Spermatogenesis associated 1

Overview
NameSpermatogenesis associated 1
Smed IDSMED30027901
Length (bp)1007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spermatogenesis associated 1 (SMED30027901) t-SNE clustered cells

Violin plots show distribution of expression levels for Spermatogenesis associated 1 (SMED30027901) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spermatogenesis associated 1 (SMED30027901) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spermatogenesis associated 1 (SMED30027901) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027901

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027901SMESG000049418.1 SmedASXL_008938SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30027901SMESG000049418.1 dd_Smed_v4_12212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30027901SMESG000049418.1 dd_Smed_v4_12212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30027901SMESG000049418.1 dd_Smed_v4_12212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30027901SMESG000049418.1 dd_Smed_v4_12212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027901SMESG000049418.1 dd_Smed_v6_12212_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027901SMESG000049418.1 dd_Smed_v4_12212_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30027901SMESG000049418.1 dd_Smed_v4_12212_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spermatogenesis associated 1 vs. Ensembl Human
Match: SPATA1 (spermatogenesis associated 1 [Source:HGNC Symbol;Acc:HGNC:14682])

HSP 1 Score: 70.0922 bits (170), Expect = 1.058e-12
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 1
Query:  424 KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKAN-------LMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNK 783
            KR    + WKK+Y E KK T  +E+ L + RE++E+ +KKLL           +L+ R   M P N AN       L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ L+ E  Q K
Sbjct:  334 KRYHAYNGWKKKYLETKKVTASMEEVLTKLREDLELYYKKLL----------MQLEAREIKMRPKNLANITDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIVEVKMRKQAVSDLRTLKTELAQKK 450          
BLAST of Spermatogenesis associated 1 vs. Ensembl Zebrafish
Match: SPATA1 (si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-11])

HSP 1 Score: 80.1073 bits (196), Expect = 3.339e-16
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  409 MNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNG------IMSPSN---KANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRL 792
            +N H +RNQ RD WK++YF+ KK T  LED+L   ++E+   + K+L          ++LQ R+G         PS+   K  L++Q      EI+NL++ ++  +M+L+ E+KLR Q  TEL+ LR E M+ K +L
Sbjct:  343 LNRH-RRNQARDRWKRQYFDTKKSTTSLEDKLKGIQQELHTFYSKML----------QQLQARDGAKHRTQTRKPSSSRLKNELIIQIMTESSEIDNLRKNVDDAKMKLATEIKLRKQAATELRALRAELMEKKAQL 468          
BLAST of Spermatogenesis associated 1 vs. Ensembl Zebrafish
Match: SPATA1 (si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-11])

HSP 1 Score: 79.7221 bits (195), Expect = 4.637e-16
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  409 MNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNG------IMSPSN---KANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRL 792
            +N H +RNQ RD WK++YF+ KK T  LED+L   ++E+   + K+L          ++LQ R+G         PS+   K  L++Q      EI+NL++ ++  +M+L+ E+KLR Q  TEL+ LR E M+ K +L
Sbjct:  306 LNRH-RRNQARDRWKRQYFDTKKSTTSLEDKLKGIQQELHTFYSKML----------QQLQARDGAKHRTQTRKPSSSRLKNELIIQIMTESSEIDNLRKNVDDAKMKLATEIKLRKQAATELRALRAELMEKKAQL 431          
BLAST of Spermatogenesis associated 1 vs. Ensembl Xenopus
Match: SPATA1 (spermatogenesis associated 1 [Source:NCBI gene;Acc:100498562])

HSP 1 Score: 80.8777 bits (198), Expect = 2.185e-16
Identity = 47/124 (37.90%), Postives = 78/124 (62.90%), Query Frame = 1
Query:  424 KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLS 795
            KR+Q RD WKK+YFE KK T  LE+ L + R ++E+ +KKL+  ++   R+ RK  K   + + S  A +++     QHE++ L+R++E+ +++L  E+K+R Q  +EL VL+ E  Q K + S
Sbjct:  310 KRHQARDSWKKKYFERKKVTSVLEETLNKQRNDLEVYYKKLM--IQLAARDSRKRSKAPALAANSKNA-VIISITTKQHELDQLKRKVENARIKLLIEIKMRKQASSELNVLKAELAQKKAQSS 430          
BLAST of Spermatogenesis associated 1 vs. Ensembl Mouse
Match: Spata1 (spermatogenesis associated 1 [Source:MGI Symbol;Acc:MGI:1918201])

HSP 1 Score: 70.4774 bits (171), Expect = 2.060e-14
Identity = 41/112 (36.61%), Postives = 71/112 (63.39%), Query Frame = 1
Query:  442 DFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQ 777
            D WKK+Y + KK T  LE+ L + RE++E+ +KKLL  +E+  RE  K++ RN      +K  L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ L+ +  Q
Sbjct:   28 DSWKKKYLDTKKVTASLEEVLTKLREDLELYYKKLLMQLEA--REI-KMRPRNLANISDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLILEVKMRKQAVSDLQTLKADLTQ 136          
BLAST of Spermatogenesis associated 1 vs. Ensembl Mouse
Match: Spata1 (spermatogenesis associated 1 [Source:MGI Symbol;Acc:MGI:1918201])

HSP 1 Score: 72.7886 bits (177), Expect = 9.722e-14
Identity = 44/122 (36.07%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  421 TKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKI 786
            +KR    D WKK+Y + KK T  LE+ L + RE++E+ +KKLL  +E+  RE  K++ RN      +K  L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ L+ +  Q K+
Sbjct:  311 SKRYHASDSWKKKYLDTKKVTASLEEVLTKLREDLELYYKKLLMQLEA--REI-KMRPRNLANISDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLILEVKMRKQAVSDLQTLKADLTQKKM 429          
BLAST of Spermatogenesis associated 1 vs. Ensembl Mouse
Match: Spata1 (spermatogenesis associated 1 [Source:MGI Symbol;Acc:MGI:1918201])

HSP 1 Score: 72.7886 bits (177), Expect = 9.722e-14
Identity = 44/122 (36.07%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  421 TKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKI 786
            +KR    D WKK+Y + KK T  LE+ L + RE++E+ +KKLL  +E+  RE  K++ RN      +K  L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ L+ +  Q K+
Sbjct:  311 SKRYHASDSWKKKYLDTKKVTASLEEVLTKLREDLELYYKKLLMQLEA--REI-KMRPRNLANISDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLILEVKMRKQAVSDLQTLKADLTQKKM 429          
BLAST of Spermatogenesis associated 1 vs. UniProt/SwissProt
Match: sp|Q6AY22|SPAT1_RAT (Spermatogenesis-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Spata1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.920e-14
Identity = 46/122 (37.70%), Postives = 77/122 (63.11%), Query Frame = 1
Query:  421 TKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKI 786
            +KR    D WKK+YF+ KK T  LE+ L + RE++E+ +KKLL  +E+  RE  K++ RN      +K  L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ LR +  Q K+
Sbjct:  311 SKRYHACDSWKKKYFDTKKVTASLEEVLTKLREDLELYYKKLLMQLEA--REI-KMRPRNLANISDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLILEVKMRKQAASDLQTLRADLTQKKM 429          
BLAST of Spermatogenesis associated 1 vs. UniProt/SwissProt
Match: sp|Q9D5R4|SPAT1_MOUSE (Spermatogenesis-associated protein 1 OS=Mus musculus OX=10090 GN=Spata1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.801e-13
Identity = 44/122 (36.07%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  421 TKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKI 786
            +KR    D WKK+Y + KK T  LE+ L + RE++E+ +KKLL  +E+  RE  K++ RN      +K  L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ L+ +  Q K+
Sbjct:  311 SKRYHASDSWKKKYLDTKKVTASLEEVLTKLREDLELYYKKLLMQLEA--REI-KMRPRNLANISDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLILEVKMRKQAVSDLQTLKADLTQKKM 429          
BLAST of Spermatogenesis associated 1 vs. UniProt/SwissProt
Match: sp|Q5VX52|SPAT1_HUMAN (Spermatogenesis-associated protein 1 OS=Homo sapiens OX=9606 GN=SPATA1 PE=2 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 5.080e-12
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 1
Query:  424 KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKAN-------LMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNK 783
            KR    + WKK+Y E KK T  +E+ L + RE++E+ +KKLL           +L+ R   M P N AN       L++Q   +QH I+ L+R+++  +M+L  E+K+R Q  ++L+ L+ E  Q K
Sbjct:  334 KRYHAYNGWKKKYLETKKVTASMEEVLTKLREDLELYYKKLL----------MQLEAREIKMRPKNLANITDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIVEVKMRKQAVSDLRTLKTELAQKK 450          
BLAST of Spermatogenesis associated 1 vs. TrEMBL
Match: A0A267F5C1 (SPATA1_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024004g1 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.426e-32
Identity = 70/152 (46.05%), Postives = 99/152 (65.13%), Query Frame = 1
Query:  397 RASQMNVHTK--RNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSV 846
            RA Q+   T+  RNQ RD WKKRYFEEKK T PLEDQ  R R+E+E  HK+++  M S ++E + +   +     + + NL +QA R+QHEIE LQR+++  +M+L+AE+KLRSQ E EL+ ++ E  Q K+ LS TR+ Q+     GH  V
Sbjct:   50 RARQLQARTQNMRNQARDMWKKRYFEEKKLTTPLEDQANRLRDELESYHKRMVSTMTSRVKEGKNIDTPDA----TQQLNLRIQATRMQHEIEELQRRVDDSKMKLTAEVKLRSQAEAELRAMKAELTQRKLNLSMTRTQQM-----GHQMV 192          
BLAST of Spermatogenesis associated 1 vs. TrEMBL
Match: A0A267F575 (SPATA1_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005998g1 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.546e-31
Identity = 69/152 (45.39%), Postives = 99/152 (65.13%), Query Frame = 1
Query:  397 RASQMNVHTK--RNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSV 846
            RA Q+   T+  RNQ RD WKKRYFEEKK T PLEDQ  R R+E+E  HK+++  M S ++E + +   +     + + NL +QA R+QHEIE LQR+++  +M+L+AE+KLR+Q E EL+ ++ E  Q K+ LS TR+ Q+     GH  V
Sbjct:   50 RARQLQARTQNMRNQARDMWKKRYFEEKKLTTPLEDQANRLRDELESYHKRMVSTMTSRVKEGKNIDTPDA----TQQLNLRIQATRMQHEIEELQRRVDDSKMKLTAEVKLRTQAEAELRAMKAELTQRKLNLSMTRTQQM-----GHQMV 192          
BLAST of Spermatogenesis associated 1 vs. TrEMBL
Match: A0A1I8I535 (SPATA1_C domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.399e-30
Identity = 69/152 (45.39%), Postives = 98/152 (64.47%), Query Frame = 1
Query:  397 RASQMNVHTK--RNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSV 846
            RA Q+   T+  RNQ RD WKKRYFEEKK T PLEDQ  R R+E+E  HK+++  M S ++E + +         + + NL +QA R+QHEIE LQR+++  +M+L+AE+KLR+Q E EL+ ++ E  Q K+ LS TR+ Q+     GH  V
Sbjct:  211 RARQLQARTQNMRNQARDMWKKRYFEEKKLTTPLEDQANRLRDELESYHKRMVSTMTSRVKEGKNID----TPDATQQLNLRIQATRMQHEIEELQRRVDDSKMKLTAEVKLRTQAEAELRAMKAELTQRKLNLSMTRTQQM-----GHQMV 353          
BLAST of Spermatogenesis associated 1 vs. TrEMBL
Match: R7TD47 (SPATA1_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_149845 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.645e-29
Identity = 70/167 (41.92%), Postives = 104/167 (62.28%), Query Frame = 1
Query:  391 KIRASQMNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFME--SGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSVVHSYE--YTTTPR 879
            +I+  Q    T+RNQ RD WKK+YF+EKK+TP  E++  + R+E+E LH++++  ME  S  +  R     +   S   ++NL +QA + QHE++ L R++E+ +MRL+AEMKLR+Q ETEL+ LR E  Q KI ++ TRS Q    A G    + SY   +  TPR
Sbjct:   60 RIKGLQGKSSTRRNQARDVWKKKYFDEKKRTPAHEEKTNKLRQELENLHRRIMSTMEGNSDGKTPRHGGDPSTAASNPKESNLKIQATKYQHELDELHRKVENIKMRLTAEMKLRTQAETELRALRAELTQKKINVTLTRSQQY--QAIGIAPPLDSYPAAHAVTPR 224          
BLAST of Spermatogenesis associated 1 vs. TrEMBL
Match: A0A267FRY9 (SPATA1_C domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003676g2 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.256e-28
Identity = 66/140 (47.14%), Postives = 95/140 (67.86%), Query Frame = 1
Query:  427 RNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSV 846
            RNQ RD WKKRYFE KK+T PLE+Q  + REE+E  HK+++G M S ++E R +   +     + + NL +QA R+QHEIE LQR+++  +M+L+AE+KLR+Q E+EL+ ++ E  Q K+ LS TRS Q+     G NS 
Sbjct:  367 RNQARDMWKKRYFEAKKQTVPLEEQTNKLREELEAYHKRMVGTMTSRVKEGRNVDAPDA----TQQLNLRIQATRMQHEIEELQRRVDDSKMKLTAEVKLRTQAESELRTMKSELTQRKLNLSVTRSQQM-----GQNSA 497          
BLAST of Spermatogenesis associated 1 vs. Ensembl Cavefish
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:103031330])

HSP 1 Score: 92.4337 bits (228), Expect = 1.259e-20
Identity = 55/131 (41.98%), Postives = 80/131 (61.07%), Query Frame = 1
Query:  409 MNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRT 801
            +N H +RNQ RD WK++YF+ KK T PLE+ L   R+E+E  + KL  F +   R+ R  Q+R G  S S K NL++Q      EI+NL++ ++  +M+L  E KL+ Q  TEL+ L+ E MQ K + S T
Sbjct:  251 LNRH-RRNQARDKWKRKYFDTKKATAPLEEALKSLRQELETFYDKL--FQQLQARDGRNRQRRTGNPS-STKNNLIIQIMTESWEIDNLKKNLDDAKMKLVTETKLKKQAATELRALKAELMQKKSQCSIT 377          
BLAST of Spermatogenesis associated 1 vs. Ensembl Cavefish
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:103031330])

HSP 1 Score: 93.2041 bits (230), Expect = 1.321e-20
Identity = 55/131 (41.98%), Postives = 80/131 (61.07%), Query Frame = 1
Query:  409 MNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRT 801
            +N H +RNQ RD WK++YF+ KK T PLE+ L   R+E+E  + KL  F +   R+ R  Q+R G  S S K NL++Q      EI+NL++ ++  +M+L  E KL+ Q  TEL+ L+ E MQ K + S T
Sbjct:  353 LNRH-RRNQARDKWKRKYFDTKKATAPLEEALKSLRQELETFYDKL--FQQLQARDGRNRQRRTGNPS-STKNNLIIQIMTESWEIDNLKKNLDDAKMKLVTETKLKKQAATELRALKAELMQKKSQCSIT 479          
BLAST of Spermatogenesis associated 1 vs. Ensembl Nematostella
Match: EDO46192 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQN1])

HSP 1 Score: 108.227 bits (269), Expect = 5.133e-26
Identity = 58/142 (40.85%), Postives = 95/142 (66.90%), Query Frame = 1
Query:  397 RASQMNVHT--KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGI---MSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRS 807
            RA  +   T  KRNQ ++ WKK++F+EK+KT PLE+Q+ R R E E+ H+ +L F+E+  ++ R+   + G     +PS K+N ++  AR+Q+E+E+L+R++E  +M L++EMKLR   + ELK LR + +  KI L+ T+S
Sbjct:  604 RAKTLQTQTMQKRNQSKNIWKKKFFDEKRKTAPLEEQVNRLRYETEVQHQAMLSFLET--KKDREGGAKGGSELDKTPSQKSNQLILLARLQNEVEDLRRKVEETKMMLASEMKLRDAAQNELKQLREDLLDKKINLTLTKS 743          
BLAST of Spermatogenesis associated 1 vs. Ensembl Medaka
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:101173620])

HSP 1 Score: 73.9442 bits (180), Expect = 3.127e-14
Identity = 42/104 (40.38%), Postives = 68/104 (65.38%), Query Frame = 1
Query:  424 KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQ 735
            +RNQ R+ WKK++FE KK T PLE+ L   R+E+E  + KL+  +++  RE R   +R G  S  N+  +++   +  +EI+NL+R++E  +M+L AE+KLR Q
Sbjct:  377 RRNQARNCWKKKFFETKKATGPLEETLKNLRQEMETFYNKLVLQLQA--RESRGKMRRQGRSSLKNELTVLIM--KETYEIDNLKRKVEDAEMKLVAEIKLRKQ 476          
BLAST of Spermatogenesis associated 1 vs. Ensembl Medaka
Match: si:dkey-205k8.5 (spermatogenesis associated 1 [Source:NCBI gene;Acc:101173620])

HSP 1 Score: 73.9442 bits (180), Expect = 3.188e-14
Identity = 42/104 (40.38%), Postives = 68/104 (65.38%), Query Frame = 1
Query:  424 KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQ 735
            +RNQ R+ WKK++FE KK T PLE+ L   R+E+E  + KL+  +++  RE R   +R G  S  N+  +++   +  +EI+NL+R++E  +M+L AE+KLR Q
Sbjct:  372 RRNQARNCWKKKFFETKKATGPLEETLKNLRQEMETFYNKLVLQLQA--RESRGKMRRQGRSSLKNELTVLIM--KETYEIDNLKRKVEDAEMKLVAEIKLRKQ 471          
BLAST of Spermatogenesis associated 1 vs. Planmine SMEST
Match: SMESG000049418.1 (SMESG000049418.1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.658e-156
Identity = 239/239 (100.00%), Postives = 239/239 (100.00%), Query Frame = 1
Query:  211 LAIQEAYNNKPVVAKFEIKDPELVLEGATEIEQINHLKQILKSAXXXXXXXXXXXXXXXXKIRASQMNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSVVHSYEYTTTPRNMPNFTTPPNDRFLQN 927
            LAIQEAYNNKPVVAKFEIKDPELVLEGATEIEQINHLKQILKSAIAERQQSESRREEAIRKIRASQMNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSVVHSYEYTTTPRNMPNFTTPPNDRFLQN
Sbjct:  530 LAIQEAYNNKPVVAKFEIKDPELVLEGATEIEQINHLKQILKSAIAERQQSESRREEAIRKIRASQMNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSVVHSYEYTTTPRNMPNFTTPPNDRFLQN 768          
BLAST of Spermatogenesis associated 1 vs. Planmine SMEST
Match: SMESG000004654.1 (SMESG000004654.1)

HSP 1 Score: 101.293 bits (251), Expect = 1.414e-23
Identity = 52/147 (35.37%), Postives = 89/147 (60.54%), Query Frame = 1
Query:  397 RASQMNVHT--KRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAA 831
            +A Q+   T  ++N  RD WKKRYFEEKK+ PP+ED L + R E++ +H+K++  MES ++++R       I+   +   + +QA ++++EIE  QR ++  +++L+ E+K+  Q   E+  +R + +Q KI LS  RS  L  M  
Sbjct:  330 KAKQLYTKTANQKNIARDMWKKRYFEEKKRNPPMEDHLNKQRSELDAIHRKIMSTMESFMKDNRNRGANEKIV---DVGKMRMQAKKLEYEIEEAQRGVDEAKLKLTCEIKMTHQARAEVVAMRADLVQKKINLSMARSQHLSSMGT 473          
BLAST of Spermatogenesis associated 1 vs. Planmine SMEST
Match: SMESG000029165.1 (SMESG000029165.1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.808e-14
Identity = 40/132 (30.30%), Postives = 79/132 (59.85%), Query Frame = 1
Query:  448 WKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGFMESGLREHRKLQKRNGI----MSPSNKANLMLQAARIQHEIENLQRQIEHCQMRLSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAA 831
            WKKR++E+KK TPP+E ++   R  +E  H K++  M++ LR+ + + K  G+        ++ N++ +A +++ +IE +QR ++  + +L+AE+KL  Q E E + ++ +  +  I+L+  RS +L  M  
Sbjct:  202 WKKRFYEQKKLTPPIEKKMNELRANLEATHSKIVNIMKARLRDTKWI-KDLGLPELDKESYDQLNVVTRAIKLKQDIEEIQRIVDEGKEKLTAEIKLHCQAEQEARFIQADTTRRNIQLAIIRSKELAKMGT 332          
The following BLAST results are available for this feature:
BLAST of Spermatogenesis associated 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA11.058e-1234.65spermatogenesis associated 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SPATA13.339e-1636.50si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-1... [more]
SPATA14.637e-1636.50si:dkey-205k8.5 [Source:ZFIN;Acc:ZDB-GENE-141216-1... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA12.185e-1637.90spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Spata12.060e-1436.61spermatogenesis associated 1 [Source:MGI Symbol;Ac... [more]
Spata19.722e-1436.07spermatogenesis associated 1 [Source:MGI Symbol;Ac... [more]
Spata19.722e-1436.07spermatogenesis associated 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6AY22|SPAT1_RAT3.920e-1437.70Spermatogenesis-associated protein 1 OS=Rattus nor... [more]
sp|Q9D5R4|SPAT1_MOUSE6.801e-1336.07Spermatogenesis-associated protein 1 OS=Mus muscul... [more]
sp|Q5VX52|SPAT1_HUMAN5.080e-1234.65Spermatogenesis-associated protein 1 OS=Homo sapie... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F5C16.426e-3246.05SPATA1_C domain-containing protein OS=Macrostomum ... [more]
A0A267F5751.546e-3145.39SPATA1_C domain-containing protein OS=Macrostomum ... [more]
A0A1I8I5354.399e-3045.39SPATA1_C domain-containing protein OS=Macrostomum ... [more]
R7TD476.645e-2941.92SPATA1_C domain-containing protein OS=Capitella te... [more]
A0A267FRY91.256e-2847.14SPATA1_C domain-containing protein (Fragment) OS=M... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-205k8.51.259e-2041.98spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
si:dkey-205k8.51.321e-2041.98spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO461925.133e-2640.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-205k8.53.127e-1440.38spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
si:dkey-205k8.53.188e-1440.38spermatogenesis associated 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Spermatogenesis associated 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000049418.12.658e-156100.00SMESG000049418.1[more]
SMESG000004654.11.414e-2335.37SMESG000004654.1[more]
SMESG000029165.15.808e-1430.30SMESG000029165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027901 ID=SMED30027901|Name=Spermatogenesis associated 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1007bp
ACTTTGGCCTCCTGGATAATTTTGCCTCATATCTGATTGACATTCAACGT
GTTGGTAATACTGTTACAACTTTGAAGCTTTGCAATTTTACAAATTTAAT
TTAAAATGGTAGCTCTTGCCAAAGAAAGATTTGAGGAAGAACAAAGACAT
TGGGAGGAAGAGAGAATACGTTATGAAGAAGAAGAAAAACGAAGAATGGA
AGAAATGGAGCTGGCTATACAAGAAGCGTATAATAATAAACCAGTCGTAG
CTAAATTCGAAATAAAAGATCCAGAATTGGTTTTGGAGGGTGCGACAGAG
ATAGAGCAAATAAACCACCTGAAACAGATATTGAAATCTGCAATAGCCGA
AAGGCAACAGTCAGAAAGTCGGCGAGAAGAAGCGATTCGAAAGATTCGCG
CAAGTCAAATGAATGTTCATACGAAAAGAAATCAAATTAGAGATTTTTGG
AAGAAACGCTATTTTGAAGAGAAGAAAAAAACTCCACCACTGGAGGACCA
ATTGGCTAGATATAGGGAAGAGATTGAAATTCTTCATAAAAAATTGTTAG
GATTTATGGAGTCCGGTTTGAGAGAACATCGAAAATTGCAAAAGCGAAAT
GGAATTATGAGTCCTTCGAATAAAGCCAATTTGATGTTGCAGGCGGCCCG
CATCCAACACGAAATTGAGAATCTTCAAAGGCAGATTGAGCACTGCCAAA
TGCGACTGTCTGCAGAAATGAAACTTCGATCTCAAACAGAAACAGAATTA
AAAGTTCTTCGAATCGAAGCCATGCAGAACAAAATTCGCCTTAGCAGAAC
TCGATCCGATCAACTGGTGATCATGGCTGCCGGCCATAATTCTGTCGTAC
ACTCATACGAATACACGACTACTCCCCGTAATATGCCTAATTTTACTACC
CCACCCAATGACAGATTTTTGCAAAATTGATGACTTTTATTTTTTTATCA
TATTGTAAATGTACTTTTATATAACTCAATTACCAGATAATATAATTTTT
TTGATTT
back to top

protein sequence of SMED30027901-orf-1

>SMED30027901-orf-1 ID=SMED30027901-orf-1|Name=SMED30027901-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MVALAKERFEEEQRHWEEERIRYEEEEKRRMEEMELAIQEAYNNKPVVAK
FEIKDPELVLEGATEIEQINHLKQILKSAIAERQQSESRREEAIRKIRAS
QMNVHTKRNQIRDFWKKRYFEEKKKTPPLEDQLARYREEIEILHKKLLGF
MESGLREHRKLQKRNGIMSPSNKANLMLQAARIQHEIENLQRQIEHCQMR
LSAEMKLRSQTETELKVLRIEAMQNKIRLSRTRSDQLVIMAAGHNSVVHS
YEYTTTPRNMPNFTTPPNDRFLQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR039062SPAT1
IPR031478SPATA1_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 173..207
NoneNo IPR availableCOILSCoilCoilcoord: 69..96
NoneNo IPR availableCOILSCoilCoilcoord: 6..44
IPR031478Spermatogenesis-associated protein 1, C-terminal domainPFAMPF15743SPATA1_Ccoord: 77..226
e-value: 1.7E-32
score: 112.6
IPR039062Spermatogenesis-associated protein 1PANTHERPTHR14421SPERMATOGENESIS-ASSOCIATED PROTEIN 1coord: 32..232