDNFV-YSADDIGIIRRWDLNSQKIYS----TLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGH---MSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIY 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Fly
Match: kat80 (gene:FBgn0040207 transcript:FBtr0340443)

HSP 1 Score: 87.0409 bits (214), Expect = 1.451e-17
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 3
Query:  852 FNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKI-DDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGL 1367
            ++ ++ +I  TL GH K V  + ++ S E  V+ S D+T+R+W + ++ +C  V R H  +V  +     G ++ S+  +G     DI   K IM   +       + ++TC++ HP   + A G  DG VSI++L+  + V+   H    ++R + FS+NG  L  G S G+
Sbjct:   87 WDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIA----DPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGI 255          

HSP 2 Score: 84.3445 bits (207), Expect = 1.068e-16
Identity = 48/191 (25.13%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDL 1385
            ++TGG D+N  ++    N+   +L GH + + CV +   D    +A     IR W ++       +  H  +V  L  + +G YV+S SND      D+      ++    H     +  +  +K  PDGL  A+   +G + IW++++ K++  F+      ++  + F    F LA G  DG + ++DL
Sbjct:   33 LVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGH-----MSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL 218          

HSP 3 Score: 63.5438 bits (153), Expect = 3.672e-10
Identity = 41/195 (21.03%), Postives = 87/195 (44.62%), Query Frame = 3
Query:  885 LKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEF 1460
            +K H  +V+ +    +  + VT   D  + +W I    C   +  H  ++  +      N+V S+ + G     D+ + K+   + +L+   +++++L     +P G    +G+ D  V +W+++       +       V ++ FS +G ++A+ G +G I +WD+RK   + +F    P       Q +  EF
Sbjct:   14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKI---YSTLNGHMKSVRTLDF---NPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEF 202          

HSP 4 Score: 53.1434 bits (126), Expect = 6.346e-7
Identity = 54/220 (24.55%), Postives = 105/220 (47.73%), Query Frame = 3
Query: 1011 IRAHTGNVTGLSLHATGNYVLSSSND---GYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMK-SHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNG---SVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSF-SDHSGLA-TGVRFGENANTIISSSVDRTVKLY 1637
            I+AH   VT L L  TG  +++   D     WA         I +++   + T   +S+ C++ ++ D  +  +  + G +  W+L   K  +    T NG   SVRTL F+ +G Y+ +G +D  ++LWD++   +   +  G       +N ++F   G ++  AG +  + ++  ++ ++++ F +D    A T V+F      + +  VD TV +Y
Sbjct:   14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWA---------IGQNECFMSLTGHNRSIDCVRFAYKDNFV-YSADDIGIIRRWDLNSQKIYS----TLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGH---MSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIY 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Zebrafish
Match: prpf19 (pre-mRNA processing factor 19 [Source:ZFIN;Acc:ZDB-GENE-030131-263])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 272/515 (52.82%), Postives = 368/515 (71.46%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL+C+ISNE+PE P ++ +S  V+E+RLIEKY+  +  DP+ G   S + LI+IKV   ++PK PS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+ +    P +  +      E      V E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L R   +  +    +  GLHSAS+PGI++LD+   D++K++TGG DKN VVF+    QIV TLKGHTKKVS V+YH +  +  +AS DSTIRVW +   +C  V+RAH   VTGLSLHATG+Y+LSSS D YWAFSDI TG+V+ +   + ++T    +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P  + G V  +AFSENG+YLATG  D  +KLWDLRK+++FKT++  ++   Y++  L FD SG+YL V G+D+RVY+ KQW  V++FSDHSGL TGV FGE+A  + S+ +DR++K Y+
Sbjct:    1 MSLVCAISNEVPEHPCVSPVSNQVFERRLIEKYIAENGADPINGQPLSEEQLIDIKVSHPIRPKAPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLVAPQAAPASQPAAVGAGGEA---MEVSEQVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVRAEDLSKYRQVGSHAGLHSASVPGILSLDLCPTDTNKVLTGGADKNVVVFDRREEQIVATLKGHTKKVSSVIYHPAQAVVFSASSDSTIRVWSVTGGNCVQVVRAHESAVTGLSLHATGDYLLSSSEDQYWAFSDIQTGRVLTK---VTDETAGC-ALTCAQFHPDGLIFGTGTGDSQIKIWDLKERTNVANFPGHS-GPVTAIAFSENGYYLATGAQDSSLKLWDLRKLKNFKTITLDNN---YEVKSLVFDQSGTYLAVGGSDIRVYICKQWSEVLNFSDHSGLVTGVAFGEHAQFLASTGMDRSLKFYS 504          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Zebrafish
Match: prpf4 (PRP4 pre-mRNA processing factor 4 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-5143])

HSP 1 Score: 111.309 bits (277), Expect = 1.696e-25
Identity = 73/291 (25.09%), Postives = 133/291 (45.70%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYH--------NSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRAT---YQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            +S  ++T        ++   +  ++ TL+GH   V  + +H         SD    + + D ++++W +D       I  H+  V  ++ H +G ++ ++  D  W   D+   + I+ HQ  H+K      +  +  HPDG +  TG  D    +W+L+  + V FL       + ++ FS NGF++ATG  D   K+WDLR+ R   T+    +  +   +Q ND  +  +G+Y   A    +++    W  + + + H G   GV    +   I + S DRT KL+ S
Sbjct:  227 NSKLLVTASWSGLCKLWKVPDCTLIRTLRGHNTNVGAISFHPQATLTLEESDVNMASCAADGSVKLWSLDSDEPIADIEGHSMRVARVTWHPSGRFLGTTCYDHSWRLWDLEVQEEIL-HQEGHSK-----GVHDLHFHPDGSLAGTGGLDSFARVWDLRTGRCVMFLEGHIK-EIYSINFSPNGFHVATGSGDNACKVWDLRQRRCIYTIPAHQNLVSSVKFQPNDGHYLLTGAYDNTA----KIWTHPGWSPLKTLAGHEGKVMGVDLSPDGQLIATCSYDRTFKLWMS 506          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Zebrafish
Match: prpf4 (PRP4 pre-mRNA processing factor 4 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-5143])

HSP 1 Score: 111.309 bits (277), Expect = 1.696e-25
Identity = 73/291 (25.09%), Postives = 133/291 (45.70%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYH--------NSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRAT---YQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            +S  ++T        ++   +  ++ TL+GH   V  + +H         SD    + + D ++++W +D       I  H+  V  ++ H +G ++ ++  D  W   D+   + I+ HQ  H+K      +  +  HPDG +  TG  D    +W+L+  + V FL       + ++ FS NGF++ATG  D   K+WDLR+ R   T+    +  +   +Q ND  +  +G+Y   A    +++    W  + + + H G   GV    +   I + S DRT KL+ S
Sbjct:  227 NSKLLVTASWSGLCKLWKVPDCTLIRTLRGHNTNVGAISFHPQATLTLEESDVNMASCAADGSVKLWSLDSDEPIADIEGHSMRVARVTWHPSGRFLGTTCYDHSWRLWDLEVQEEIL-HQEGHSK-----GVHDLHFHPDGSLAGTGGLDSFARVWDLRTGRCVMFLEGHIK-EIYSINFSPNGFHVATGSGDNACKVWDLRQRRCIYTIPAHQNLVSSVKFQPNDGHYLLTGAYDNTA----KIWTHPGWSPLKTLAGHEGKVMGVDLSPDGQLIATCSYDRTFKLWMS 506          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Zebrafish
Match: katnb1 (katanin p80 (WD repeat containing) subunit B 1 [Source:NCBI gene;Acc:406291])

HSP 1 Score: 101.679 bits (252), Expect = 7.104e-24
Identity = 60/213 (28.17%), Postives = 106/213 (49.77%), Query Frame = 3
Query:  756 HSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK 1391
            HS+++  +V   + K     + TGG D    ++  S    + +L GHT  V C+ +++S+E  V  S   ++R+W ++ A     +  H  +++ L  H  G Y+ S S D      D+     + R++     T+A++   C+   PDG   A+ ++D  V +W+L   K +  F  HT+  +V  + F  N + LA+G +D  +KLWDL K
Sbjct:   19 HSSNVSSLV---LGKSSGRLLATGGEDCRVNIWAVSKPNCIMSLTGHTSAVGCIQFNSSEERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYK---GHTQAVR---CLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHTS--AVNVVQFHPNEYLLASGSADRTVKLWDLEK 220          

HSP 2 Score: 65.4698 bits (158), Expect = 2.148e-11
Identity = 69/242 (28.51%), Postives = 106/242 (43.80%), Query Frame = 3
Query:  951 ASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSND----GYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVS-----FSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            A  ++TI  WK+ +      I AH+ NV+ L L  +   +L++  +      WA S       IM   SL   T A+    C++ +        G+  G + +W+L+  K +   + H    S+ +L F   G YLA+G  D  IKLWD+R+   V  +K         T  +  L F   G +L  A  D  V   K W+ +       F+ H+     V+F  N   + S S DRTVKL+
Sbjct:    2 ALTNTTITSWKLQE------IVAHSSNVSSLVLGKSSGRLLATGGEDCRVNIWAVSK---PNCIM---SLTGHTSAVG---CIQFNSSEERVVAGSLSGSLRLWDLEAAKILRTLMGH--KASISSLDFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYKG-------HTQAVRCLAFSPDGKWLASASDDSTV---KLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVKLW 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Zebrafish
Match: katnb1 (katanin p80 (WD repeat containing) subunit B 1 [Source:NCBI gene;Acc:406291])

HSP 1 Score: 105.145 bits (261), Expect = 3.455e-23
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 3
Query:  756 HSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGS--YLGVAGTDVRVYLSKQWE 1529
            HS+++  +V   + K     + TGG D    ++  S    + +L GHT  V C+ +++S+E  V  S   ++R+W ++ A     +  H  +++ L  H  G Y+ S S D      D+     + R++  H      Q++ C+   PDG   A+ ++D  V +W+L   K +  F  HT+  +V  + F  N + LA+G +D  +KLWDL K   F  +   +   T  +  + F+  GS  Y G   T +RVY    WE
Sbjct:   19 HSSNVSSLV---LGKSSGRLLATGGEDCRVNIWAVSKPNCIMSLTGHTSAVGCIQFNSSEERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYKG-HT-----QAVRCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHTS--AVNVVQFHPNEYLLASGSADRTVKLWDLEK---FNMIGSSEGE-TGVVRSVLFNPDGSCLYSGSENT-LRVY---GWE 260          

HSP 2 Score: 69.707 bits (169), Expect = 4.690e-12
Identity = 68/238 (28.57%), Postives = 104/238 (43.70%), Query Frame = 3
Query:  960 DSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSND----GYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWE-----RVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            ++TI  WK+ +      I AH+ NV+ L L  +   +L++  +      WA S       IM   SL   T A+    C++ +        G+  G + +W+L+  K +  L      S+ +L F   G YLA+G  D  IKLWD+R+   V  +K         T  +  L F   G +L  A  D  V L   W+      +  F+ H+     V+F  N   + S S DRTVKL+
Sbjct:    5 NTTITSWKLQE------IVAHSSNVSSLVLGKSSGRLLATGGEDCRVNIWAVSK---PNCIM---SLTGHTSAVG---CIQFNSSEERVVAGSLSGSLRLWDLEAAKILRTL-MGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYKG-------HTQAVRCLAFSPDGKWLASASDDSTVKL---WDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVKLW 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Xenopus
Match: lsm14a (LSM14A mRNA processing body assembly factor [Source:Xenbase;Acc:XB-GENE-5955547])

HSP 1 Score: 495.352 bits (1274), Expect = 1.058e-171
Identity = 242/439 (55.13%), Postives = 320/439 (72.89%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTL 1412
            MSL C ISNE+ + P ++ +SGH++++RLIEKYL  +  DPVT    S D LI+IKV   ++PKPPS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI+     PQAS          +    + E +GMS EI  +LQ+K+ +LT+ERKKRGK +PEDL +P  +  +   ++  GLHSAS+PGI+ALD+   D++K +TGG DK+ VVF+  + QI+ TLKGHTKKV+ VV+H S E+  +ASPDSTIRVW + DASC  V+RAH G VTGLSLHATG+Y+LS S+D YWAFSDI+ G+V+ +   + +++    +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G V  +AFSENG+YLAT   D  +KLWDLRK+++FKTL
Sbjct:    1 MSLTCYISNEVTDRPCISPVSGHIFDRRLIEKYLAENGTDPVTNQPLSEDQLIDIKVAHPIRPKPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGISV----PQASPMPQAGAAGSAEAMELGELIGMSAEIIQKLQDKATVLTTERKKRGKTVPEDLVKPEELSKYHQVSSHVGLHSASVPGILALDLCPTDTNKTLTGGADKSVVVFDALSQQILATLKGHTKKVTSVVFHPSQELVFSASPDSTIRVWSVPDASCAQVLRAHEGAVTGLSLHATGDYLLSCSDDQYWAFSDIHVGRVLTK---VTDESSGC-ALTCAQFHPDGLIFGTGTVDSQIKIWDLKERSNVANFP-GHSGPVSCIAFSENGYYLATAADDSSVKLWDLRKLKNFKTL 430          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Xenopus
Match: lsm14a (LSM14A mRNA processing body assembly factor [Source:Xenbase;Acc:XB-GENE-5955547])

HSP 1 Score: 424.476 bits (1090), Expect = 2.313e-144
Identity = 223/441 (50.57%), Postives = 296/441 (67.12%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARP--SSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTL 1412
            MSL C ISNE+ + P ++ +SGH++++RLIEKYL  +  DPVT    S D LI+IKV   ++PKPPS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI+     PQAS          +    + E +GMS EI  +LQ+K+ +LT+ERKKRGK +PEDL +P  +S+  + VKN  +  H ++I                           ++   +   C L GHTKKV+ VV+H S E+  +ASPDSTIRVW + DASC  V+RAH G VTGLSLHATG+Y+LS S+D YWAFSDI+ G+V+ +   + +++    +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G V  +AFSENG+YLAT   D  +KLWDLRK+++FKTL
Sbjct:    1 MSLTCYISNEVTDRPCISPVSGHIFDRRLIEKYLAENGTDPVTNQPLSEDQLIDIKVAHPIRPKPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGISV----PQASPMPQAGAAGSAEAMELGELIGMSAEIIQKLQDKATVLTTERKKRGKTVPEDLVKPYTNSILYYSVKNA-SNYHCSNI---------------------------YSCFCSFSFC-LVGHTKKVTSVVFHPSQELVFSASPDSTIRVWSVPDASCAQVLRAHEGAVTGLSLHATGDYLLSCSDDQYWAFSDIHVGRVLTK---VTDESSGC-ALTCAQFHPDGLIFGTGTVDSQIKIWDLKERSNVANFP-GHSGPVSCIAFSENGYYLATAADDSSVKLWDLRKLKNFKTL 403          

HSP 2 Score: 51.2174 bits (121), Expect = 3.347e-6
Identity = 44/214 (20.56%), Postives = 88/214 (41.12%), Query Frame = 3
Query: 1002 EHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            E +++ +T ++   S+    NY  S+    + +FS    G         H K      +T +  HP   +  + + D  + +W++ +      L     G+V  L+    G YL +   D      D+   R    ++  D+ +   +   +F   G   G    D  ++++  K+   V +F  HSG  + + F EN   + +++ D +VKL+
Sbjct:  196 EDLVKPYTNSILYYSVKNASNYHCSNIYSCFCSFSFCLVG---------HTK-----KVTSVVFHPSQELVFSASPDSTIRVWSVPDASCAQVL-RAHEGAVTGLSLHATGDYLLSCSDDQYWAFSDIHVGRVLTKVT--DESSGCALTCAQFHPDGLIFGTGTVDSQIKIWDLKERSNVANFPGHSGPVSCIAFSENGYYLATAADDSSVKLW 392          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Xenopus
Match: lsm14a (LSM14A mRNA processing body assembly factor [Source:Xenbase;Acc:XB-GENE-5955547])

HSP 1 Score: 400.979 bits (1029), Expect = 6.645e-135
Identity = 219/519 (42.20%), Postives = 302/519 (58.19%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEV----KKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL C ISNE+ + P ++ +SGH++++RLIEKYL  +  DPVT    S D LI+IKV   ++PKPPS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI+     PQAS          +    + E +GMS EI  +LQ+K+ +LT+ERKKRGK +PEDL +P  +  +   ++  GLHSAS+PGI+ALD+   D++K +TGG DK+ VVF+               KV+ VV+H S E+  +ASPDSTIRVW + DASC  V+RAH G VTGLSLHATG+Y+LS S+D  +     +  ++++ H              C+         +TG         N  E+      + F        VR+L F ++G YLA GG                                              TD++VY+ KQW  V+ F+DHS L TG+ FG+NA  + S+ +DR+++ Y+
Sbjct:    1 MSLTCYISNEVTDRPCISPVSGHIFDRRLIEKYLAENGTDPVTNQPLSEDQLIDIKVAHPIRPKPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGISV----PQASPMPQAGAAGSAEAMELGELIGMSAEIIQKLQDKATVLTTERKKRGKTVPEDLVKPEELSKYHQVSSHVGLHSASVPGILALDLCPTDTNKTLTGGADKSVVVFD---------------KVTSVVFHPSQELVFSASPDSTIRVWSVPDASCAQVLRAHEGAVTGLSLHATGDYLLSCSDDQVF-----WKNRILLSH--------------CLAQLDFSFFSSTGWYGKSSDSANRGEIICTSCSICFF-----FKVRSLVFDQSGTYLAVGG----------------------------------------------TDIQVYICKQWAEVLHFTDHSALTTGLAFGQNAKFLASTGMDRSLRFYS 430          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Xenopus
Match: lsm14a (LSM14A mRNA processing body assembly factor [Source:Xenbase;Acc:XB-GENE-5955547])

HSP 1 Score: 395.586 bits (1015), Expect = 1.378e-132
Identity = 217/527 (41.18%), Postives = 310/527 (58.82%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGIT---SHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDG----EVSIWNLKEVKKVAFLPHTTNG-----SVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL C ISNE+ + P ++ +SGH++++RLIEKYL  +  DPVT    S D LI+IKV   ++PKPPS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI+   +  +P   + S   ME        + E +GMS EI  +LQ+K+ +LT+ERKKRGK +PEDL +P  +  +   ++  GLHSAS+PGI+ALD+   D++K +TGG DK+ VVF+               KV+ VV+H S E+  +ASPDSTIRVW + DASC  V+RAH G VTGLSLHATG+Y+LS S+D  +     +  ++++ H              C++    G+      ++     E+ ++  ++      +  T+        VR+L F ++G YLA GG                                              TD++VY+ KQW  V+ F+DHS L TG+ FG+NA  + S+ +DR+++ Y+
Sbjct:    1 MSLTCYISNEVTDRPCISPVSGHIFDRRLIEKYLAENGTDPVTNQPLSEDQLIDIKVAHPIRPKPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGISVPQASPMPQAGAGSAEAME--------LGELIGMSAEIIQKLQDKATVLTTERKKRGKTVPEDLVKPEELSKYHQVSSHVGLHSASVPGILALDLCPTDTNKTLTGGADKSVVVFD---------------KVTSVVFHPSQELVFSASPDSTIRVWSVPDASCAQVLRAHEGAVTGLSLHATGDYLLSCSDDQVF-----WKNRILLSH--------------CLRCECCGVALKGLPKNANFAFELLLYRKEDSANRGEIICTSCSICFFFKVRSLVFDQSGTYLAVGG----------------------------------------------TDIQVYICKQWAEVLHFTDHSALTTGLAFGQNAKFLASTGMDRSLRFYS 439          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:Xenbase;Acc:XB-GENE-490993])

HSP 1 Score: 109.383 bits (272), Expect = 1.616e-24
Identity = 71/259 (27.41%), Postives = 122/259 (47.10%), Query Frame = 3
Query:  756 HSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVYLSKQWE 1529
            H +S+  +V   + K     + TGG+D    +++ +    + +L GHT  V  V ++N++E+ V  S   ++RVW ++ A     +  H  NV  L  H  G++V S S D      D+     + R++  H      Q++ C++  PDG   A+ ++D  V +W+L   K +A L     G V  + F  N + LA+G +D  ++ WDL K +    L    +  T  +  + F + G  +   G D +RVY    WE
Sbjct:   19 HGSSVSSVV---LGKSSGRLVATGGDDCRVNLWSVNKPNCIMSLTGHTTPVESVRFNNAEELIVAGSQSGSLRVWDLEAAKILRTLMGHKANVCSLDFHPYGDFVASGSLDTNIKLWDVRRKGCVFRYKG-HT-----QAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAEL-SEHKGPVNIIEFHPNEYLLASGSADRTVRFWDLEKFQ----LIGCTEGETIPVRAILFSSDGGCIFCGGRDALRVY---GWE 260          

HSP 2 Score: 64.3142 bits (155), Expect = 3.054e-10
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 3
Query:  951 ASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSL-HATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            A+P  T   WK+ +      I AH  +V+ + L  ++G  V +  +D       +     IM   SL   T  ++S+    ++ + LI A G++ G + +W+L+  K +   + H  N  V +L F   G ++A+G  D  IKLWD+R+   V  +K         T  +  L F   G +L  A  D  V+++     + +   S+H G    + F  N   + S S DRTV+ +
Sbjct:    2 ATPSPTKTTWKLQE------IVAHGSSVSSVVLGKSSGRLVATGGDDCRVNLWSVNKPNCIM---SLTGHTTPVESVR--FNNAEELIVA-GSQSGSLRVWDLEAAKILRTLMGHKAN--VCSLDFHPYGDFVASGSLDTNIKLWDVRRKGCVFRYKG-------HTQAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFW 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Mouse
Match: Prpf19 (pre-mRNA processing factor 19 [Source:MGI Symbol;Acc:MGI:106247])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 276/515 (53.59%), Postives = 374/515 (72.62%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S  QI+ TLKGHTKKV+ VV+H S E+  +ASPD+TIR+W + + SC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Mouse
Match: Prpf19 (pre-mRNA processing factor 19 [Source:MGI Symbol;Acc:MGI:106247])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 276/534 (51.69%), Postives = 374/534 (70.04%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEW-------------------DALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEW                   DA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S  QI+ TLKGHTKKV+ VV+H S E+  +ASPD+TIR+W + + SC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWGWPNSPALPQSSQWPTLSQDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 522          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Mouse
Match: Katnb1 (katanin p80 (WD40-containing) subunit B 1 [Source:MGI Symbol;Acc:MGI:1921437])

HSP 1 Score: 105.916 bits (263), Expect = 1.652e-23
Identity = 72/254 (28.35%), Postives = 115/254 (45.28%), Query Frame = 3
Query:  777 IVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTL--SPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVYLSKQWE 1529
            + +L + K     + TGG+D    +++ +    + +L GHT  V  V  +  +E+ V  S   +IRVW ++ A     +  H  N+  L  H  G +V S S D      DI     + R++  H+     Q++ C++  PDG   A+  +D  V +W+L   K ++  P  T G V  + F  N + LA+G SD  I+ WDL K +    +   PG  R+        F+  G  L     D +RVY    WE
Sbjct:   23 VSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRG-HS-----QAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT-GPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVL------FNPDGCCLYSGCQDSLRVY---GWE 260          

HSP 2 Score: 70.8626 bits (172), Expect = 2.313e-12
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  951 ASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSL-HATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            A+P  T   WK+ +      I AH  NV+ L L  A+G  + +  +D       I     IM   SL   T  ++S+    + P+ LI A G++ G + +W+L+  K +   + H  N  + +L F   G ++A+G  D  IKLWD+R+   V  ++    G  +A   +  L F   G +L  A  D  V+++     + +  F  H+G    V F  N   + S S DRT++ +
Sbjct:    2 ATPVVTKTAWKLQE------IVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIM---SLTGHTSPVESVRL--NTPEELIVA-GSQSGSIRVWDLEAAKILRTLMGHKAN--ICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYR----GHSQA---VRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Mouse
Match: Daw1 (dynein assembly factor with WDR repeat domains 1 [Source:MGI Symbol;Acc:MGI:1923089])

HSP 1 Score: 95.9005 bits (237), Expect = 1.001e-20
Identity = 98/369 (26.56%), Postives = 168/369 (45.53%), Query Frame = 3
Query:  567 VEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGK----QMPEDLARPSSMESFVVKNTQTGLHSASIPGI-VALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHN--SDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNG---SVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            +E+S + +V   VG       ++Q+   ++T+ R K+ +    ++ E L + S    ++ K     L +  +P   VAL+   K  S  ITG  D+   V++T++ + + TL+GH   V  + ++N   D+IA T S D T ++W  +   C H  R HT  +  LS +     V + S D      DI  G+ ++   +L      I SL+   +  D +I  TG+ D  V +W+    +KV    HT  G    + +  F+ +   + TG  D    LWD    +   TL+  DD    +I D  FD +G  +  A  D   RVY +   + V     H G  + + F    N +++ S D+T +++
Sbjct:   33 LELSPSTDVNTLVG-------EIQQAEPLITASRTKQVRLLVQRLQEKLRQHSDHNFYLFKV----LRAHILPLTNVALN---KAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGDKIA-TGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVV---TLTGHLAEIISLS-FDTSGDRII--TGSFDHTVVVWDASTGRKV----HTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSGKYVATLTGHDD----EILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIW 372          

HSP 2 Score: 66.6254 bits (161), Expect = 3.518e-11
Identity = 43/149 (28.86%), Postives = 75/149 (50.34%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIW 1250
            D S I+TG  DK  ++++ ++ + V TL GH  ++    +  + ++  TAS D T RV+      C   +  H G ++ +S +  GN +L+ S+D      D+ TG+ +   Q L   T+ I   +C  ++  G I  TG++D    IW
Sbjct:  272 DCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCL---QVLEGHTDEI--FSCAFNYK-GNIVITGSKDNSCRIW 414          

HSP 3 Score: 63.5438 bits (153), Expect = 3.212e-10
Identity = 58/289 (20.07%), Postives = 121/289 (41.87%), Query Frame = 3
Query:  777 IVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            + A+  +     KI TG  DK   +++    +   T +GHT ++ C+ ++    +  T S D+T ++W I +      +  H   +  LS   +G+ +++ S D      D  TG+ +  H  + +  E   +L     + D  +  TG+ D    +W+    K VA L    +  +    F   G  +AT  +DG  ++++    +    L   +     +I+ + F+  G+ L    +D   R++  +  + +     H+       F    N +I+ S D + +++
Sbjct:  137 VYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSFDTSGDRIITGSFDHTVVVWDASTGRKV--HTLIGHCAEISSAL----FNWDCSLILTGSMDKTCMLWDATSGKYVATLT-GHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEG----EISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIW 414          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Mouse
Match: Prpf4 (pre-mRNA processing factor 4 [Source:MGI Symbol;Acc:MGI:1917302])

HSP 1 Score: 95.9005 bits (237), Expect = 2.017e-20
Identity = 64/276 (23.19%), Postives = 126/276 (45.65%), Query Frame = 3
Query:  849 VFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAV--------TASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRAT---YQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            +++  +  ++ TL+GH   V  +V+H    +++        + + D ++++W +D       I  HT  V  +  H +G ++ ++  D  W   D+   + I+ HQ  H+       +  +  H DG +  TG  D    +W+L+  + + FL       +  + FS NG+++ATG  D   K+WDLR+ R   T+    +  T   ++    +F  +G+Y   A    +++    W  + + + H G   G+    +   I + S DRT KL+ +
Sbjct:  256 LWSVPDCSLLHTLRGHNTNVGAIVFHPKSTVSLDQKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEIL-HQEGHS-----MGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK-EIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGDFLLTGAYDNTA----KIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMA 520          
BLAST of pre-mRNA-processing factor 19 vs. UniProt/SwissProt
Match: sp|Q08E38|PRP19_BOVIN (Pre-mRNA-processing factor 19 OS=Bos taurus OX=9913 GN=PRPF19 PE=2 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 277/515 (53.79%), Postives = 376/515 (73.01%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S+ QI+ TLKGHTKKV+ VV+H S E+  +ASPD+TIR+W + +ASC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
BLAST of pre-mRNA-processing factor 19 vs. UniProt/SwissProt
Match: sp|Q9UMS4|PRP19_HUMAN (Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 276/515 (53.59%), Postives = 376/515 (73.01%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S+ QI+ TLKGHTKKV+ VV+H S ++  +ASPD+TIR+W + +ASC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
BLAST of pre-mRNA-processing factor 19 vs. UniProt/SwissProt
Match: sp|Q9JMJ4|PRP19_RAT (Pre-mRNA-processing factor 19 OS=Rattus norvegicus OX=10116 GN=Prpf19 PE=1 SV=2)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 276/515 (53.59%), Postives = 374/515 (72.62%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S  QI+ TLKGHTKKV+ VV+H S E+  +ASPD+TIR+W + + SC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
BLAST of pre-mRNA-processing factor 19 vs. UniProt/SwissProt
Match: sp|Q99KP6|PRP19_MOUSE (Pre-mRNA-processing factor 19 OS=Mus musculus OX=10090 GN=Prpf19 PE=1 SV=1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 276/515 (53.59%), Postives = 374/515 (72.62%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSLICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DP+     S + LI+IKV   ++PKPPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+    + PQA  S     V      ++ E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L +P  +  +    +  GLHSASIPGI+ALD+   D++KI+TGG DKN VVF+ S  QI+ TLKGHTKKV+ VV+H S E+  +ASPD+TIR+W + + SC  V+RAH   VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + ++T    SLTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL----IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDETSGC-SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
BLAST of pre-mRNA-processing factor 19 vs. UniProt/SwissProt
Match: sp|Q5ZMA2|PRP19_CHICK (Pre-mRNA-processing factor 19 OS=Gallus gallus OX=9031 GN=PRPF19 PE=1 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 268/516 (51.94%), Postives = 375/516 (72.67%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQT-GLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            M+LICSISNE+PE P ++ +S HVYE+RLIEKY+  +  DPV     S + LI+IKV   ++P+PPS TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG    ++ PQA  S          + ++ E  GM+ EI  + Q+K+ +LT+ERKKRGK +PE+L      +    ++ +  GLHSASIPGI+ALD+   D++KI+TGG DKN +VF+ S+ QI+ TLKGH+KKV+ VV+H S ++  +ASPD+TIR+W + +ASC  V+RAH G+VTGLSLHATG+Y+LSSS+D YWAFSDI TG+V+ +   + +++    +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G + ++AFSENG+YLAT   D  +KLWDLRK+++FKTL   ++   +++  L FD SG+YL + GTDV++Y+ KQW  ++ F++HSGL TGV FG +A  I S+ +DR++K Y+
Sbjct:    1 MALICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPVNNQPLSEEQLIDIKVAHPIRPRPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAG----LIVPQAVPSSQPNVAGAGESMDLGELAGMTPEIIQKPQDKATVLTTERKKRGKTVPEELVEARGAQQVPGRSPRMWGLHSASIPGILALDLCPSDTNKILTGGADKNVIVFDKSSEQILATLKGHSKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHEGSVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK---VTDESSGC-ALTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFP-GHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNN---FEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 504          
BLAST of pre-mRNA-processing factor 19 vs. TrEMBL
Match: A0A430QF01 (Pre-mRNA-processing factor 19 OS=Schistosoma bovis OX=6184 GN=DC041_0003026 PE=4 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 293/538 (54.46%), Postives = 396/538 (73.61%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGI--------------------TSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPH--TTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            MSL+CS+SNE+PE PV++  SGH++E+RLIEKYL  +  DP+     + ++LI+IK P  V+PKPPS TSIPA+LK+ QDEWDA+MLQ FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI                    T+  VPP    S++   V+   ++ +QE +G+S+++   LQE++  LT+ERK+RGK +PE LAR  ++  +       GLHSAS+PGI  LD+SK    +I+TGGNDK AVVF+ S +Q++  LKGH KKV+ VVYH S+E+  T SPD+T+RVW ++   C  +IRAH G VTGLS+HATG+Y+LS S+DG WAFSD+  G+V++R  ++ +K+ +IQ+LTC + HPDGLI  TGT DGEV IW++KE + VA   H   TN  V  +AFSENG+YLAT G D  +KLWDLRK+++FKTL PG+D+ +Y+I D+EFD SGSYL VAGTDVRVYL KQW+++VSF+ H+  ATGVRFGENA T+IS+S DR+VK++ +
Sbjct:    1 MSLLCSLSNEVPEHPVVSPRSGHIFERRLIEKYLGENGTDPIDQQPLAVEELIDIKTPAFVRPKPPSATSIPAILKTLQDEWDAVMLQSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIIQPSQMNVQNINTTHQPPAGTAPTVPPSLDTSDNSSTVD---SNQLQEEIGISEDVINTLQERASQLTAERKRRGKTVPEGLARSRAISEYQQLANHVGLHSASMPGINCLDISKTSPERIVTGGNDKTAVVFDLSTSQVISILKGHNKKVTQVVYHPSEELVFTGSPDTTLRVWGVEQGQCASIIRAHKGPVTGLSIHATGDYLLSCSSDGQWAFSDLRHGRVLVRISAV-DKSGSIQALTCAQFHPDGLILGTGTADGEVKIWDVKERRNVANFAHGSGTNQLVTAVAFSENGYYLATSGGDSQVKLWDLRKLKNFKTLIPGEDQPSYEICDVEFDQSGSYLAVAGTDVRVYLCKQWDQLVSFNAHTAPATGVRFGENATTVISASRDRSVKVFGT 534          
BLAST of pre-mRNA-processing factor 19 vs. TrEMBL
Match: A0A4E0R015 (Pre-mRNA-processing factor 19 OS=Fasciola hepatica OX=6192 GN=D915_008535 PE=4 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 294/533 (55.16%), Postives = 393/533 (73.73%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGIT-----SHIV--------PPQASQSEHEMEVEVSY--NHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPH--TTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRA-TYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL+CS+SNE+PE PV++  SGHV+E+RLIEKYL  +  DP+     + ++LIE+K    V+PKPPS TSIPA+LK+ QDEWDA+MLQ FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQ GIT     S+ V        P Q +    +   + +    H +QE +G+ + +   LQE++  LT+ERK+RGK +PE LA+  ++  F    +  GLHSAS+PGI++LD+SK    +I+TGGNDKNAVVFN ++ Q+V  L+GHTKKV+ VVYH +DE+  T SPDST+RVW ++   C  VIRAH G VTGLS+HATG+Y+LSSS DG WAFSD+  G+V++R  +L +K+   QSLTC + HPDGLI  TGT DGEV IW++KE + VA   H    N  V  +AFSENG+YLATGG+DG +KLWDLRK+++FKTL PG+D+   Y+I D+EFD SGSYLG+AG+DVR+YL KQW+++  F++H+  ATG RFGENAN  ISSS+DR+VK++ 
Sbjct:    1 MSLLCSLSNEVPEHPVISPRSGHVFERRLIEKYLAENGTDPIDQQPLAPEELIELKTSAFVRPKPPSATSIPAILKTLQDEWDAVMLQSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQTGITAPAPTSYAVANAASVGHPSQGTPQPMDTTGDAASVEPHQLQEEIGVDENVIATLQERASQLTAERKRRGKTVPEGLAKSRTISEFQQLASHVGLHSASMPGILSLDISKASPDRIVTGGNDKNAVVFNLASAQVVSILRGHTKKVTSVVYHPTDELVFTGSPDSTVRVWGVEQGQCASVIRAHKGPVTGLSVHATGDYLLSSSADGQWAFSDLRHGRVLVRISAL-DKSGTQQSLTCAQFHPDGLILGTGTGDGEVKIWDVKERRNVANFGHGAGANQPVTAVAFSENGYYLATGGADGQVKLWDLRKLKNFKTLVPGEDQPDAYEIYDIEFDQSGSYLGIAGSDVRIYLCKQWDQLALFNNHTAPATGCRFGENANKFISSSLDRSVKVFG 532          
BLAST of pre-mRNA-processing factor 19 vs. TrEMBL
Match: A0A504Z8V4 (Pre-mRNA-processing factor 19 OS=Fasciola gigantica OX=46835 GN=FGIG_06162 PE=4 SV=1)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 294/533 (55.16%), Postives = 393/533 (73.73%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGIT-----SHIV--------PPQASQSEHEMEVEVSY--NHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPH--TTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRA-TYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL+CS+SNE+PE PV++  SGHV+E+RLIEKYL  +  DP+     + ++LIE+K    V+PKPPS TSIPA+LK+ QDEWDA+MLQ FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQ GIT     S+ V        P Q +    +   + +    H +QE +G+ + +   LQE++  LT+ERK+RGK +PE LA+  ++  F    +  GLHSAS+PGI++LD+SK    +I+TGGNDKNAVVFN ++ Q+V  L+GHTKKV+ VVYH +DE+  T SPDST+RVW ++   C  VIRAH G VTGLS+HATG+Y+LSSS DG WAFSD+  G+V++R  +L +K+   QSLTC + HPDGLI  TGT DGEV IW++KE + VA   H    N  V  +AFSENG+YLATGG+DG +KLWDLRK+++FKTL PG+D+   Y+I D+EFD SGSYLG+AG+DVR+YL KQW+++  F++H+  ATG RFGENAN  ISSS+DR+VK++ 
Sbjct:    1 MSLLCSLSNEVPEHPVISPRSGHVFERRLIEKYLAENGTDPIDQQPLAPEELIELKTSAFVRPKPPSATSIPAILKTLQDEWDAVMLQSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQTGITAPAPTSYAVANAASVGHPSQGTPQPMDTTGDTASVEPHQLQEEIGVDENVIATLQERASQLTAERKRRGKTVPEGLAKSRTISEFQQLASHVGLHSASMPGILSLDISKASPDRIVTGGNDKNAVVFNLASAQVVSILRGHTKKVTSVVYHPTDELVFTGSPDSTVRVWGVEQGQCASVIRAHKGPVTGLSVHATGDYLLSSSADGQWAFSDLRHGRVLVRISAL-DKSGTQQSLTCAQFHPDGLILGTGTGDGEVKIWDVKERRNVANFGHGAGANQPVTAVAFSENGYYLATGGADGQVKLWDLRKLKNFKTLVPGEDQPDAYEIYDIEFDQSGSYLGIAGSDVRIYLCKQWDQLALFNNHTAPATGCRFGENANKFISSSLDRSVKVFG 532          
BLAST of pre-mRNA-processing factor 19 vs. TrEMBL
Match: A0A5K3EN21 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 294/521 (56.43%), Postives = 383/521 (73.51%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPH--TTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRA--TYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            MSL CSISNEIPE PVL+  SGH++E+RLIEKYL  +  DP+     S ++LIE+K    V+PKPP  TSIPA+LK+ QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV++RLTKEVTAAREAL+TLKP  GI +      ASQ++   E   S   N+QE VG+S+++  +LQE++  LT ERKKRGK +PE LA+   +  +    +  G+HS S+PGI+ LD SK    +I+TGGNDKNA+VFNT  +Q+V  L+GHTKKV+ VVYH S+++A TASPD T+RVW I+ A C  VIRAH G +TGLSLHA G+Y+LSSS DG WA SD+  G+V++R      K  ++QSLTC + HPDG I ATGT DGEV IW+++E +  A   H    N  +  ++FSENG+YLATGG+DG IKLWDLRK+++FKTL+P  DRA  TY+INDLEFD SG YL VAG+DVR YL KQW+++  F+ H+  ATGVRFG NA +II+ S+DRTVK+Y S+
Sbjct:    1 MSLACSISNEIPEQPVLSPRSGHIFERRLIEKYLIETGCDPINQQPLSAEELIEVKTSPLVRPKPPLATSIPAILKTLQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVISRLTKEVTAAREALATLKPHTGIGA---AQPASQAQDVSEAPTSDKSNLQEEVGLSEQVIARLQERAAKLTDERKKRGKTVPEGLAKSRDIAEYRQIASLVGIHSPSVPGILCLDASKATPERIVTGGNDKNAIVFNTQASQVVAVLRGHTKKVTRVVYHQSEQLAFTASPDCTVRVWGIEQAQCASVIRAHAGPITGLSLHAIGDYLLSSSADGQWALSDLRRGQVLVR--VTVEKGGSLQSLTCAQFHPDGQILATGTVDGEVKIWDIRERRNAANFTHGVGANQPLTAVSFSENGYYLATGGADGQIKLWDLRKLKNFKTLTPDVDRANSTYEINDLEFDQSGCYLAVAGSDVRAYLCKQWDQLAVFTSHTSPATGVRFGPNAKSIITCSLDRTVKIYGSS 516          
BLAST of pre-mRNA-processing factor 19 vs. TrEMBL
Match: A0A5K4F9L9 (Putative wd-repeat protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 293/535 (54.77%), Postives = 395/535 (73.83%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGI------------TSHIVP----PQASQSEHEMEVEVSYNHN-VQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPH--TTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            MSL+CS+SNE+PE PV++  SGH++E+RLIEKYL  +  DP+     + ++LI+IK P  V+PKPPS TSIPA+LK+ QDEWDA+MLQ FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI            T+H  P    P   QS    +   + + N +QE  G+S+++   LQE++  LT+ERK+RGK +PE LAR  ++  +       GLHSAS+PGI  LD+SK    +I+TGGNDK AVVF+ S +Q++  LKGH KKV+ VVYH S+E+  T SPD+T+RVW ++   C  +IRAH G+VTGLS+HATG+Y+LS S+DG WAFSD+  G+V++R  ++ +K+ +IQ+LTC + HPDGLI  TGT DGEV IW++KE + VA   H   TN  V  +AFSENG+YLAT G D  +KLWDLRK+++FKTL PG+D+ +Y+I D+EFD SGSYL VAGTDVRVYL KQW++++SF+ H+  ATGVRFGENA T+IS+S DR+VK++ +
Sbjct:    1 MSLLCSLSNEVPEHPVVSPRSGHIFERRLIEKYLGENGTDPIDQQPLAVEELIDIKTPAFVRPKPPSATSIPAILKTLQDEWDAVMLQSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIIQPSQMNVQNINTTHQPPAGTAPTVPQSSDTSDNSSTVDSNQLQEETGISEDVINTLQERASQLTAERKRRGKTVPEGLARSRAISEYQQLANHVGLHSASMPGINCLDISKTSPERIVTGGNDKTAVVFDLSTSQVISILKGHNKKVTQVVYHPSEELVFTGSPDTTLRVWGVEQGQCASIIRAHKGSVTGLSIHATGDYLLSCSSDGQWAFSDLRHGRVLVRISAV-DKSGSIQALTCAQFHPDGLILGTGTADGEVKIWDVKERRNVANFAHGSGTNQPVTAVAFSENGYYLATSGGDSQVKLWDLRKLKNFKTLIPGEDQPSYEICDMEFDQSGSYLAVAGTDVRVYLCKQWDQLISFNAHTAPATGVRFGENATTVISASRDRSVKVFGT 534          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Cavefish
Match: prpf19 (pre-mRNA processing factor 19 [Source:NCBI gene;Acc:103033338])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 273/515 (53.01%), Postives = 371/515 (72.04%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL+C+ISNE+PE P ++ +S  V+E+RLIEKY+  +  DP+ G   S + LI+IKV   ++PKPPS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAG+ +    P +  +      E      V E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PE+L R   +  +    +  GLHSAS+PGI++LD+   D++K++TGG DKN VVF+  + QIV TLKGHTKKV+ V+YH S  +  +ASPDSTIRVW I   +C  V+RAH   VTGLSLHATG+Y+LSSS D YWAFSDI TG+V+ +   + ++T    +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G V  +AFSENG+YLATG  D  +KLWDLRK+++FKT++  ++   Y++  L FD SG+YL V G+D+RVY+ KQW  V++F+DH+GL TGV FGE+A  + S+ +DR++K Y+
Sbjct:    1 MSLVCAISNEVPEHPCVSPVSNQVFERRLIEKYIAENGADPINGQPLSEEQLIDIKVSHPIRPKPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLVAPQAAPASQPAAVGAGGE---PMEVSEQVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVRAEDLSKYRQVASHAGLHSASVPGILSLDLCPTDTNKVLTGGADKNVVVFDRRDEQIVATLKGHTKKVTSVIYHPSQSVVFSASPDSTIRVWSISGGNCVQVVRAHEAGVTGLSLHATGDYLLSSSEDQYWAFSDIQTGRVLTK---VTDETAGC-ALTCAQFHPDGLIFGTGTGDSQIKIWDLKERTNVANFP-GHSGPVTAIAFSENGYYLATGAQDSSLKLWDLRKLKNFKTITLDNN---YEVKSLVFDQSGTYLAVGGSDIRVYICKQWSEVLNFTDHTGLVTGVAFGEHAQFLSSTGMDRSLKFYS 504          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Cavefish
Match: prpf19 (pre-mRNA processing factor 19 [Source:NCBI gene;Acc:103033338])

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 257/515 (49.90%), Postives = 352/515 (68.35%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL+C+ISNE+PE P ++ +S  V+E+RLIEKY+  +  DP+ G   S + LI+IKV   ++PKPPS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAARE    +  +  + +      AS                             LQ+K+ +LT+ERKKRGK +PE+L R   +  +    +  GLHSAS+PGI++LD+   D++K++TGG DKN VVF+  + QIV TLKGHTKKV+ V+YH S  +  +ASPDSTIRVW I   +C  V+RAH   VTGLSLHATG+Y+LSSS D YWAFSDI TG+V+ +   + ++T    +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P  + G V  +AFSENG+YLATG  D  +KLWDLRK+++FKT++  ++   Y++  L FD SG+YL V G+D+RVY+ KQW  V++F+DH+GL TGV FGE+A  + S+ +DR++K Y+
Sbjct:    1 MSLVCAISNEVPEHPCVSPVSNQVFERRLIEKYIAENGADPINGQPLSEEQLIDIKVSHPIRPKPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREGEGYIPSKCSLLT-----TASS----------------------------LQDKATVLTTERKKRGKTVPEELVRAEDLSKYRQVASHAGLHSASVPGILSLDLCPTDTNKVLTGGADKNVVVFDRRDEQIVATLKGHTKKVTSVIYHPSQSVVFSASPDSTIRVWSISGGNCVQVVRAHEAGVTGLSLHATGDYLLSSSEDQYWAFSDIQTGRVLTK---VTDETAGC-ALTCAQFHPDGLIFGTGTGDSQIKIWDLKERTNVANFPGHS-GPVTAIAFSENGYYLATGAQDSSLKLWDLRKLKNFKTITLDNN---YEVKSLVFDQSGTYLAVGGSDIRVYICKQWSEVLNFTDHTGLVTGVAFGEHAQFLSSTGMDRSLKFYS 474          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 103.219 bits (256), Expect = 1.134e-22
Identity = 68/240 (28.33%), Postives = 112/240 (46.67%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVYLSKQWE 1529
            + TGG D    ++  +    + +L GHT  V CV + +++E  V  S   ++RVW ++ A     +  H  N+  L  H  G ++ S S D      D+     + R++  H      Q++ C+   PDG   A+ ++D  + +W+L   K +  F  HT+  +V  + F  N + LA+G +D  +KLWDL K   FK +   +   T  +  + F   GS L     D +RVY    WE
Sbjct:   35 LATGGEDCRVNIWAVNKPNCIMSLTGHTSPVQCVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKANICSLDFHPFGEHIASGSVDTNIKLWDVRRKGCVFRYKG-HT-----QAVRCISFSPDGKWLASASDDSTIKLWDLTAGKLITEFTAHTS--AVNVVQFHPNEYLLASGSADRTVKLWDLEK---FKLIGSSEGE-TGPVRCMLFSPDGSCLYSGSEDALRVY---GWE 259          

HSP 2 Score: 65.4698 bits (158), Expect = 9.265e-11
Identity = 61/235 (25.96%), Postives = 102/235 (43.40%), Query Frame = 3
Query:  951 ASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            A+ D T   WK+ D      + AH+  V+ L L  +G  + +   D       +     IM   SL   T  +Q   C++          G+E G + +W+L+  K +   + H  N  + +L F   G ++A+G  D  IKLWD+R+   V  +K         T  +  + F   G +L  A  D  ++++     + +  F+ H+     V+F  N   + S S DRTVKL+
Sbjct:    2 AASDVTKMWWKLQD------MVAHSSKVSSLVLGKSGRLLATGGEDCRVNIWAVNKPNCIM---SLTGHTSPVQ---CVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKAN--ICSLDFHPFGEHIASGSVDTNIKLWDVRRKGCVFRYKG-------HTQAVRCISFSPDGKWLASASDDSTIKLWDLTAGKLITEFTAHTSAVNVVQFHPNEYLLASGSADRTVKLW 215          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 103.219 bits (256), Expect = 1.253e-22
Identity = 68/240 (28.33%), Postives = 112/240 (46.67%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVYLSKQWE 1529
            + TGG D    ++  +    + +L GHT  V CV + +++E  V  S   ++RVW ++ A     +  H  N+  L  H  G ++ S S D      D+     + R++  H      Q++ C+   PDG   A+ ++D  + +W+L   K +  F  HT+  +V  + F  N + LA+G +D  +KLWDL K   FK +   +   T  +  + F   GS L     D +RVY    WE
Sbjct:   72 LATGGEDCRVNIWAVNKPNCIMSLTGHTSPVQCVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKANICSLDFHPFGEHIASGSVDTNIKLWDVRRKGCVFRYKG-HT-----QAVRCISFSPDGKWLASASDDSTIKLWDLTAGKLITEFTAHTS--AVNVVQFHPNEYLLASGSADRTVKLWDLEK---FKLIGSSEGE-TGPVRCMLFSPDGSCLYSGSEDALRVY---GWE 296          

HSP 2 Score: 66.2402 bits (160), Expect = 6.033e-11
Identity = 62/239 (25.94%), Postives = 103/239 (43.10%), Query Frame = 3
Query:  939 IAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            I   A+ D T   WK+ D      + AH+  V+ L L  +G  + +   D       +     IM   SL   T  +Q   C++          G+E G + +W+L+  K +   + H  N  + +L F   G ++A+G  D  IKLWD+R+   V  +K         T  +  + F   G +L  A  D  ++++     + +  F+ H+     V+F  N   + S S DRTVKL+
Sbjct:   35 INAMAASDVTKMWWKLQD------MVAHSSKVSSLVLGKSGRLLATGGEDCRVNIWAVNKPNCIM---SLTGHTSPVQ---CVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKAN--ICSLDFHPFGEHIASGSVDTNIKLWDVRRKGCVFRYKG-------HTQAVRCISFSPDGKWLASASDDSTIKLWDLTAGKLITEFTAHTSAVNVVQFHPNEYLLASGSADRTVKLW 252          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 102.449 bits (254), Expect = 1.729e-22
Identity = 71/260 (27.31%), Postives = 118/260 (45.38%), Query Frame = 3
Query:  756 HSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVYLSKQWE 1529
            HS+ +  +V      K    + TGG D    ++  +    + +L GHT  V CV + +++E  V  S   ++RVW ++ A     +  H  N+  L  H  G ++ S S D      D+     + R++         Q++ C+   PDG   A+ ++D  + +W+L   K +  F  HT+  +V  + F  N + LA+G +D  +KLWDL K   FK +   +   T  +  + F   GS L     D +RVY    WE
Sbjct:   19 HSSKVSSLVL----GKSGRLLATGGEDCRVNIWAVNKPNCIMSLTGHTSPVQCVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKANICSLDFHPFGEHIASGSVDTNIKLWDVRRKGCVFRYKG------HTQAVRCISFSPDGKWLASASDDSTIKLWDLTAGKLITEFTAHTS--AVNVVQFHPNEYLLASGSADRTVKLWDLEK---FKLIGSSEGE-TGPVRCMLFSPDGSCLYSGSEDALRVY---GWE 259          

HSP 2 Score: 65.0846 bits (157), Expect = 1.262e-10
Identity = 61/235 (25.96%), Postives = 102/235 (43.40%), Query Frame = 3
Query:  951 ASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            A+ D T   WK+ D      + AH+  V+ L L  +G  + +   D       +     IM   SL   T  +Q   C++          G+E G + +W+L+  K +   + H  N  + +L F   G ++A+G  D  IKLWD+R+   V  +K         T  +  + F   G +L  A  D  ++++     + +  F+ H+     V+F  N   + S S DRTVKL+
Sbjct:    2 AASDVTKMWWKLQD------MVAHSSKVSSLVLGKSGRLLATGGEDCRVNIWAVNKPNCIM---SLTGHTSPVQ---CVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKAN--ICSLDFHPFGEHIASGSVDTNIKLWDVRRKGCVFRYKG-------HTQAVRCISFSPDGKWLASASDDSTIKLWDLTAGKLITEFTAHTSAVNVVQFHPNEYLLASGSADRTVKLW 215          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 86.2705 bits (212), Expect = 2.941e-18
Identity = 73/286 (25.52%), Postives = 124/286 (43.36%), Query Frame = 3
Query:  813 KIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQ-----INDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            ++ +G  D   +V+N           GH   V  V +  S  + V+AS D T+R+W         V +AHT  V  +S  A G  ++++S+D       ++  K +    SL+  +  ++S    K  PDG +  +G++D  V +W+    + V  F  H   G V  + F  +G  +A  G+D  +K+WD+R  +  +          YQ     +N L F  +G+YL  A  D  ++V    +     +   H G AT V F    +   S   D  V ++ +N
Sbjct:   32 QLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLY---SLNQHSNWVRS---AKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEH--GGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQ---------HYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWKTN 300          

HSP 2 Score: 80.1073 bits (196), Expect = 2.909e-16
Identity = 50/192 (26.04%), Postives = 87/192 (45.31%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLW 1379
            D   ++T  +DK+  V+     + + +L  H+  V    +     + V+ S D T+RVW  +   C H    H G V  +  H +G  + ++  D      DI   K +++H  +H    A+ SL+    HP G    T + D  + + +L E  ++ +  H   G    +AFS  G + A+GGSD  + +W
Sbjct:  113 DGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNK-LLQHYQVHGA--AVNSLSF---HPTGNYLITASNDSTLKVLDLVE-GRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 3 Score: 63.1586 bits (152), Expect = 8.149e-11
Identity = 57/255 (22.35%), Postives = 110/255 (43.14%), Query Frame = 3
Query:  885 LKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDG---YWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKL 1634
             KGH   ++ V ++ + +   + S D+ + VW     +  +    H   V  +    +G+ V+S+S D     W  S      V   H      T  ++S++      DG    T ++D  + +W +   K +  L   +N  VR+  FS +G  + +G  D  +++WD        T     +   + +N ++F  SG+ +  AGTD  V+V+  +  + +  +  H      + F    N +I++S D T+K+
Sbjct:   14 FKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAH------TATVRSVSFSA---DGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNW-VRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFY---EHGGF-VNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKV 254          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 77.0258 bits (188), Expect = 1.578e-15
Identity = 68/297 (22.90%), Postives = 129/297 (43.43%), Query Frame = 3
Query:  810 SKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIW---------NLKE----VKKVAFLPHTTNGSVRTLAFSEN------GFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            S I++   D    V++        TLKGHT  V  + +  S ++  + S D T+++W      C   +  H  NV+ ++    G++++S+S D      ++ TG  +   ++     E ++ +   + + DG + A+ + D  V +W          L+E    V+ V++ P   +  +     +E       G YL +G  D  IK+WD+       TL   D+     +  + F   G ++     D  +RV+  K      S + H    T + F + A  +I+ SVD++VK++
Sbjct:   60 SVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCV---KTFTGHREWVRMV---RPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDN----WVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVW 346          

HSP 2 Score: 59.6918 bits (143), Expect = 6.547e-10
Identity = 30/96 (31.25%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  801 KDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSND 1088
            K    +++G  DK   +++ S    V TL GH   V  V++H   +  ++ + D T+RVW   +  C+  + AH   VT L  H T  YV++ S D
Sbjct:  245 KPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVD 340          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 7.887e-15
Identity = 74/279 (26.52%), Postives = 126/279 (45.16%), Query Frame = 3
Query:  810 SKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSF---SDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            ++I++G +D    V++    + + TL GHT  V       +  I V+ S D T++VW  D   C H +  HT  V  + LH  GN V+S S D      DI TG      Q LH     + ++ C++   DG    +G  D  V +W+ +    +  L   TN   R  +   +G ++ +G  D  I++WD        TL  G    T   + +E  ++    G A + V+++  K  + + +    + H    T ++F  +   +++SS D TVKL+
Sbjct:  245 NRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRGN--IIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLH--GNRVVSGSRDATLRVWDIETG------QCLHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTN---RVYSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLV-GHQSLT---SGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQF--SRKLVVTSSDDGTVKLW 502          

HSP 2 Score: 75.0998 bits (183), Expect = 1.660e-14
Identity = 60/212 (28.30%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  810 SKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVI---MRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFL--PHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRK---VRDFKTLSPG 1421
            +++++G  D    V++    Q +  L GH   V CV Y       V+ + D T++VW  +  +C H ++ HT  V   SL   G +++S S D      D  TG  +   + HQSL +  E   +           I  +G  D  V IW++K  + +  L  P+    +V  L FS     + T   DG +KLWDLR    +R+  +L  G
Sbjct:  325 NRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRR--VVSGAYDYTVKVWDPESETCLHTLQGHTNRV--YSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELRDN-----------ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRK--LVVTSSDDGTVKLWDLRTGDFLRNLVSLDSG 519          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 73.1738 bits (178), Expect = 6.905e-14
Identity = 63/226 (27.88%), Postives = 95/226 (42.04%), Query Frame = 3
Query:  849 VFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDG---YWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVY 1511
            V   S    V TL+ H+  V  V +       ++ S D+++R W     +   V + H   V  + + A G Y  S S+D     W     +  +V   H         +  +  ++ HP+G   ATG+ D  V +W+ ++    A L     G+V  LAFS  G  LA+GG D  ++LWD+      K L    D     I  L F   GS L    +D  VRV+
Sbjct:  327 VVEDSKGSDVKTLRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSALGLYFCSGSHDRTARLWVPERAFPLRVYAGH---------VSDVNVVRFHPNGSYVATGSADRTVRLWSAQQ-GSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSD----DITCLSFSPDGSALASGSSDGSVRVW 538          

HSP 2 Score: 68.9366 bits (167), Expect = 1.422e-12
Identity = 38/148 (25.68%), Postives = 65/148 (43.92%), Query Frame = 3
Query:  816 IITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLK 1259
              +G +D+ A ++       +    GH   V+ V +H +     T S D T+R+W     S   +   H G V  L+    G  + S   D      DI +G ++   + L   ++ I   TC+   PDG   A+G+ DG V +W+++
Sbjct:  400 FCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIV---KELRGHSDDI---TCLSFSPDGSALASGSSDGSVRVWDVR 541          

HSP 3 Score: 60.4622 bits (145), Expect = 5.963e-10
Identity = 40/150 (26.67%), Postives = 69/150 (46.00%), Query Frame = 3
Query:  948 TASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDG---YWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLR 1388
            + S D T R+W  + A    V   H  +V  +  H  G+YV + S D     W+       ++   H+          ++  +   P G + A+G ED  V +W++     V  L   ++  +  L+FS +G  LA+G SDG +++WD+R
Sbjct:  402 SGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRG---------AVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSD-DITCLSFSPDGSALASGSSDGSVRVWDVR 541          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 7.348e-14
Identity = 67/278 (24.10%), Postives = 111/278 (39.93%), Query Frame = 3
Query:  810 SKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVI-MRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWE-RVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            + + TGG D    V++ S    V TL+GH   V    +H+  +   ++S D++ +VW ++   C   +R HT +V  +      + +L+SS D   +  D  TG+   + +  LH+                   C  GT       +NLK                        G  + +  S G+IK+WD+RK     TL+ G     +  N L F  SG  + VA  D  V +       V + S H      V F  + +T+ S   D T++++
Sbjct:  390 TNLATGGGDSTVKVWDFSQGACVLTLEGHGHAVWGCSWHSCGDFIASSSMDNSSKVWDVNSERCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHS-------------------CNHGT-------FNLK------------------------GDTVVSCDSYGVIKVWDVRKGTATMTLNLG----PHPANRLSFHPSGHVMAVASDDACVRIVDLLTGHVETLSGHEDAVQAVVFSPDGDTLFSGGSDGTIRMW 613          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 90.5077 bits (223), Expect = 1.943e-19
Identity = 53/197 (26.90%), Postives = 95/197 (48.22%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKV 1394
            D+  +++G  DK   +++   +  + + KGH   V  V +        TAS D T R+W  D      +   H  +V  +S H  G YV + S+D      D+ TG  +     L +    I    C    PDG   +TG+EDG +++W++   K++  +      ++ +L++S+ G  L +GG+D  +++WDL+K 
Sbjct:  536 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF--LGHTAPVISIAVC----PDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKA 726          

HSP 2 Score: 81.2629 bits (199), Expect = 1.385e-16
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 3
Query:  882 TLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDG---YWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVY 1511
            TL GH+  V    +   ++  ++ S D T+R+W +D  +     + H   V  +S    G+Y  ++S+D     W+   IY  ++   H         +  + C+  HP+G    TG+ D    +W++     V  FL HT    V ++A   +G +L+TG  DG+I +WD+   +  K +      A Y    L +   G+ L   G D  VRV+
Sbjct:  520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGH---------LNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHT--APVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYS---LSYSKEGNVLISGGADHTVRVW 721          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 83.9593 bits (206), Expect = 1.127e-17
Identity = 83/338 (24.56%), Postives = 154/338 (45.56%), Query Frame = 3
Query:  663 ERKKRGKQMPEDLARPSSMESFVVKNTQ-TGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQ-IVCTLKGHTKKVSCVVYH-NSDEIAVTASPDSTIRVWKIDDASCEHVIR------AHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSP--GDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            ER ++     E L+R + ++     N +  G    S   I A+ +S  D   + TG    +  V N+   Q +   L  H  K+  + +H +S+   ++ + D  I+ ++  +   E  +R       H   ++ +  H +G ++ S+S+D  W   D  T + ++  +  H+K     S  C     DG +  +G  D    +W+++   KV  L   +   + T+A+S NG+ +ATGG DG+I +WD+RK RD   L+          Q+     ++ G  L   G D  + VY S  W ++ S + H+     +    N++ ++S   DR++KL+
Sbjct:  141 ERHQKFNTRQELLSRRTELQRMA--NLELAGSQLVSTKPISAVSLSTDDMV-VATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNE--EGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEG-HDKGVFSLSFQC-----DGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSK-PIYTVAWSPNGYQVATGGGDGIINVWDIRK-RDEGQLNQILAHRNIVTQVR-FSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLW 464          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Yeast
Match: PRP19 (Splicing factor associated with the spliceosome; contains a U-box, a motif found in a class of ubiquitin ligases, and a WD40 domain; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003959])

HSP 1 Score: 78.9518 bits (193), Expect = 5.332e-16
Identity = 45/130 (34.62%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  102 LICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFT---------SIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKE 464
            ++C+IS ++P  PVL+  S  ++EK L+E+Y+  +  DP+T    S ++++EI VP   +      T         SIP LL S Q+EWDA+ML+ F ++    +L ++LS  +Y+ DA+  V  +L  E
Sbjct:    1 MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEI-VPSAQQASLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAKLVAAQLLME 129          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 77.7962 bits (190), Expect = 2.277e-15
Identity = 61/252 (24.21%), Postives = 121/252 (48.02%), Query Frame = 3
Query:  903 KVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYV-LSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGT----DVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            KV CV +H +  +          R++ + D +    +      V  +S++ TG ++   SS  G     +  +   I++ Q   + T +      +   PDG    T +EDG++ +W++     +A F  HT+  SV  + F++ G  + +   DG ++ WDL + R+F+T + G +R   Q N L  D SG  +  AG+    D+ V+  +  + + + S H G  + + F +  + + S+S D+T+++++
Sbjct:  262 KVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNS------LAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTS--SVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFT-GTERI--QFNCLAVDPSGEVV-CAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWS 501          

HSP 2 Score: 67.0106 bits (162), Expect = 4.121e-12
Identity = 47/181 (25.97%), Postives = 80/181 (44.20%), Query Frame = 3
Query:  846 VVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDG-LICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDL 1385
            +V+   +   +   +GH    + + Y       VTAS D  I+VW I    C      HT +VT +     G  + SSS DG     D+    +  R+      TE IQ   C+   P G ++CA   ++ ++ +W+++  + +  L     G V  L+FS+    LA+   D  I++W +
Sbjct:  328 LVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDL----IRYRNFRTFTGTERIQ-FNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALS-GHEGPVSCLSFSQENSVLASASWDKTIRIWSI 502          

HSP 3 Score: 51.2174 bits (121), Expect = 3.813e-7
Identity = 60/292 (20.55%), Postives = 118/292 (40.41%), Query Frame = 3
Query:  891 GHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDAS---CEHVIRAHTGNVTGLSLHATGNYVLSSSNDG---YWAFS--------------------DI--YTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSD-GLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWER-----VVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN*MLKYK 1664
            GH + ++ + +       +T S D + ++W +D             H   V G         + + S DG    W F+                    DI  Y+ ++  +H    N+ +    + C+  HP   + A G   GE  +++L +   +  L    N  V T++ ++ G +LA G S  G + +++ +    +     G   +T   N L +   GS +  A  D ++   K W+      + +F +H+   T V+F +    + SSS+D TV+ +    +++Y+
Sbjct:  144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAK----VKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQN-PVNTVSVNQTGEWLAFGSSKLGQLLVYEWQS-ESYILKQQGHFDST---NSLAYSPDGSRVVTASEDGKI---KVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWD---LIRYR 420          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 66.2402 bits (160), Expect = 5.364e-12
Identity = 72/288 (25.00%), Postives = 120/288 (41.67%), Query Frame = 3
Query:  807 SSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASC-EHVIRAHTGNVTGLSLH-------ATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLS---KQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            SS+++TG  D  A +++      + TLKGH   V CV +    E+  T S D+TIR+W      C    +R H+  +T LS          +   + SSS DG     D  + +V     S H       S++C+K    GL+  +G+ D  V +W++    +   +  +    V  L+ S + + L  G  D   K     +    K L        Y+    +  NS   +  A  D  ++L    K  + +   + H  L   V F  +   I+S+S D ++KL+
Sbjct:  156 SSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVS-RVCQYTMSGHT-----NSVSCVKWGGQGLL-YSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTD-YALRIGAFDHTGKKPSTPEEAQKKALE------NYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 429          

HSP 2 Score: 62.3882 bits (150), Expect = 1.016e-10
Identity = 70/280 (25.00%), Postives = 119/280 (42.50%), Query Frame = 3
Query:  813 KIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDD-ASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWN-LKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQI---NDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            ++ +   D    +++T +     T+ GHT  VSCV +     +  + S D T+RVW I+    C +++++H   V  LSL  + +Y L        AF   +TGK     +    K        C K+     +  T ++D  + +WN LK  K +A +       V  +AFS +G Y+ +   D  IKLWD R  +   T   G   + YQ+   +D     S S      T ++V+  +  +  V    H      V +  +   + S   D+ V+L+
Sbjct:  250 RLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKW-GGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSL--STDYALRIG-----AFD--HTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQK-LVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFR-GHVASVYQVAWSSDCRLLVSCS----KDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Nematostella
Match: EDO47404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLW2])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 276/520 (53.08%), Postives = 373/520 (71.73%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGIT---SHIVPPQASQ--SEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            M+  CSIS+E+PE P ++ LSG+V+E+RLIEKY+  +  DPV G   S D LI++KV   VKP+PPS TSIPA+LK+ QDEWDA ML  F+++Q+ Q  ++ELSHALYQ+DA+CRV+ RLTKEVTAAREAL+TLKPQAGI    + +  P A    ++  MEV+        E  GM++E+  +LQEK+ +LT+ERKKRGK++PEDL     + +F    +  GLHSAS PGI+ALD+   D+SK++TGG DKNA+VFN    Q++ TLKGHTKK++ V+YH ++E+ +TAS DSTIRVW I   SCEH+++AH   VTGLSLHATG+Y+LS S D +WAFSDI TG+V+ +  S        Q LTC + HPDGLI  TGT D  + IW+LKE   VA  P   +G +  + FSENG+YLAT   D ++KLWDLRK+++FKT++  D    +++  L FD SG+YL VAGT++++YL KQWE + SFS+HSGL TGV+FG +A T++SS +DR +K Y+
Sbjct:    1 MAFYCSISHEVPEHPCISPLSGNVFERRLIEKYIAENGTDPVNGEPMSEDQLIDVKVNTLVKPRPPSATSIPAILKALQDEWDACMLHSFSLRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIVPTPALVAAPVALSVLADESMEVQAG------EEGGMTEEVLQKLQEKATLLTAERKKRGKKVPEDLTPADEIRNFTQIASHPGLHSASTPGILALDLQLADTSKVLTGGLDKNAIVFNKDTEQVIATLKGHTKKITNVIYHPTEELGITASADSTIRVWSITKGSCEHILKAHDQAVTGLSLHATGDYLLSCSADQHWAFSDIRTGRVLTKCIS---DPAVNQGLTCAQFHPDGLIFGTGTSDSIIKIWDLKERTNVAKFP-GHSGPISDITFSENGYYLATSADDSVVKLWDLRKLKNFKTINLAD---RFEVKALSFDQSGTYLAVAGTEIQIYLVKQWELLNSFSEHSGLVTGVKFGRHAATVVSSGMDRHLKFYS 507          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Nematostella
Match: KATNB1 (Katanin p80 WD40 repeat-containing subunit B1 [Source:UniProtKB/TrEMBL;Acc:A7SV12])

HSP 1 Score: 101.679 bits (252), Expect = 1.305e-22
Identity = 79/298 (26.51%), Postives = 125/298 (41.95%), Query Frame = 3
Query:  777 IVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVA-FLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD-VRVY----------LSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKL 1634
            I  L +       ++TGG D+   ++      ++ +L GHT  V CV +++ +++ V  S   T+++W ++ A     +  H  ++  L  H  G++V S S D      DI     I  ++     T+ +  L   +  PDG    +G EDG   +W+L   K +  F  HT  G V    F    F LATG SD  +K WDL       + SP     T+ I  + F   G  L     D ++VY              W ++  F+ +S    G  F +   T +S  V   VKL
Sbjct:   21 INCLSLGPSTGRVMVTGGEDRKVNMWAVGQPNVIMSLAGHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAKILRTLTGHKSSIRSLDFHPFGDFVASGSLDTNLKLWDIRRKGCIFTYK---GHTDCVNHL---RFSPDGRWIISGGEDGAAKLWDLTAGKIINDFKMHT--GPVNCAEFHPKEFLLATGSSDRTVKYWDLETFELVSSTSP----ETHPIRCIGFHTDGLCLFSGAQDSLKVYGWEPIKCYESFPLGWGKLGDFTFYSNQLIGAGFSQ---TNVSVWVVNIVKL 303          

HSP 2 Score: 50.8322 bits (120), Expect = 1.256e-6
Identity = 37/158 (23.42%), Postives = 74/158 (46.84%), Query Frame = 3
Query: 1173 SLTCMKSHPD-GLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYL--GVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            ++ C+   P  G +  TG ED +V++W + +   +  L   T+  V  + F+     +  G   G +K+WDL   +  +TL+ G   +   I  L+F   G ++  G   T+++++  ++   + ++  H+     +RF  +   IIS   D   KL+
Sbjct:   20 NINCLSLGPSTGRVMVTGGEDRKVNMWAVGQPNVIMSLAGHTS-PVECVQFNSGEDLVVAGSQSGTLKIWDLEAAKILRTLT-GHKSS---IRSLDFHPFGDFVASGSLDTNLKLWDIRRKGCIFTYKGHTDCVNHLRFSPDGRWIISGGEDGAAKLW 172          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 97.8265 bits (242), Expect = 8.241e-22
Identity = 68/280 (24.29%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  813 KIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFS--DHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            +++TG  D + ++++   +       GH   +  V +  S  +  +AS D T+R+W         V +AHT  V  +     G  +L++S+D       ++T   + R + L++    +  + C K  PDG +  +G++D  + +W+ +  K      +   G V ++ F  +G  +A GG+D  +K+WD+R  +  +         T  +N + F  SG+YL  A +D  + +    E  + ++   H G AT V F  N     S S D  V ++ +N
Sbjct:   32 QLVTGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLK---VWT---VHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWD-RTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQ----AHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWKTN 300          

HSP 2 Score: 79.7221 bits (195), Expect = 6.526e-16
Identity = 48/192 (25.00%), Postives = 84/192 (43.75%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLW 1379
            D   ++T  +DK+  V+     + + +L  H   V C  +     + V+ S D TI++W      C H      G V  +  H +G  + +   D      DI   K++  +Q+    T A+ S++    HP G    + + D  + I +L E  ++ +  H   G   ++ FS NG Y A+G SD  + +W
Sbjct:  113 DGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQA---HTGAVNSVSF---HPSGNYLVSASSDTTLKILDLME-GRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVW 297          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 92.8189 bits (229), Expect = 3.385e-20
Identity = 73/287 (25.44%), Postives = 130/287 (45.30%), Query Frame = 3
Query:  801 KDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHN--SDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKV-AFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            K  +  ITG  D+   V++T++ +   TL+GH   V  + ++N   D+IA T S D T ++W  +   C H  R H+  +  L+ +     + + S D      D+ TG  I    +L   +  I  ++C   +  G    TG+ D  VS+W+ +  ++V   + H   G +    F+ +  ++ TG  D   K+WD    +   TL   DD    ++ D+ FD +G  +  A  D   RVY +     +     H G  + + F      ++++S D+T +L+  N
Sbjct:  102 KSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIA-TGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEI---STLSGHSAEI--ISCA-FNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGH--RGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDD----EVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPN 375          

HSP 2 Score: 66.6254 bits (161), Expect = 8.753e-12
Identity = 44/149 (29.53%), Postives = 75/149 (50.34%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIW 1250
            D S I+TG  DK   +++    + + TL+GH  +V  V +  + ++  TAS D T RV+      C   +  H G ++ ++ +A G  +L++S+D      D  TGK +   Q L   T+ I   +C  ++ DG I  TG++D    +W
Sbjct:  272 DCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCL---QVLEGHTDEI--FSCAFNY-DGDIIITGSKDNTCRLW 414          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Nematostella
Match: EDO43295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ49])

HSP 1 Score: 92.0485 bits (227), Expect = 8.445e-20
Identity = 74/290 (25.52%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAV--------TASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQ--WERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            DS  + T        +++  + + V T+KGH ++V  +V+H    +++        ++  D T+ +W     +    I  H   V  L+ H +G ++ ++  D  W   D+   K ++ HQ  H++     +  C     DG + AT   D    +W+L+  + V  L       V  + FS NG+++ATG  D  + +WDLRK +   T+ P        +   E     +YL  A  D +V +  Q  W  + + S H    + V    +   I S+S DRT KL+AS
Sbjct:  236 DSKLLATASWSGLCKLWSVPDCEPVSTMKGHNERVCSIVFHPQARLSLDETTPSMASSGADGTVLLWNFKSENPIANIEGHDKRVPRLAYHPSGRFLGTTCFDNSWRLWDLEQLKEVL-HQEGHSREVYDIAFQC-----DGSMVATCGLDARGMVWDLRTGQCVMPLDGHLQ-KVLGIDFSPNGYHIATGSEDQKVIVWDLRKRQAIYTI-PAHTNLISSVKYYE-----NYLISASYDCKVKVWSQPGWAPLKTLSGHEQKVSCVDISPDGEYIASTSFDRTFKLWAS 512          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Medaka
Match: prpf19 (pre-mRNA processing factor 19 [Source:NCBI gene;Acc:101155698])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 275/516 (53.29%), Postives = 368/516 (71.32%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYN-HNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYA 1640
            MSL+C+I NE+PE P ++ +S HV+E+RLIEKY+  +  DP+ G   S + L++IKV   ++PK PS TSIPA+LKS QDEWDA+ML  FT++Q+ Q  ++ELSHALYQ+DA+CRV+ RL KEVTAAREAL+TLKPQAG+    V PQA  +              + E VGM+ EI  +LQ+K+ +LT+ERKKRGK +PEDL R   +  +    +  GLHSAS+PGI+ALDV   D++K++TGG DKN VVF+ S  QIV TLKGHTKKV+ V+YH S  +  +ASPD+TIRVW +   +C  V+RAH   VTGLSLHATG+Y+LSSS D YWAFSDI TGKV+ +         A  +LTC + HPDGLI  TGT D ++ IW+LKE   VA  P   +G V ++AFSENG+YLATG  D  +KLWDLRK+++FKT++  ++   Y++  L FD SG+YL VAGTD+RVY+ KQW  V++F+DH+GL TGV FGE+A  + S+ +DR+++ Y+
Sbjct:    1 MSLVCAICNEVPEHPCISPVSNHVFERRLIEKYIAENGTDPMNGQPLSEEQLVDIKVTHPIRPKAPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLNKEVTAAREALATLKPQAGL----VAPQAVPASQPAAAGAGGEPMEISEQVGMTPEIIQKLQDKATILTTERKKRGKTVPEDLVRAEDLSKYRQVASHAGLHSASVPGILALDVCPSDTNKVLTGGADKNVVVFDKSEEQIVATLKGHTKKVTSVIYHPSQSVVFSASPDTTIRVWSVTGGNCVQVVRAHEAGVTGLSLHATGDYLLSSSEDQYWAFSDIQTGKVLTK----VTDESAGCALTCAQFHPDGLIFGTGTADSQIKIWDLKERTNVANFP-GHSGPVTSIAFSENGYYLATGAQDSSLKLWDLRKLKNFKTITLDNN---YEVKSLVFDQSGTYLAVAGTDIRVYICKQWSEVLNFTDHTGLVTGVAFGEHAKFLTSAGMDRSLRFYS 504          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 109.383 bits (272), Expect = 2.620e-25
Identity = 84/344 (24.42%), Postives = 159/344 (46.22%), Query Frame = 3
Query:  618 EIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYH--NSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            E+ +++Q+   ++T  R ++ K++   L +  +         +  +H   +  +       K  S+ ITG  D+   V++T++ Q + +L+GHT  V+ V ++    D+IA T S D T ++W     SC H +R H   +  L+ +     V + S D      D+  GK +    +L   +  I SL C  S    L+  TG+ D  +++W++   + V  L     G +    F+ +   + +G  D   KLW+    R   TL+      T ++ D+ FD++G  + +A  D    V+ +  +E +     H G  + + F    NTI+++S D+T +L+
Sbjct:   43 ELVVEIQQSEPLITQSRVEQVKELIHRLQQKQAHNRSFFLQQEVHVHLLPLTNVAF----NKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIA-TGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVA---TLKGHSAEILSL-CFNSVGSQLV--TGSSDQTLAVWDVATERLVHMLAGHA-GEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAA----HTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKICFSPQGNTILTASSDKTARLW 370          

HSP 2 Score: 67.781 bits (164), Expect = 1.039e-11
Identity = 48/194 (24.74%), Postives = 91/194 (46.91%), Query Frame = 3
Query:  807 SSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLR 1388
            S+ + TG  D +A +++    + V TLKGH+ ++  + +++     VT S D T+ VW +      H++  H G ++    +   + ++S S D      +  +G+ +    +L   TE +  + C  S   G + A  + DG  S++N    + +A L     G +  + FS  G  + T  SD   +LWD++
Sbjct:  187 STLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSVGSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVA---TLAAHTEEVLDV-CFDS--TGQLVAIASADGTASVFNAATYECMARL-EGHEGEISKICFSPQGNTILTASSDKTARLWDVQ 373          

HSP 3 Score: 63.1586 bits (152), Expect = 3.479e-10
Identity = 50/212 (23.58%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  756 HSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLP-HTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLR 1388
            HSA I  +    V     S+++TG +D+   V++ +  ++V  L GH  ++S   ++    + V+ S D+T ++W+     C   + AHT  V  +   +TG  V  +S DG  +  +  T + + R +    +   I    C    P G    T + D    +W+++    +  L  HT    + + AF+  G  + TG +D   ++W  +
Sbjct:  216 HSAEILSLCFNSVG----SQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKI----CFS--PQGNTILTASSDKTARLWDVQTGGCLQILTGHTLE--IFSCAFNYEGDTIITGSADNTCQIWRCK 415          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 108.997 bits (271), Expect = 4.198e-25
Identity = 84/344 (24.42%), Postives = 159/344 (46.22%), Query Frame = 3
Query:  618 EIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYH--NSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTD--VRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLY 1637
            E+ +++Q+   ++T  R ++ K++   L +  +         +  +H   +  +       K  S+ ITG  D+   V++T++ Q + +L+GHT  V+ V ++    D+IA T S D T ++W     SC H +R H   +  L+ +     V + S D      D+  GK +    +L   +  I SL C  S    L+  TG+ D  +++W++   + V  L     G +    F+ +   + +G  D   KLW+    R   TL+      T ++ D+ FD++G  + +A  D    V+ +  +E +     H G  + + F    NTI+++S D+T +L+
Sbjct:   50 ELVVEIQQSEPLITQSRVEQVKELIHRLQQKQAHNRSFFLQQEVHVHLLPLTNVAF----NKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIA-TGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVA---TLKGHSAEILSL-CFNSVGSQLV--TGSSDQTLAVWDVATERLVHMLAGHA-GEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAA----HTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKICFSPQGNTILTASSDKTARLW 377          

HSP 2 Score: 66.2402 bits (160), Expect = 2.978e-11
Identity = 48/194 (24.74%), Postives = 91/194 (46.91%), Query Frame = 3
Query:  807 SSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLR 1388
            S+ + TG  D +A +++    + V TLKGH+ ++  + +++     VT S D T+ VW +      H++  H G ++    +   + ++S S D      +  +G+ +    +L   TE +  + C  S   G + A  + DG  S++N    + +A L     G +  + FS  G  + T  SD   +LWD++
Sbjct:  194 STLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSVGSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVA---TLAAHTEEVLDV-CFDS--TGQLVAIASADGTASVFNAATYECMARL-EGHEGEISKICFSPQGNTILTASSDKTARLWDVQ 380          

HSP 3 Score: 62.003 bits (149), Expect = 8.364e-10
Identity = 50/212 (23.58%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  756 HSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLP-HTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLR 1388
            HSA I  +    V     S+++TG +D+   V++ +  ++V  L GH  ++S   ++    + V+ S D+T ++W+     C   + AHT  V  +   +TG  V  +S DG  +  +  T + + R +    +   I    C    P G    T + D    +W+++    +  L  HT    + + AF+  G  + TG +D   ++W  +
Sbjct:  223 HSAEILSLCFNSVG----SQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKI----CFS--PQGNTILTASSDKTARLWDVQTGGCLQILTGHTLE--IFSCAFNYEGDTIITGSADNTCQIWRCK 422          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Medaka
Match: prpf4 (pre-mRNA processing factor 4 [Source:NCBI gene;Acc:101174721])

HSP 1 Score: 103.99 bits (258), Expect = 3.166e-23
Identity = 76/291 (26.12%), Postives = 133/291 (45.70%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYH--------NSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRAT---YQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            DS  + T        +++  +  ++ TL+GH   V  +V+          SD    + + D T+++W ++       I  H+  V+ ++ H +G ++ ++  D  W   D+   + I+ HQ  H+K   +  L+    HPDG + ATG  D    +W+L+  + V FL       + +L FS NG +LATG  D   K+W+LR  +   T+    +  +   +Q  D  F  +G+Y   A    +V+    W  + + + H G    V    +   I +SS DRT KL+ S
Sbjct:  225 DSKMLATASWSGLCKLWSVPDCNLIRTLRGHNTNVGAIVFRPQSGVSLDQSDVNLASCAADGTVKLWNMESDEPVADIEGHSDRVSRVAWHPSGRFLGTTCYDNSWRLWDLEVQEEIL-HQEGHSK--GVHDLSF---HPDGSLVATGGLDSFGRVWDLRTGRCVVFLEGHLK-EIYSLHFSPNGHHLATGSGDNTCKVWELRNRKCLYTVPAHQNLLSTVRFQPTDGHFLLTGAYDNTA----KVWSHPGWTPLKTLAGHEGKVMSVDVSPDGKLIATSSYDRTFKLWLS 504          
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Medaka
Match: prpf4 (pre-mRNA processing factor 4 [Source:NCBI gene;Acc:101174721])

HSP 1 Score: 103.99 bits (258), Expect = 3.166e-23
Identity = 76/291 (26.12%), Postives = 133/291 (45.70%), Query Frame = 3
Query:  804 DSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYH--------NSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRAT---YQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYAS 1643
            DS  + T        +++  +  ++ TL+GH   V  +V+          SD    + + D T+++W ++       I  H+  V+ ++ H +G ++ ++  D  W   D+   + I+ HQ  H+K   +  L+    HPDG + ATG  D    +W+L+  + V FL       + +L FS NG +LATG  D   K+W+LR  +   T+    +  +   +Q  D  F  +G+Y   A    +V+    W  + + + H G    V    +   I +SS DRT KL+ S
Sbjct:  225 DSKMLATASWSGLCKLWSVPDCNLIRTLRGHNTNVGAIVFRPQSGVSLDQSDVNLASCAADGTVKLWNMESDEPVADIEGHSDRVSRVAWHPSGRFLGTTCYDNSWRLWDLEVQEEIL-HQEGHSK--GVHDLSF---HPDGSLVATGGLDSFGRVWDLRTGRCVVFLEGHLK-EIYSLHFSPNGHHLATGSGDNTCKVWELRNRKCLYTVPAHQNLLSTVRFQPTDGHFLLTGAYDNTA----KVWSHPGWTPLKTLAGHEGKVMSVDVSPDGKLIATSSYDRTFKLWLS 504          
BLAST of pre-mRNA-processing factor 19 vs. Planmine SMEST
Match: SMESG000045309.1 (SMESG000045309.1)

HSP 1 Score: 1075.46 bits (2780), Expect = 0.000e+0
Identity = 516/517 (99.81%), Postives = 517/517 (100.00%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNT+NNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN
Sbjct:    1 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTANNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 517          
BLAST of pre-mRNA-processing factor 19 vs. Planmine SMEST
Match: SMESG000045321.1 (SMESG000045321.1)

HSP 1 Score: 1033.09 bits (2670), Expect = 0.000e+0
Identity = 500/517 (96.71%), Postives = 501/517 (96.91%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNAVVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENANTIISSSVDRTVKLYASN 1646
            MSLICSISNE+PEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITG               IVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHS LATGVRFGENANTIISSSVDRTVKLYASN
Sbjct:    1 MSLICSISNEVPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPEDLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITG---------------IVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDASCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQSLHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTTNGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQINDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSSLATGVRFGENANTIISSSVDRTVKLYASN 502          
BLAST of pre-mRNA-processing factor 19 vs. Planmine SMEST
Match: SMESG000020077.1 (SMESG000020077.1)

HSP 1 Score: 286.96 bits (733), Expect = 5.854e-87
Identity = 134/147 (91.16%), Postives = 140/147 (95.24%), Query Frame = 3
Query:  114 ISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSE 554
            ISNEI EVPVLNRLSGHVYEKRL+EKYLTTSDLD VTGVQFSGDDLIE +VPMHVKPKPPSFTSIPALLKSFQDEWDA MLQQFTMKQENQALKRELSHALYQYD SCRVVTRLT+E TAAREALSTLKPQAGITSHI+PPQA+Q +
Sbjct:  571 ISNEISEVPVLNRLSGHVYEKRLLEKYLTTSDLDSVTGVQFSGDDLIENRVPMHVKPKPPSFTSIPALLKSFQDEWDAFMLQQFTMKQENQALKRELSHALYQYDVSCRVVTRLTEEATAAREALSTLKPQAGITSHIIPPQAAQFD 717          
BLAST of pre-mRNA-processing factor 19 vs. Planmine SMEST
Match: SMESG000054023.1 (SMESG000054023.1)

HSP 1 Score: 273.863 bits (699), Expect = 1.115e-86
Identity = 130/153 (84.97%), Postives = 137/153 (89.54%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQSE 554
            MSLICSISNEIPEVPVLNR SGH YE+RLI+KY TTSDL+PVTGVQFSGDDLIEI+V MHVK KP SFT I ALLKSFQDEWDALMLQQF MKQENQALKRELSHALYQYD SCRVVTRLTKEV  AREALSTLKPQ GITSHI+ PQ +Q +
Sbjct:    1 MSLICSISNEIPEVPVLNRFSGHAYERRLIDKYSTTSDLNPVTGVQFSGDDLIEIRVLMHVKSKPHSFTPISALLKSFQDEWDALMLQQFIMKQENQALKRELSHALYQYDVSCRVVTRLTKEVNTAREALSTLKPQVGITSHIISPQVAQFD 153          
BLAST of pre-mRNA-processing factor 19 vs. Planmine SMEST
Match: SMESG000081505.1 (SMESG000081505.1)

HSP 1 Score: 271.552 bits (693), Expect = 1.164e-86
Identity = 132/151 (87.42%), Postives = 138/151 (91.39%), Query Frame = 3
Query:   96 MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGDDLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALKRELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQASQ 548
            MSLICSISNEI EVPVLNRLSG VYEK LIEK LTTS+LDPVT +QFSGDDLIEI+VPMHVKPK PSFTSIP  LKSFQDEWDAL+LQ  TMKQENQALKRELSHALYQYD SCRVVTRLTKE TA REALSTLKPQAGITSHI+PPQA+Q
Sbjct:    1 MSLICSISNEISEVPVLNRLSGRVYEKMLIEKCLTTSELDPVTAIQFSGDDLIEIRVPMHVKPKTPSFTSIPTSLKSFQDEWDALILQ--TMKQENQALKRELSHALYQYDVSCRVVTRLTKEATAGREALSTLKPQAGITSHIIPPQAAQ 149          
The following BLAST results are available for this feature:
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPF190.000e+053.59pre-mRNA processing factor 19 [Source:HGNC Symbol;... [more]
PRPF198.379e-8853.15pre-mRNA processing factor 19 [Source:HGNC Symbol;... [more]
PRPF198.868e-2954.63pre-mRNA processing factor 19 [Source:HGNC Symbol;... [more]
KATNB12.305e-2328.35katanin regulatory subunit B1 [Source:HGNC Symbol;... [more]
PRPF193.380e-2332.24pre-mRNA processing factor 19 [Source:HGNC Symbol;... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prp-191.856e-15044.38Pre-mRNA-processing factor 19 [Source:UniProtKB/S... [more]
prp-42.161e-2424.51Yeast PRP (Splicing factor) related [Source:UniPr... [more]
wdr-5.12.134e-1823.72WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.12.134e-1823.72WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
sel-101.128e-1526.46F-box/WD repeat-containing protein sel-10 [Source... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prp190.000e+052.23gene:FBgn0261119 transcript:FBtr0086723[more]
U4-U6-60K9.384e-2225.63gene:FBgn0036733 transcript:FBtr0075209[more]
kat801.319e-1729.48gene:FBgn0040207 transcript:FBtr0074246[more]
kat801.319e-1729.48gene:FBgn0040207 transcript:FBtr0074247[more]
kat801.451e-1729.48gene:FBgn0040207 transcript:FBtr0340443[more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpf190.000e+052.82pre-mRNA processing factor 19 [Source:ZFIN;Acc:ZDB... [more]
prpf41.696e-2525.09PRP4 pre-mRNA processing factor 4 homolog (yeast) ... [more]
prpf41.696e-2525.09PRP4 pre-mRNA processing factor 4 homolog (yeast) ... [more]
katnb17.104e-2428.17katanin p80 (WD repeat containing) subunit B 1 [So... [more]
katnb13.455e-2327.97katanin p80 (WD repeat containing) subunit B 1 [So... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14a1.058e-17155.13LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14a2.313e-14450.57LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14a6.645e-13542.20LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14a1.378e-13241.18LSM14A mRNA processing body assembly factor [Sourc... [more]
hnrnpa2b11.616e-2427.41heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prpf190.000e+053.59pre-mRNA processing factor 19 [Source:MGI Symbol;A... [more]
Prpf190.000e+051.69pre-mRNA processing factor 19 [Source:MGI Symbol;A... [more]
Katnb11.652e-2328.35katanin p80 (WD40-containing) subunit B 1 [Source:... [more]
Daw11.001e-2026.56dynein assembly factor with WDR repeat domains 1 [... [more]
Prpf42.017e-2023.19pre-mRNA processing factor 4 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08E38|PRP19_BOVIN0.000e+053.79Pre-mRNA-processing factor 19 OS=Bos taurus OX=991... [more]
sp|Q9UMS4|PRP19_HUMAN0.000e+053.59Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9... [more]
sp|Q9JMJ4|PRP19_RAT0.000e+053.59Pre-mRNA-processing factor 19 OS=Rattus norvegicus... [more]
sp|Q99KP6|PRP19_MOUSE0.000e+053.59Pre-mRNA-processing factor 19 OS=Mus musculus OX=1... [more]
sp|Q5ZMA2|PRP19_CHICK0.000e+051.94Pre-mRNA-processing factor 19 OS=Gallus gallus OX=... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QF010.000e+054.46Pre-mRNA-processing factor 19 OS=Schistosoma bovis... [more]
A0A4E0R0150.000e+055.16Pre-mRNA-processing factor 19 OS=Fasciola hepatica... [more]
A0A504Z8V40.000e+055.16Pre-mRNA-processing factor 19 OS=Fasciola gigantic... [more]
A0A5K3EN210.000e+056.43Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K4F9L90.000e+054.77Putative wd-repeat protein OS=Schistosoma mansoni ... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpf190.000e+053.01pre-mRNA processing factor 19 [Source:NCBI gene;Ac... [more]
prpf190.000e+049.90pre-mRNA processing factor 19 [Source:NCBI gene;Ac... [more]
katnb11.134e-2228.33katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb11.253e-2228.33katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb11.729e-2227.31katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POC1A2.941e-1825.52POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
pafah1b1b1.578e-1522.90platelet-activating factor acetylhydrolase 1b, reg... [more]
ENSPMAT00000008862.17.887e-1526.52pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
taf5l6.905e-1427.88TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
ENSPMAT00000004902.17.348e-1424.10pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TAF51.943e-1926.90Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
PRP41.127e-1724.56Splicing factor; component of the U4/U6-U5 snRNP c... [more]
PRP195.332e-1634.62Splicing factor associated with the spliceosome; c... [more]
PWP22.277e-1524.21Conserved 90S pre-ribosomal component; essential f... [more]
RSA45.364e-1225.00WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474040.000e+053.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
KATNB11.305e-2226.51Katanin p80 WD40 repeat-containing subunit B1 [So... [more]
EDO453468.241e-2224.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348653.385e-2025.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432958.445e-2025.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpf190.000e+053.29pre-mRNA processing factor 19 [Source:NCBI gene;Ac... [more]
daw12.620e-2524.42dynein assembly factor with WD repeats 1 [Source:N... [more]
daw14.198e-2524.42dynein assembly factor with WD repeats 1 [Source:N... [more]
prpf43.166e-2326.12pre-mRNA processing factor 4 [Source:NCBI gene;Acc... [more]
prpf43.166e-2326.12pre-mRNA processing factor 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of pre-mRNA-processing factor 19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045309.10.000e+099.81SMESG000045309.1[more]
SMESG000045321.10.000e+096.71SMESG000045321.1[more]
SMESG000020077.15.854e-8791.16SMESG000020077.1[more]
SMESG000054023.11.115e-8684.97SMESG000054023.1[more]
SMESG000081505.11.164e-8687.42SMESG000081505.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027904 ID=SMED30027904|Name=pre-mRNA-processing factor 19|organism=Schmidtea mediterranea sexual|type=transcript|length=1730bp
ATTATTGAAAAAGATTTCTATGACTAGTAAACCTATTACATAAGACTTTG
CTAATTTTTGTTTAAAAGAATTAATCTATTTAAATCTTCTTTAAAATGTC
GTTAATATGTTCAATTTCTAATGAAATTCCTGAAGTTCCAGTTCTTAATA
GATTATCAGGACATGTTTACGAAAAAAGGTTAATTGAAAAATACTTAACA
ACCAGTGATCTAGATCCAGTCACTGGAGTACAGTTTTCTGGAGATGATCT
GATTGAAATTAAAGTTCCAATGCACGTGAAACCGAAGCCACCCAGTTTTA
CATCCATTCCAGCTTTATTGAAATCTTTTCAGGATGAATGGGATGCTTTG
ATGCTTCAACAATTTACGATGAAGCAAGAGAACCAGGCTCTTAAACGTGA
ATTGTCTCACGCTCTTTACCAATACGATGCTTCGTGTAGAGTTGTGACTC
GTTTAACTAAAGAAGTTACTGCAGCTCGAGAAGCTTTATCCACTCTTAAA
CCACAAGCTGGAATTACTTCTCATATTGTTCCTCCTCAAGCTTCACAAAG
CGAACACGAAATGGAAGTCGAAGTTTCTTATAATCATAATGTTCAAGAAG
CTGTAGGAATGAGTCAAGAAATCGAAATACAACTTCAAGAAAAATCTCAA
ATGCTCACGTCTGAAAGAAAAAAACGAGGCAAACAAATGCCAGAAGACTT
AGCTAGACCTAGTTCAATGGAAAGTTTTGTTGTGAAAAACACACAAACTG
GTTTGCATTCTGCCAGTATTCCCGGTATTGTGGCATTGGATGTGTCTAAA
AAAGATTCGAGTAAAATAATTACTGGGGGTAATGATAAAAATGCAGTTGT
CTTTAATACATCAAATAATCAGATTGTTTGTACATTGAAAGGTCATACGA
AAAAAGTTTCTTGTGTGGTTTATCATAATTCTGATGAAATTGCCGTAACT
GCATCGCCTGATAGTACTATTCGAGTGTGGAAAATTGATGATGCCAGCTG
TGAACATGTAATTCGTGCACACACTGGCAATGTTACTGGTTTGAGTCTCC
ATGCGACTGGTAATTACGTTCTCTCCAGTAGCAATGACGGCTATTGGGCG
TTTTCTGATATCTATACCGGAAAAGTCATTATGCGTCACCAAAGTCTCCA
TAATAAAACTGAAGCCATTCAGAGTTTAACATGTATGAAATCTCACCCGG
ACGGATTGATTTGTGCGACCGGTACCGAGGACGGTGAGGTGTCTATTTGG
AATTTGAAGGAAGTGAAAAAAGTCGCATTTCTGCCCCATACAACAAATGG
ATCTGTGCGCACGCTTGCGTTCTCGGAAAATGGATTTTATTTAGCTACCG
GGGGCAGTGACGGCCTCATCAAGCTGTGGGATTTGAGAAAGGTTCGAGAT
TTTAAGACTTTGAGCCCAGGAGATGACAGAGCAACCTACCAAATCAATGA
TTTAGAGTTCGATAATTCCGGCAGTTACCTGGGGGTGGCCGGAACAGACG
TCCGTGTCTATCTCAGCAAGCAATGGGAACGAGTTGTCAGTTTCAGTGAC
CACAGTGGCTTGGCTACGGGTGTTAGATTCGGTGAGAACGCAAACACCAT
TATTAGCAGCAGCGTTGACAGAACCGTGAAATTATACGCGTCCAATTGAA
TGTTGAAATATAAAATCAATAATTCAAAAATGTTTTATTCATTTTTTATT
TGGGTTTTGAACAAATAAATGGCAGATCGG
back to top

protein sequence of SMED30027904-orf-1

>SMED30027904-orf-1 ID=SMED30027904-orf-1|Name=SMED30027904-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MSLICSISNEIPEVPVLNRLSGHVYEKRLIEKYLTTSDLDPVTGVQFSGD
DLIEIKVPMHVKPKPPSFTSIPALLKSFQDEWDALMLQQFTMKQENQALK
RELSHALYQYDASCRVVTRLTKEVTAAREALSTLKPQAGITSHIVPPQAS
QSEHEMEVEVSYNHNVQEAVGMSQEIEIQLQEKSQMLTSERKKRGKQMPE
DLARPSSMESFVVKNTQTGLHSASIPGIVALDVSKKDSSKIITGGNDKNA
VVFNTSNNQIVCTLKGHTKKVSCVVYHNSDEIAVTASPDSTIRVWKIDDA
SCEHVIRAHTGNVTGLSLHATGNYVLSSSNDGYWAFSDIYTGKVIMRHQS
LHNKTEAIQSLTCMKSHPDGLICATGTEDGEVSIWNLKEVKKVAFLPHTT
NGSVRTLAFSENGFYLATGGSDGLIKLWDLRKVRDFKTLSPGDDRATYQI
NDLEFDNSGSYLGVAGTDVRVYLSKQWERVVSFSDHSGLATGVRFGENAN
TIISSSVDRTVKLYASN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006281DNA repair
GO:0016567protein ubiquitination
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0000974Prp19 complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR038959Prp19
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR003613Ubox_domain
IPR013915Pre-mRNA_splic_Prp19
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR013083Znf_RING/FYVE/PHD
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 416..430
score: 40.32
coord: 283..297
score: 34.24
coord: 373..387
score: 29.69
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 299..338
e-value: 3.3E-4
score: 30.0
coord: 257..296
e-value: 8.0E-9
score: 45.3
coord: 389..429
e-value: 6.0E-7
score: 39.1
coord: 341..386
e-value: 0.017
score: 24.3
coord: 432..473
e-value: 160.0
score: 3.0
coord: 476..515
e-value: 0.011
score: 24.9
coord: 218..254
e-value: 5.2
score: 12.5
IPR001680WD40 repeatPFAMPF00400WD40coord: 480..514
e-value: 0.1
score: 13.5
coord: 301..332
e-value: 0.024
score: 15.5
coord: 259..296
e-value: 5.8E-4
score: 20.6
coord: 398..429
e-value: 9.3E-5
score: 23.1
coord: 359..386
e-value: 0.004
score: 18.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 483..517
score: 9.974
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 264..305
score: 14.251
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 397..438
score: 13.316
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 361..395
score: 8.838
IPR003613U box domainSMARTSM00504Ubox_2coord: 2..68
e-value: 4.3E-15
score: 66.1
IPR003613U box domainPROSITEPS51698U_BOXcoord: 1..73
score: 16.968
IPR013915Pre-mRNA-splicing factor 19PFAMPF08606Prp19coord: 68..133
e-value: 1.3E-28
score: 98.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 2..58
e-value: 7.9E-16
score: 59.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 199..516
e-value: 2.9E-95
score: 320.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..205
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..200
NoneNo IPR availablePANTHERPTHR43995:SF1PRE-MRNA-PROCESSING FACTOR 19coord: 1..515
NoneNo IPR availableCDDcd00200WD40coord: 227..515
e-value: 1.7855E-48
score: 167.127
NoneNo IPR availableCDDcd16656RING-Ubox_PRP19coord: 4..56
e-value: 6.93987E-23
score: 89.5618
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 3..55
IPR038959Pre-mRNA-processing factor 19PANTHERPTHR43995FAMILY NOT NAMEDcoord: 1..515
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 373..387
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 416..430
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 221..517
score: 36.358
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 227..514