Serine/threonine kinase receptor associated protein

Overview
NameSerine/threonine kinase receptor associated protein
Smed IDSMED30027898
Length (bp)889
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase receptor associated protein (SMED30027898) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase receptor associated protein (SMED30027898) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase receptor associated protein (SMED30027898) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase receptor associated protein (SMED30027898) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027898

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027898h1SMcG0008025 SmedASXL_010639SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027898h1SMcG0008025 SmedASXL_010639SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Human
Match: STRAP (serine/threonine kinase receptor associated protein [Source:HGNC Symbol;Acc:HGNC:30796])

HSP 1 Score: 147.517 bits (371), Expect = 2.939e-41
Identity = 86/168 (51.19%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W ++D++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILS-ADDKTVR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Human
Match: STRAP (serine/threonine kinase receptor associated protein [Source:HGNC Symbol;Acc:HGNC:30796])

HSP 1 Score: 138.272 bits (347), Expect = 1.242e-37
Identity = 86/181 (47.51%), Postives = 114/181 (62.98%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASK-------------DSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA K             D  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W ++D++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKGAGQHLPRLSGQHDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILS-ADDKTVR 180          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Human
Match: EIF3I (eukaryotic translation initiation factor 3 subunit I [Source:HGNC Symbol;Acc:HGNC:3272])

HSP 1 Score: 67.3958 bits (163), Expect = 1.971e-13
Identity = 34/115 (29.57%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK 536
            I   GH R +  + ++R  D     + + +KD +  + +   G+ +G++ GH GAVW      D     TG+AD + ++WDCE GK +  +  N  VR   F+   N ++ +T+K
Sbjct:    4 ILLQGHERSITQIKYNREGD----LLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDK 114          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Human
Match: EIF3I (eukaryotic translation initiation factor 3 subunit I [Source:HGNC Symbol;Acc:HGNC:3272])

HSP 1 Score: 68.1662 bits (165), Expect = 1.711e-12
Identity = 42/155 (27.10%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FG----IEIHDLKSPGK-----PIMNFNGHTDMIHRTMW 626
            I   GH R +  + ++R  D     + + +KD +  + +   G+ +G++ GH GAVW      D     TG+AD + ++WDCE GK +  +  N  VR   F+   N ++ +T+K  G    +   DL+ P +     P M    +   I   +W
Sbjct:    4 ILLQGHERSITQIKYNREGD----LLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVW 154          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Human
Match: NLE1 (notchless homolog 1 [Source:HGNC Symbol;Acc:HGNC:19889])

HSP 1 Score: 63.929 bits (154), Expect = 1.265e-11
Identity = 46/178 (25.84%), Postives = 86/178 (48.31%), Query Frame = 3
Query:  150 TMEKLNNKAL-RQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ++++L  +AL R N ++  G  R V        +DD T ++ S ++D  P+ R            GH+  +     S D+   A+ + D + K+WD   GK + S+  H   V  + ++  +  LV+ ++   +++ D+K+  K  M+  GH D ++   W  D Q++ S  KDK +R
Sbjct:   29 SLQELKERALSRYNLVRGQGPERLVSG------SDDFTLFLWSPAEDKKPLTRM----------TGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQ-KLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLR 189          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Celegans
Match: eif-3.I (Eukaryotic translation initiation factor 3 subunit I [Source:UniProtKB/Swiss-Prot;Acc:Q965S8])

HSP 1 Score: 73.1738 bits (178), Expect = 1.329e-14
Identity = 39/135 (28.89%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKF-----GIEIHDLKSPGKPI 581
            +   GH R +  + F+R  D       S +KD  P + +   G+ IGS+ GH GAVW   +S D +K  T + D T K+WD E G  + +I+H   ++   F+ + N +   T K        ++ DL+   + +
Sbjct:    4 LSLKGHERALTRVRFNREGD----LTFSCAKDKKPCVWYTENGERIGSYDGHNGAVWDIDVSWDTTKCVTASGDLTVKIWDAELGNCLYTINHQTPMKSCGFSYSGNLVCFTTQKMTKNLSTFQVRDLRDSSQMV 134          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Celegans
Match: qui-1 (QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:N1NTL8])

HSP 1 Score: 54.6842 bits (130), Expect = 3.887e-8
Identity = 47/157 (29.94%), Postives = 71/157 (45.22%), Query Frame = 3
Query:  246 NDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGK---------------AITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKT 671
            +DD+  Y+I+AS DS   +    TG+ + SF  H G+V S  L+++     TG+ DF  ++WD  NGK               AITS D   +V C D  ET     T     G E+H+L           GH   ++  +   DD ++ + +K K 
Sbjct:  963 SDDQ--YLITASADSSAKMIKLETGEVMRSFNDHTGSVVSLQLTSNNQFLITGSGDFVVQMWDVTNGKCISRMGGLMAPVSTLAITSNDAFVVVACED--ETLKVFSTVG---GQELHELM----------GHEGKVNSLVCAQDDCQLFAATKSKV 1102          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Celegans
Match: qui-1 (QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:N1NTL8])

HSP 1 Score: 54.6842 bits (130), Expect = 4.794e-8
Identity = 47/156 (30.13%), Postives = 71/156 (45.51%), Query Frame = 3
Query:  246 NDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGK---------------AITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDK 668
            +DD+  Y+I+AS DS   +    TG+ + SF  H G+V S  L+++     TG+ DF  ++WD  NGK               AITS D   +V C D  ET     T     G E+H+L           GH   ++  +   DD ++ + +K K
Sbjct:  698 SDDQ--YLITASADSSAKMIKLETGEVMRSFNDHTGSVVSLQLTSNNQFLITGSGDFVVQMWDVTNGKCISRMGGLMAPVSTLAITSNDAFVVVACED--ETLKVFSTVG---GQELHELM----------GHEGKVNSLVCAQDDCQLFAATKSK 836          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Celegans
Match: W07E6.2 (pep chromosome:WBcel235:II:480722:483104:-1 gene:WBGene00021074.1 transcript:W07E6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E6.2)

HSP 1 Score: 50.447 bits (119), Expect = 9.774e-8
Identity = 36/122 (29.51%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  165 NNKALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTA 527
            N K  +Q+  + +GH + V  + FS      T Y+ SAS D    L  G TG ++ S +GH G V+    S D+    +G+AD T KV++ +       +  H   V  VD++    ++V+ 
Sbjct:    3 NPKETKQSINRMTGHMQLVNQVVFS----PDTRYIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYDLPGHGDEVFTVDWSPEGTKVVSG 120          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Celegans
Match: smu-1 (Smu-1 suppressor of mec-8 and unc-52 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EEG7])

HSP 1 Score: 51.9878 bits (123), Expect = 2.214e-7
Identity = 34/111 (30.63%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  351 GAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHI--VRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
             AV   + S D+   ATG+ D   KVW  E G  +   D  H   V  V F++  + +++  N   + +H +KS GK +    GH+  I    + ++   IIS S D +IR
Sbjct:  265 AAVRCISFSRDSEMLATGSIDGKIKVWKVETGDCLRRFDRAHTKGVCAVRFSKDNSHILSGGNDHVVRVHGMKS-GKCLKEMRGHSSYITDVRYSDEGNHIISCSTDGSIR 374          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Fly
Match: wmd (gene:FBgn0034876 transcript:FBtr0113112)

HSP 1 Score: 165.622 bits (418), Expect = 8.224e-49
Identity = 81/167 (48.50%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  177 LRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            LRQ  + CSGHTRPVV L FS + D   Y++ISA KD  PMLR G TGDW+G+F+GHKGAVW+ TL+ +A+ AA+GAADFT KVW+   G  I S  H HIV+ V F+  +  +VT +N+  + + +L+ P      + GHT  I R ++   D+ IIS ++DKT+R
Sbjct:    6 LRQIPLTCSGHTRPVVHLDFSDICD-AGYFLISACKDGSPMLRHGDTGDWVGTFEGHKGAVWNATLNRNATLAASGAADFTGKVWNAVTGAEIHSFQHKHIVKSVAFDRDSENIVTGSNEKLVRVFNLEQPEAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVR 171          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Fly
Match: wmd (gene:FBgn0034876 transcript:FBtr0072114)

HSP 1 Score: 165.622 bits (418), Expect = 8.224e-49
Identity = 81/167 (48.50%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  177 LRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            LRQ  + CSGHTRPVV L FS + D   Y++ISA KD  PMLR G TGDW+G+F+GHKGAVW+ TL+ +A+ AA+GAADFT KVW+   G  I S  H HIV+ V F+  +  +VT +N+  + + +L+ P      + GHT  I R ++   D+ IIS ++DKT+R
Sbjct:    6 LRQIPLTCSGHTRPVVHLDFSDICD-AGYFLISACKDGSPMLRHGDTGDWVGTFEGHKGAVWNATLNRNATLAASGAADFTGKVWNAVTGAEIHSFQHKHIVKSVAFDRDSENIVTGSNEKLVRVFNLEQPEAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVR 171          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Fly
Match: CG10459 (gene:FBgn0033440 transcript:FBtr0088468)

HSP 1 Score: 107.457 bits (267), Expect = 8.576e-27
Identity = 59/165 (35.76%), Postives = 91/165 (55.15%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTAT--NKFGIEIHDLKSPGK-PIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            + C GH+  VV+L F+R + D  Y++ SA  D V  LR G TGD I   + H  +VWS +LS+DA   A+G AD   +VWD   GK +  + H   V CVD N  A +L+T     +  + + D++   K P+M F GH+  +   ++  ++   +S S D+T+R
Sbjct:    7 VLCPGHSDSVVELSFNR-DYDTGYFLASAGLDGVAALRHGDTGDCITHLRKHTDSVWSVSLSHDAKILASGGADCKVRVWDALLGKQLKKLRHTKTVACVDLNPKATRLLTGCIDQESPLALFDMEQSEKAPLMEFRGHSRGVRDVIFCLEEHCFLSSSYDRTVR 170          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Fly
Match: eIF3i (gene:FBgn0015834 transcript:FBtr0079053)

HSP 1 Score: 79.337 bits (194), Expect = 1.237e-16
Identity = 49/165 (29.70%), Postives = 79/165 (47.88%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK--------FGIEIHDLK---SPGKPIMNFNGHTDMIHRTMWLNDDQKIIS 653
            +   GH R +  + ++R  D     + S SKD  P + +   G+ +G++ GH+GAVW   +  ++ K  TGA D TAK+WD E G  I SI     VR  +F+ + NQ   +T+K        F I++ +     S  +P +        I   +W   D+ II+
Sbjct:    4 LMLQGHERSITQIKYNREGD----LLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWESRKLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFLIDVRNADSSLSEQEPTLRIPMTESKITSMLWGPLDETIIT 164          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 61.2326 bits (147), Expect = 2.280e-10
Identity = 42/160 (26.25%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  201 SGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +GHT+ V  + FS   +    ++ S+S D +  +   + G +  +  GHK  +     S+D+    +G+ D T KVW+   GK++ ++  H++ V C +FN  +N +V+ +    + I D+++ GK +     H+D +    +  D   I+S S D   R
Sbjct:   69 AGHTKAVSAVKFSPNGE----WLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRT-GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCR 223          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Zebrafish
Match: strap (serine/threonine kinase receptor associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1110])

HSP 1 Score: 158.688 bits (400), Expect = 5.939e-46
Identity = 88/168 (52.38%), Postives = 113/168 (67.26%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ +A+KAAT AADFTAKVWD   G  + ++ H HIV+ V+F + +N L+T  N   + I+DL  P        GHT  I + +W N+DQ+I+S + DKTIR
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNTEATKAATAAADFTAKVWDAVTGDEVLTLAHKHIVKSVNFTQDSNYLLTGGNDKVLRIYDLSKPEAEPQEIAGHTSAIKKALWCNNDQQILSAADDKTIR 168          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Zebrafish
Match: eif3i (eukaryotic translation initiation factor 3, subunit I [Source:NCBI gene;Acc:406263])

HSP 1 Score: 70.8626 bits (172), Expect = 1.445e-13
Identity = 38/131 (29.01%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FG----IEIHDLKSP 569
            I   GH R +  + ++R  D     + S +KD +  + +   G+ +G++ GH GAVW   +  D     TG+AD + ++WDCE GK +  ++ +  VR   F+ + N ++ +T+K  G    +  +DL+ P
Sbjct:    4 ILLQGHERSITQIKYNREGD----LLFSVAKDPIANVWYSVNGERLGTYNGHTGAVWCVDVDWDTKNVLTGSADNSCRLWDCETGKQLALLETSSAVRTCGFDFSGNIIMFSTDKQMGYQCFLNYYDLRDP 130          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 66.6254 bits (161), Expect = 5.799e-12
Identity = 50/178 (28.09%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  150 TMEKLNNKAL-RQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ++E++  KAL R NS++  GH R V        +DD T ++ + ++D  P+ R            GH+  V     S D    A+ + D + K+WD + GK + S+  H   V  V ++  +  LV+ ++   +++ D+K+ GK   +  GH D +    W  D Q++ S  KDK +R
Sbjct:  312 SLEEIKEKALKRYNSVRGEGHERLVSG------SDDFTMFLWNPAEDKKPVARL----------TGHQALVNEVLFSPDTRLIASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKT-GKLNADLPGHADEVFAVDWSPDGQRVASGGKDKCLR 472          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 66.6254 bits (161), Expect = 5.799e-12
Identity = 50/178 (28.09%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  150 TMEKLNNKAL-RQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ++E++  KAL R NS++  GH R V        +DD T ++ + ++D  P+ R            GH+  V     S D    A+ + D + K+WD + GK + S+  H   V  V ++  +  LV+ ++   +++ D+K+ GK   +  GH D +    W  D Q++ S  KDK +R
Sbjct:  312 SLEEIKEKALKRYNSVRGEGHERLVSG------SDDFTMFLWNPAEDKKPVARL----------TGHQALVNEVLFSPDTRLIASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKT-GKLNADLPGHADEVFAVDWSPDGQRVASGGKDKCLR 472          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 66.6254 bits (161), Expect = 5.799e-12
Identity = 50/178 (28.09%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  150 TMEKLNNKAL-RQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ++E++  KAL R NS++  GH R V        +DD T ++ + ++D  P+ R            GH+  V     S D    A+ + D + K+WD + GK + S+  H   V  V ++  +  LV+ ++   +++ D+K+ GK   +  GH D +    W  D Q++ S  KDK +R
Sbjct:  312 SLEEIKEKALKRYNSVRGEGHERLVSG------SDDFTMFLWNPAEDKKPVARL----------TGHQALVNEVLFSPDTRLIASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKT-GKLNADLPGHADEVFAVDWSPDGQRVASGGKDKCLR 472          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Xenopus
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:100145616])

HSP 1 Score: 152.14 bits (383), Expect = 4.797e-44
Identity = 86/167 (51.50%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  177 LRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +RQ  + CSGHTRPVVDL FS +     +++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD   G  + ++ H HIV+ VDF E +N L+T      + I+D+  P       +GHT  I + +W N+D +I+S S DKT+R
Sbjct:    1 MRQTPLTCSGHTRPVVDLAFSPVTP-YGFFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNRDATKAATAAADFTAKVWDAVTGDELITLAHKHIVKSVDFTEDSNNLLTGGQDKVLRIYDMNKPEAEPWEISGHTSAIKKALWYNNDNQILSASDDKTVR 166          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Xenopus
Match: eif3i (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:548498])

HSP 1 Score: 68.5514 bits (166), Expect = 1.308e-12
Identity = 44/164 (26.83%), Postives = 77/164 (46.95%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FG----IEIHDLKSP-----GKPIMNFNGHTDMIHRTMWLNDDQKIIS 653
            I   GH R +  + ++R  D     + + +KD V  + +   G+ +G++ GH GAVW   +  D     +G+AD + ++WDCE GK +  ++ N  VR   F+   N ++ +T+K  G    +   DL+ P      +P M        I   +W    + II+
Sbjct:    4 ILLQGHERSITQIKYNRDGD----LLFTVAKDPVVNVWYSVNGERLGTYSGHTGAVWCVDVDWDTRHVLSGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFIDLRDPTQIEDNEPYMKIPCSESKITSAVWGPLGENIIA 163          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Xenopus
Match: eif3i (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:548498])

HSP 1 Score: 68.5514 bits (166), Expect = 1.308e-12
Identity = 44/164 (26.83%), Postives = 77/164 (46.95%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FG----IEIHDLKSP-----GKPIMNFNGHTDMIHRTMWLNDDQKIIS 653
            I   GH R +  + ++R  D     + + +KD V  + +   G+ +G++ GH GAVW   +  D     +G+AD + ++WDCE GK +  ++ N  VR   F+   N ++ +T+K  G    +   DL+ P      +P M        I   +W    + II+
Sbjct:    4 ILLQGHERSITQIKYNRDGD----LLFTVAKDPVVNVWYSVNGERLGTYSGHTGAVWCVDVDWDTRHVLSGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFIDLRDPTQIEDNEPYMKIPCSESKITSAVWGPLGENIIA 163          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Xenopus
Match: ppp6c (protein phosphatase 6, catalytic subunit [Source:Xenbase;Acc:XB-GENE-1017127])

HSP 1 Score: 64.3142 bits (155), Expect = 4.469e-11
Identity = 36/110 (32.73%), Postives = 57/110 (51.82%), Query Frame = 3
Query:  354 AVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHI--VRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            AV     S D    ATGA D   KVW  ++G+ +   +  H   V C+ F++  +Q+++A+    I +H LKS GK +  F GH+  ++   +  D   IIS S D T++
Sbjct:  215 AVLCMCFSRDTEMLATGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCLSFSKDCSQILSASFDQTIRVHGLKS-GKTLKEFRGHSSFVNEATFTQDGHYIISASSDGTVK 323          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Xenopus
Match: ppp6c (protein phosphatase 6, catalytic subunit [Source:Xenbase;Acc:XB-GENE-1017127])

HSP 1 Score: 64.6994 bits (156), Expect = 4.477e-11
Identity = 36/110 (32.73%), Postives = 57/110 (51.82%), Query Frame = 3
Query:  354 AVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHI--VRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            AV     S D    ATGA D   KVW  ++G+ +   +  H   V C+ F++  +Q+++A+    I +H LKS GK +  F GH+  ++   +  D   IIS S D T++
Sbjct:  266 AVLCMCFSRDTEMLATGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCLSFSKDCSQILSASFDQTIRVHGLKS-GKTLKEFRGHSSFVNEATFTQDGHYIISASSDGTVK 374          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Mouse
Match: Strap (serine/threonine kinase receptor associated protein [Source:MGI Symbol;Acc:MGI:1329037])

HSP 1 Score: 149.058 bits (375), Expect = 4.416e-42
Identity = 87/168 (51.79%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W +DD++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSDDKQILS-ADDKTVR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Mouse
Match: Eif3i (eukaryotic translation initiation factor 3, subunit I [Source:MGI Symbol;Acc:MGI:1860763])

HSP 1 Score: 68.1662 bits (165), Expect = 1.163e-12
Identity = 42/155 (27.10%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FG----IEIHDLKSPGK-----PIMNFNGHTDMIHRTMW 626
            I   GH R +  + ++R  D     + + +KD +  + +   G+ +G++ GH GAVW      D     TG+AD + ++WDCE GK +  +  N  VR   F+   N ++ +T+K  G    +   DL+ P +     P M    +   I   +W
Sbjct:    4 ILLQGHERSITQIKYNREGD----LLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDSNEPYMKIPCNDSKITSAVW 154          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Mouse
Match: Smu1 (smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1915546])

HSP 1 Score: 65.4698 bits (158), Expect = 1.472e-11
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  354 AVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHI--VRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            AV     S D    ATGA D   KVW  ++G+ +   +  H   V C+ F++ ++Q+++A+    I IH LKS GK +  F GH+  ++   +  D   IIS S D T++
Sbjct:  266 AVLCMCFSRDTEMLATGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIRIHGLKS-GKTLKEFRGHSSFVNEATFTQDGHYIISASSDGTVK 374          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Mouse
Match: Apaf1 (apoptotic peptidase activating factor 1 [Source:MGI Symbol;Acc:MGI:1306796])

HSP 1 Score: 64.3142 bits (155), Expect = 6.179e-11
Identity = 53/179 (29.61%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  153 MEKLNNKALRQNS-IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTAT--NKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +E +N K ++  S +    HT  V    FS+        + S   D    +    TG+ +   K H+  V  C  S+D S  AT +AD   K+WD   GK + + D H+  V C  F   +N L+ AT  N F +++ DL         F GHT+ ++   +  DD+ + S S D T+R
Sbjct:  595 LEWINKKTIKNLSRLVVRPHTDAVYHACFSQ----DGQRIASCGADKTLQVFKAETGEKLLDIKAHEDEVLCCAFSSDDSYIATCSADKKVKIWDSATGKLVHTYDEHSEQVNCCHFTNKSNHLLLATGSNDFFLKLWDLNQKECRNTMF-GHTNSVNHCRFSPDDELLASCSADGTLR 768          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Mouse
Match: Apaf1 (apoptotic peptidase activating factor 1 [Source:MGI Symbol;Acc:MGI:1306796])

HSP 1 Score: 64.3142 bits (155), Expect = 6.179e-11
Identity = 53/179 (29.61%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  153 MEKLNNKALRQNS-IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTAT--NKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +E +N K ++  S +    HT  V    FS+        + S   D    +    TG+ +   K H+  V  C  S+D S  AT +AD   K+WD   GK + + D H+  V C  F   +N L+ AT  N F +++ DL         F GHT+ ++   +  DD+ + S S D T+R
Sbjct:  595 LEWINKKTIKNLSRLVVRPHTDAVYHACFSQ----DGQRIASCGADKTLQVFKAETGEKLLDIKAHEDEVLCCAFSSDDSYIATCSADKKVKIWDSATGKLVHTYDEHSEQVNCCHFTNKSNHLLLATGSNDFFLKLWDLNQKECRNTMF-GHTNSVNHCRFSPDDELLASCSADGTLR 768          
BLAST of Serine/threonine kinase receptor associated protein vs. UniProt/SwissProt
Match: sp|Q54LT8|STRAP_DICDI (Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum OX=44689 GN=strap PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.159e-41
Identity = 75/168 (44.64%), Postives = 109/168 (64.88%), Query Frame = 3
Query:  177 LRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMW-LNDDQKIISVSKDKTIR 677
            +RQ  I CSGH+RPV DL FS  N D ++ ++SA  D  PMLR G  GDWIG+F+GHKGAVWS   ++ AS+A T +AD+T K+WD  NG  I SI+H  IV+  DF+   +++VT  ++  + I DL+ P  P++  +GHT+ I    W +++D  ++S   D+ IR
Sbjct:    1 MRQPLI-CSGHSRPVSDLSFSNENSDGSF-IVSACLDGSPMLRNGENGDWIGTFEGHKGAVWSSRFNSTASQALTASADYTVKLWDTLNGSEILSIEHQSIVKTADFSNNNSRVVTGGSEKILRIFDLERPNDPLLQISGHTNTIKTATWSVHNDDIVLSGGLDEVIR 166          
BLAST of Serine/threonine kinase receptor associated protein vs. UniProt/SwissProt
Match: sp|Q9Z1Z2|STRAP_MOUSE (Serine-threonine kinase receptor-associated protein OS=Mus musculus OX=10090 GN=Strap PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 3.089e-41
Identity = 87/168 (51.79%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W +DD++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSDDKQILS-ADDKTVR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. UniProt/SwissProt
Match: sp|Q5XIG8|STRAP_RAT (Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Strap PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.084e-40
Identity = 86/168 (51.19%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W ++D++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILS-ADDKTVR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. UniProt/SwissProt
Match: sp|Q5E959|STRAP_BOVIN (Serine-threonine kinase receptor-associated protein OS=Bos taurus OX=9913 GN=STRAP PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.192e-40
Identity = 86/168 (51.19%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W ++D++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILS-ADDKTVR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. UniProt/SwissProt
Match: sp|Q9Y3F4|STRAP_HUMAN (Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.411e-40
Identity = 86/168 (51.19%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + ++ H HIV+ VDF + +N L+T      + I+DL  P       +GHT  I + +W ++D++I+S + DKT+R
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILS-ADDKTVR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. TrEMBL
Match: T1FM24 (WD_REPEATS_REGION domain-containing protein OS=Helobdella robusta OX=6412 GN=20209873 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.203e-56
Identity = 94/168 (55.95%), Postives = 124/168 (73.81%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ++RQN + CSGHTRPVV L FSR+  D  Y+VISASKD+ PMLR G TGDWIG+F+GHKGAVW+ TL+ +ASKAATG+ADFTAKVW+   G+ + S  H HIV+CVDF+  +N L+T +N+  + I+DL  P +     NGHT  +   +WL DD+ IIS ++DKTI+
Sbjct:    3 SMRQNPLTCSGHTRPVVHLSFSRITPDG-YFVISASKDAKPMLRQGETGDWIGTFEGHKGAVWAATLNYEASKAATGSADFTAKVWNAVTGEEVQSFAHKHIVKCVDFSPDSNYLLTGSNEKLLRIYDLNKPSESPEVINGHTSNLKCCLWL-DDRTIISAAEDKTIK 168          
BLAST of Serine/threonine kinase receptor associated protein vs. TrEMBL
Match: T1K495 (WD_REPEATS_REGION domain-containing protein OS=Tetranychus urticae OX=32264 GN=107360417 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.671e-54
Identity = 93/168 (55.36%), Postives = 120/168 (71.43%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            AL+Q+++ C+GHTRPVV L+FS + D K YY+ISA KD  PMLR G TGDWIG+F+GHKGAVW   L+ DASKAATGAADF+AK+WD  NG  + S+ H HIV+ V F+  ++QLVT +N+  + I DL       +  NGHT  I   ++LNDD+ +IS S DKTIR
Sbjct:    2 ALKQHNLTCTGHTRPVVFLNFSGITDGK-YYLISACKDGKPMLRQGETGDWIGTFEGHKGAVWGAALNVDASKAATGAADFSAKLWDAINGSELASLPHRHIVKSVSFSTDSSQLVTGSNEKLMRIFDLNRLDAEPLKINGHTSSIRHALFLNDDRWLISASDDKTIR 168          
BLAST of Serine/threonine kinase receptor associated protein vs. TrEMBL
Match: T1K499 (WD_REPEATS_REGION domain-containing protein OS=Tetranychus urticae OX=32264 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.612e-53
Identity = 93/168 (55.36%), Postives = 120/168 (71.43%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            AL+Q+++ C+GHTRPVV L+FS + D K YY+ISA KD  PMLR G TGDWIG+F+GHKGAVW   L+ DASKAATGAADF+AK+WD  NG  + S+ H HIV+ V F+  ++QLVT +N+  + I DL       +  NGHT  I   ++LNDD+ +IS S DKTIR
Sbjct:    2 ALKQHNLTCTGHTRPVVFLNFSGITDGK-YYLISACKDGKPMLRQGETGDWIGTFEGHKGAVWGAALNVDASKAATGAADFSAKLWDAINGSELASLPHRHIVKSVSFSTDSSQLVTGSNEKLMRIFDLNRLDAEPLKINGHTSSIRHALFLNDDRWLISASDDKTIR 168          
BLAST of Serine/threonine kinase receptor associated protein vs. TrEMBL
Match: A0A023FLZ8 (Putative serine/threonine kinase receptor-associated protein (Fragment) OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.992e-53
Identity = 92/170 (54.12%), Postives = 117/170 (68.82%), Query Frame = 3
Query:  171 KALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDL-KSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            + LRQ  + CSGHTRPVVDL FS+L+   TYY+ISA KD  PMLR G TGDWIG+F GHKGAVW   L+ DAS AATGAADFTAK+W+   G+ + +  H HIVRCVDF+    +L+T +N   + I D+ K    P M   GHT  I + ++L DD++I+S S DKT+R
Sbjct:    1 RRLRQTPLTCSGHTRPVVDLCFSKLSSTGTYYLISACKDGKPMLRQGDTGDWIGTFVGHKGAVWGVALNKDASVAATGAADFTAKLWNAVAGEELHTFAHPHIVRCVDFDSEGVRLLTGSNDKTLRIFDVNKEDAAPTM-MKGHTSAIKKVLFLQDDKRIVSASDDKTVR 169          
BLAST of Serine/threonine kinase receptor associated protein vs. TrEMBL
Match: A0A0C9S2N0 (Putative serine/threonine kinase receptor-associated protein OS=Amblyomma americanum OX=6943 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.745e-53
Identity = 91/169 (53.85%), Postives = 116/169 (68.64%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDL-KSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
             LRQ  + CSGHTRPVVDL FS+L+   TYY+ISA KD  PMLR G TGDWIG+F GHKGAVW   L+ DAS AATGAADFTAK+W+   G+ + +  H HIVRCVDF+    +L+T +N   + I D+ K    P M   GHT  I + ++L DD++I+S S DK++R
Sbjct:    3 GLRQTPLTCSGHTRPVVDLCFSKLSSTGTYYLISACKDGKPMLRQGDTGDWIGTFVGHKGAVWGVALNKDASVAATGAADFTAKLWNAVAGEELHTFSHPHIVRCVDFDSEGVRLLTGSNDKTLRIFDVNKEDAAPTM-LKGHTSAIKKVLFLQDDKRIVSASDDKSVR 170          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Cavefish
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:111193019])

HSP 1 Score: 166.392 bits (420), Expect = 5.508e-49
Identity = 85/168 (50.60%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ +A+KAAT AADF+AKVWD   G  + ++ H HIV+ V+F + +N L+T  N   + I+DL  P       +GHT  + + +W N+DQ+I+S + D+TIR
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-YGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKEATKAATAAADFSAKVWDAVTGDEVLTLAHKHIVKSVNFTQDSNCLLTGGNDKLLRIYDLSKPEAEPQEISGHTSAVKKALWCNNDQQILSAADDRTIR 168          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Cavefish
Match: eif3i (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:103045556])

HSP 1 Score: 71.633 bits (174), Expect = 6.229e-14
Identity = 39/131 (29.77%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FGIEIH----DLKSP 569
            I   GH R +  + ++R  D     + S +KD    + +   G+ +G++ GH GAVW   +  D     TG+AD + ++WDCE GK +  ++ N  VR   F+ + N ++ +T+K  G + +    DL+ P
Sbjct:    4 ILLQGHERSLTQIKYNREGD----LLFSVAKDQFANVWYSVNGERLGTYNGHSGAVWCVDVDWDTKNVLTGSADNSCRLWDCETGKQLAMLETNSAVRTCGFDFSGNIIMFSTDKQMGYQCYLNYFDLRDP 130          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Cavefish
Match: smu1a (SMU1 DNA replication regulator and spliceosomal factor a [Source:NCBI gene;Acc:393168])

HSP 1 Score: 66.2402 bits (160), Expect = 6.348e-12
Identity = 38/110 (34.55%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  354 AVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHI--VRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            AV     S D    ATGA D   KVW  ++G+ +   +  H   V CV F++ ++QL++A+    I +H LKS GK +  F GH+  ++   +  D   IIS S D T++
Sbjct:  215 AVLCMCFSRDTEMLATGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCVSFSKDSSQLLSASFDQTIRVHGLKS-GKSLKEFRGHSSFVNEATFTPDGHHIISASSDGTVK 323          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Cavefish
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:103032740])

HSP 1 Score: 62.3882 bits (150), Expect = 1.025e-10
Identity = 46/166 (27.71%), Postives = 82/166 (49.40%), Query Frame = 3
Query:  183 QNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASK-AATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +N     GH+  V++LH+   N D +  + SAS D    +    TG+ +   KGH   V SC  +    + A TG+ D T K+WD     ++ +  + + V  V FN+T++Q+++      I++ DL+   K I +  GH D +      ++   ++S S D ++R
Sbjct:   90 ENFATLKGHSGAVMELHY---NTDGSL-LYSASTDKTVCVWDSETGERVKRLKGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKASVHTFQNTYQVLSVTFNDTSDQIISGGIDNDIKVWDLRQ-NKLIYSMQGHGDSVTGLSLSSEGSYLLSNSMDNSVR 250          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 62.003 bits (149), Expect = 1.213e-10
Identity = 42/160 (26.25%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  201 SGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +GHT+ V  + FS   +    ++ S+S D +  +   + G +  +  GHK  +     S+D++   + + D T K+WD  +GK + ++  H++ V C +FN  +N +V+ +    + I D+K+ GK +     H+D +    +  D   I+S S D   R
Sbjct:   42 AGHTKAVSSVKFSPSGE----WLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT-GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCR 196          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Sea Lamprey
Match: strap (serine/threonine kinase receptor associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1110])

HSP 1 Score: 143.665 bits (361), Expect = 5.862e-41
Identity = 88/168 (52.38%), Postives = 109/168 (64.88%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ALRQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDW+G+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + S  H HIV+ VDF E +  L+T      + I+DL+         +GHT  + R  W   ++ IISV+ DKTIR
Sbjct:    2 ALRQTPLTCSGHTRPVVDLAFSTITP-YGYFMISACKDGKPMLRQGDTGDWVGTFLGHKGAVWGATLNRDATKAATAAADFTAKVWDAVSGDEVVSFTHKHIVKTVDFTEDSVHLLTGGQDKVLRIYDLEKTDAEPQLLSGHTSGVRRA-WCTGEKLIISVADDKTIR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 59.3066 bits (142), Expect = 1.901e-10
Identity = 43/160 (26.88%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  201 SGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            SGH  PV  + F  +       ++SAS+D+   +    TGD+  + KGH  +V   +        A+ +AD T K+WD ++ + + ++  H+H V  V F    + LV+A+    +++ ++++ G  +  F GH + +       D   I S S D+T+R
Sbjct:   44 SGHRSPVTRVIFHPVFS----VIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQT-GYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVR 198          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 56.9954 bits (136), Expect = 1.210e-9
Identity = 44/165 (26.67%), Postives = 76/165 (46.06%), Query Frame = 3
Query:  186 NSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASK-AATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            N     GHT  ++D+H+S   D  T  + ++S D    L    TG+ I   KGH   V +C  +    +   T + D T K+WD     ++ S  + +    V FN+T++Q+++      I++ DL+   K I    GH D +       D   ++S + D ++R
Sbjct:   92 NYAHLKGHTGAILDIHYS--TDGST--IFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQ-NKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVR 251          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.033e-7
Identity = 41/179 (22.91%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  153 MEKLNNKALRQNSIQCS----GHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTI 674
            ++K  + A+R  S++ S     H  PV  +        +   +++AS D +  +     GD I + +GH   +  C  +   +  ATG  D T KVWD   G  + +++ H H V    ++   + + +++     ++ D+ S  +      GHTD ++   +L     +++ S DKT+
Sbjct:  312 VQKQPSDAMRSGSLRISQTLKAHEMPVSSMALH----PRKEIIVTASDDQLWKMWSIPNGDIIMTGQGHTDWIGDCDFNPTGTNLATGGGDSTVKVWDFSQGACVLTLEGHGHAVWGCSWHSCGDFIASSSMDNSSKVWDVNSE-RCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTL 485          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 4.026e-7
Identity = 33/138 (23.91%), Postives = 69/138 (50.00%), Query Frame = 3
Query:  267 VISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAI-TSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            ++S S D+   +    TG  + +  GH G VWS  +  +     +G+ D T KVW+ + G+ + T   H   VRC+  +   N++V+ +    + + D+++ G+ +    GH   +    +  D ++++S + D T++
Sbjct:  247 IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRGNI--IVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLH--GNRVVSGSRDATLRVWDIET-GQCLHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVK 377          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Yeast
Match: TIF34 (eIF3i subunit of the eukaryotic translation initiation factor 3 (eIF3); subunit of the core complex of eIF3; essential for translation; stimulates rate of ribosomal scanning during translation reinitiation; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000004754])

HSP 1 Score: 63.929 bits (154), Expect = 4.360e-12
Identity = 34/128 (26.56%), Postives = 64/128 (50.00%), Query Frame = 3
Query:  189 SIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPG 572
            +I+ +GH RP+  + +++  D     + S SKDS   + +   G+ +G+  GH G +WS  +        TG+AD++ K+WD  NG+ + +      V+ V+F+   N  +   +        +K+PG
Sbjct:    3 AIKLTGHERPLTQVKYNKEGD----LLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNV------MKNPG 120          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 51.2174 bits (121), Expect = 5.802e-8
Identity = 40/150 (26.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query:  267 VISASKDSVPMLRFGHTGD------WIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITS-IDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWL------NDDQKIISVSKDKTIR 677
            ++SAS+D   ++ +  TGD       + SFKGH   V  CTL+ D + A + + D T ++WD   G+     + H   V  VD ++ A+ +++ +    I++  +K  G+ +    GH D + +   +      +D   IIS   DK ++
Sbjct:   33 LLSASRDKT-LISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 45.0542 bits (105), Expect = 8.951e-6
Identity = 35/145 (24.14%), Postives = 67/145 (46.21%), Query Frame = 3
Query:  246 NDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +DD T ++ +  K + P+ R            GH+  V     S D     + + D + K+WD  +GK I++   H   V  V ++     LV+ +    +++ D+++  K  ++  GH D ++   W  D +++ S  KDK +R
Sbjct:  378 SDDYTMFLWNPLKSTKPIARM----------TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRT-RKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVR 511          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Nematostella
Match: EDO27706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8I0])

HSP 1 Score: 82.4185 bits (202), Expect = 2.901e-19
Identity = 53/166 (31.93%), Postives = 77/166 (46.39%), Query Frame = 3
Query:  180 RQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            RQ  + CSGHTRPVVDLHFS +     Y++ISA K    +           S   H   ++    +            F  KVWD  +G  + S+ H HIV+ VDF+    +L+T +N+  + I DL++         GHT  I   +W  ++  + S   DK IR
Sbjct:    3 RQIPLSCSGHTRPVVDLHFSDITP-HGYFLISACKGEKRLEFHLKELSIFSSVHIHSRLLFVLLKNTKWWLQLFEGFFFFRKVWDALSGDEVASLPHKHIVKTVDFSSDGIRLLTGSNEKILRIFDLQNLDSEPQVLTGHTGSIKTALWNKENNMVYSGGDDKMIR 167          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Nematostella
Match: EDO47524 (Eukaryotic translation initiation factor 3 subunit I [Source:UniProtKB/Swiss-Prot;Acc:A7RM20])

HSP 1 Score: 75.0998 bits (183), Expect = 1.317e-15
Identity = 33/111 (29.73%), Postives = 64/111 (57.66%), Query Frame = 3
Query:  204 GHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK 536
            GH R +  + ++R+ D     + SA+KD+ P + +   G+ +G++ GH GAVW   ++ D ++  +G AD   ++WDCE G  ++ I+    VR   F+   N+++ +T++
Sbjct:    8 GHERNITQIKYNRMGD----LLFSAAKDTRPTVWYSLNGERLGTYNGHGGAVWCIDVNYDTTQFISGGADNCLRLWDCEKGVTLSKIETKSAVRTCGFSYGGNEIMLSTDR 114          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Nematostella
Match: EDO47633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM8])

HSP 1 Score: 68.9366 bits (167), Expect = 5.255e-13
Identity = 37/114 (32.46%), Postives = 64/114 (56.14%), Query Frame = 3
Query:  339 KGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID-HNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            K H GAV+ C  S+D+SK  +   D   KVWD ++G+ + SI  H  +V C  F+   +++++ +    ++I D  S G+ ++ F GHT  +    +  DD K +S S D+T++
Sbjct:  604 KVHCGAVYCCKFSSDSSKVVSCGTDNHVKVWDSQSGRQLLSISGHGDVVNCCAFSHDDSRIISCSADQTVKIWD-ASSGEGVLCFVGHTQEVFSCSFSPDDTKAVSCSADRTVK 716          

HSP 2 Score: 56.225 bits (134), Expect = 6.812e-9
Identity = 35/131 (26.72%), Postives = 65/131 (49.62%), Query Frame = 3
Query:  267 VISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAI-TSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISV 656
            +IS S D    +    +G+ +  F GH   V+SC+ S D +KA + +AD T KVWD + G      + H  IVR   F+    ++ + ++   + I +  S G+ +   + HT  +    ++N  + +++V
Sbjct:  664 IISCSADQTVKIWDASSGEGVLCFVGHTQEVFSCSFSPDDTKAVSCSADRTVKVWDSKTGVCYHVYMAHTDIVRWCCFSPDGGKVASCSDDNTVRIWE-ASSGEDLCLLDDHTSSVSFCCFMNQGESVVTV 793          

HSP 3 Score: 49.2914 bits (116), Expect = 1.067e-6
Identity = 33/123 (26.83%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  312 HTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITS-IDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
             +G  + S  GH   V  C  S+D S+  + +AD T K+WD  +G+ +   + H   V    F+    + V+ +    +++ D K+ G     +  HTD++    +  D  K+ S S D T+R
Sbjct:  637 QSGRQLLSISGHGDVVNCCAFSHDDSRIISCSADQTVKIWDASSGEGVLCFVGHTQEVFSCSFSPDDTKAVSCSADRTVKVWDSKT-GVCYHVYMAHTDIVRWCCFSPDGGKVASCSDDNTVR 758          

HSP 4 Score: 46.9802 bits (110), Expect = 6.044e-6
Identity = 32/115 (27.83%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  327 IGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSID--HNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKD 665
            + SF  HKGAV  C  S D     + + D TAKV++ +  + + ++    N + RC+ FN    +++TA+    +++ D K+        +  TD +      +D Q++IS S D
Sbjct:  973 LQSFSEHKGAVRRCYFSQDGQLLLSASDDKTAKVFNLQEARVMYTLAGHTNKLRRCMFFNND-TRILTASLDGSLKVWDAKTGNLEFTCCHSSTDYVLTCDVSHDSQRLISASAD 1086          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Nematostella
Match: EDO41499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4D0])

HSP 1 Score: 66.2402 bits (160), Expect = 3.006e-12
Identity = 38/109 (34.86%), Postives = 56/109 (51.38%), Query Frame = 3
Query:  357 VWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHI--VRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            V   T S D+   A+G  D   KVW  + G+ +   +  H   V CV F+  A+QL++ +    I +H LKS GK +  F GHT  ++  ++  D   IIS S D TI+
Sbjct:  267 VLCLTFSRDSEMLASGGQDGKIKVWKLQTGQCLRRFERAHSKGVTCVTFSRDASQLLSGSFDMTIRMHGLKS-GKTLKEFRGHTSFVNDVIFTADAHHIISASSDGTIK 374          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 61.6178 bits (148), Expect = 7.551e-11
Identity = 43/160 (26.88%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  201 SGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSI-DHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +GH  P+  + F  +       ++++S+D+   +    TGD+  + KGH  AV      +     A+ +AD T K+WD +  + I ++  H+H V  + F  + + LV+A+    I++ ++ + G  +  F GH + + R     D   I S S D+TIR
Sbjct:  103 TGHRSPITKVLFHPVYS----VMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQGFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIAT-GYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIR 257          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Medaka
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:101165272])

HSP 1 Score: 150.984 bits (380), Expect = 4.375e-43
Identity = 89/168 (52.98%), Postives = 113/168 (67.26%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + S+ H HIV+ V+F + +N L+TA N   + I DL +         GH   I + +W NDD++I+S + DKTIR
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-FGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNMDATKAATAAADFTAKVWDSVSGDEVLSLAHKHIVKSVNFTQDSNHLLTAGNDKLLRIFDLSNTDAAPQEIAGHGAAIKKALWCNDDKQILSAADDKTIR 168          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Medaka
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:101165272])

HSP 1 Score: 150.214 bits (378), Expect = 6.059e-43
Identity = 89/168 (52.98%), Postives = 113/168 (67.26%), Query Frame = 3
Query:  174 ALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            A+RQ  + CSGHTRPVVDL FS +     Y++ISA KD  PMLR G TGDWIG+F GHKGAVW  TL+ DA+KAAT AADFTAKVWD  +G  + S+ H HIV+ V+F + +N L+TA N   + I DL +         GH   I + +W NDD++I+S + DKTIR
Sbjct:    2 AMRQTPLTCSGHTRPVVDLAFSGITP-FGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNMDATKAATAAADFTAKVWDSVSGDEVLSLAHKHIVKSVNFTQDSNHLLTAGNDKLLRIFDLSNTDAAPQEIAGHGAAIKKALWCNDDKQILSAADDKTIR 168          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Medaka
Match: EIF3I (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:101173320])

HSP 1 Score: 69.707 bits (169), Expect = 3.087e-13
Identity = 42/155 (27.10%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  192 IQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNK-FGIEIH----DLKSPGK-----PIMNFNGHTDMIHRTMW 626
            I   GH R +  + ++R  D     + S +KD+V    +   G+ +G++ GH GAVW      D     TG+AD + ++WDCE GK +  ++ +  VR   F+ + N ++ +T+K  G + +    DL+ P +     P ++   +   I   +W
Sbjct:    4 ILLQGHERSITQIKYNREGD----LLFSVAKDTVANAWYSVNGERLGTYNGHTGAVWCVDCDWDTKNVLTGSADNSCRLWDCETGKQLALLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQCYLNFFDLRDPQQIEDNNPYLSVPCNESKITSAVW 154          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 66.2402 bits (160), Expect = 4.558e-12
Identity = 49/166 (29.52%), Postives = 83/166 (50.00%), Query Frame = 3
Query:  183 QNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASK-AATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +N     GH+  V++LH+   N D +  + SAS D    +    TG+ I   KGH   V +C  +    +   TG+ D T K+WD     AI +  + + V  V FN+T++Q+++      I++ DL+   K I N +GH+D +      ++   ++S S D T+R
Sbjct:   90 ENYATLKGHSGAVMELHY---NTDGSL-LFSASTDKTVGIWDSETGERIKRLKGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRKKAAIHTFQNTYQVLAVTFNDTSDQILSGGIDNDIKVWDLRQ-NKLIYNMHGHSDSVTGLSLSSEGSYLLSNSMDNTVR 250          
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 66.2402 bits (160), Expect = 5.355e-12
Identity = 49/166 (29.52%), Postives = 83/166 (50.00%), Query Frame = 3
Query:  183 QNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASK-AATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            +N     GH+  V++LH+   N D +  + SAS D    +    TG+ I   KGH   V +C  +    +   TG+ D T K+WD     AI +  + + V  V FN+T++Q+++      I++ DL+   K I N +GH+D +      ++   ++S S D T+R
Sbjct:  116 ENYATLKGHSGAVMELHY---NTDGSL-LFSASTDKTVGIWDSETGERIKRLKGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRKKAAIHTFQNTYQVLAVTFNDTSDQILSGGIDNDIKVWDLRQ-NKLIYNMHGHSDSVTGLSLSSEGSYLLSNSMDNTVR 276          
BLAST of Serine/threonine kinase receptor associated protein vs. Planmine SMEST
Match: SMESG000035983.1 (SMESG000035983.1)

HSP 1 Score: 367.466 bits (942), Expect = 1.448e-128
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = 3
Query:  153 MEKLNNKALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 677
            MEKLNNKALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR
Sbjct:    1 MEKLNNKALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHTDMIHRTMWLNDDQKIISVSKDKTIR 175          
BLAST of Serine/threonine kinase receptor associated protein vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 65.855 bits (159), Expect = 4.847e-12
Identity = 35/125 (28.00%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  159 KLNNKALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATN 533
            K   K  ++  +   GH RP+  + ++R  D     + + +K+  P + +   G+ +G++ GHKGAVW   +  +     TGAAD +  +WD E G  + SI     VR   F  + N ++  T+
Sbjct:   10 KFKLKISKKRPLILQGHERPITQVKYNREGD----LLFTIAKEKEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSIRTLTSVRSCQFGYSGNTILMTTD 130          
BLAST of Serine/threonine kinase receptor associated protein vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.304e-11
Identity = 34/117 (29.06%), Postives = 58/117 (49.57%), Query Frame = 3
Query:  183 QNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATN 533
            Q  +   GH RP+  + ++R  D     + + +K+  P + +   G+ +G++ GHKGAVW   +  +     TGAAD +  +WD E G  + SI     VR   F  + N ++  T+
Sbjct:  264 QRPLILQGHERPITQVKYNREGD----LLFTIAKEKEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSIRTLTSVRSCQFGYSGNTILMTTD 376          
BLAST of Serine/threonine kinase receptor associated protein vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.023e-11
Identity = 33/111 (29.73%), Postives = 56/111 (50.45%), Query Frame = 3
Query:  201 SGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATN 533
             GH RP+  + ++R  D     + + +K+  P + +   G+ +G++ GHKGAVW   +  +     TGAAD +  +WD E G  + SI     VR   F  + N ++  T+
Sbjct:    7 QGHERPITQVKYNREGD----LLFTIAKEKEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSIRTLTSVRSCQFGYSGNTILMTTD 113          
BLAST of Serine/threonine kinase receptor associated protein vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.344e-11
Identity = 33/111 (29.73%), Postives = 56/111 (50.45%), Query Frame = 3
Query:  201 SGHTRPVVDLHFSRLNDDKTYYVISASKDSVPMLRFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKAITSIDHNHIVRCVDFNETANQLVTATN 533
             GH RP+  + ++R  D     + + +K+  P + +   G+ +G++ GHKGAVW   +  +     TGAAD +  +WD E G  + SI     VR   F  + N ++  T+
Sbjct:   18 QGHERPITQVKYNREGD----LLFTIAKEKEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSIRTLTSVRSCQFGYSGNTILMTTD 124          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STRAP2.939e-4151.19serine/threonine kinase receptor associated protei... [more]
STRAP1.242e-3747.51serine/threonine kinase receptor associated protei... [more]
EIF3I1.971e-1329.57eukaryotic translation initiation factor 3 subunit... [more]
EIF3I1.711e-1227.10eukaryotic translation initiation factor 3 subunit... [more]
NLE11.265e-1125.84notchless homolog 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif-3.I1.329e-1428.89Eukaryotic translation initiation factor 3 subunit... [more]
qui-13.887e-829.94QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:... [more]
qui-14.794e-830.13QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:... [more]
W07E6.29.774e-829.51pep chromosome:WBcel235:II:480722:483104:-1 gene:W... [more]
smu-12.214e-730.63Smu-1 suppressor of mec-8 and unc-52 protein [Sou... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wmd8.224e-4948.50gene:FBgn0034876 transcript:FBtr0113112[more]
wmd8.224e-4948.50gene:FBgn0034876 transcript:FBtr0072114[more]
CG104598.576e-2735.76gene:FBgn0033440 transcript:FBtr0088468[more]
eIF3i1.237e-1629.70gene:FBgn0015834 transcript:FBtr0079053[more]
wds2.280e-1026.25gene:FBgn0040066 transcript:FBtr0308566[more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strap5.939e-4652.38serine/threonine kinase receptor associated protei... [more]
eif3i1.445e-1329.01eukaryotic translation initiation factor 3, subuni... [more]
nle15.799e-1228.09notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
nle15.799e-1228.09notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
nle15.799e-1228.09notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strap4.797e-4451.50serine/threonine kinase receptor associated protei... [more]
eif3i1.308e-1226.83eukaryotic translation initiation factor 3 subunit... [more]
eif3i1.308e-1226.83eukaryotic translation initiation factor 3 subunit... [more]
ppp6c4.469e-1132.73protein phosphatase 6, catalytic subunit [Source:X... [more]
ppp6c4.477e-1132.73protein phosphatase 6, catalytic subunit [Source:X... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Strap4.416e-4251.79serine/threonine kinase receptor associated protei... [more]
Eif3i1.163e-1227.10eukaryotic translation initiation factor 3, subuni... [more]
Smu11.472e-1133.64smu-1 suppressor of mec-8 and unc-52 homolog (C. e... [more]
Apaf16.179e-1129.61apoptotic peptidase activating factor 1 [Source:MG... [more]
Apaf16.179e-1129.61apoptotic peptidase activating factor 1 [Source:MG... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54LT8|STRAP_DICDI1.159e-4144.64Serine-threonine kinase receptor-associated protei... [more]
sp|Q9Z1Z2|STRAP_MOUSE3.089e-4151.79Serine-threonine kinase receptor-associated protei... [more]
sp|Q5XIG8|STRAP_RAT1.084e-4051.19Serine-threonine kinase receptor-associated protei... [more]
sp|Q5E959|STRAP_BOVIN1.192e-4051.19Serine-threonine kinase receptor-associated protei... [more]
sp|Q9Y3F4|STRAP_HUMAN1.411e-4051.19Serine-threonine kinase receptor-associated protei... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FM243.203e-5655.95WD_REPEATS_REGION domain-containing protein OS=Hel... [more]
T1K4954.671e-5455.36WD_REPEATS_REGION domain-containing protein OS=Tet... [more]
T1K4991.612e-5355.36WD_REPEATS_REGION domain-containing protein OS=Tet... [more]
A0A023FLZ81.992e-5354.12Putative serine/threonine kinase receptor-associat... [more]
A0A0C9S2N03.745e-5353.85Putative serine/threonine kinase receptor-associat... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strap5.508e-4950.60serine/threonine kinase receptor associated protei... [more]
eif3i6.229e-1429.77eukaryotic translation initiation factor 3 subunit... [more]
smu1a6.348e-1234.55SMU1 DNA replication regulator and spliceosomal fa... [more]
snrnp401.025e-1027.71small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
wdr51.213e-1026.25WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strap5.862e-4152.38serine/threonine kinase receptor associated protei... [more]
pafah1b1b1.901e-1026.88platelet-activating factor acetylhydrolase 1b, reg... [more]
snrnp401.210e-926.67small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
ENSPMAT00000004902.12.033e-722.91pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
ENSPMAT00000008862.14.026e-723.91pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TIF344.360e-1226.56eIF3i subunit of the eukaryotic translation initia... [more]
ASC15.802e-826.67G-protein beta subunit and guanine dissociation in... [more]
RSA48.951e-624.14WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO277062.901e-1931.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475241.317e-1529.73Eukaryotic translation initiation factor 3 subunit... [more]
EDO476335.255e-1332.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414993.006e-1234.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418967.551e-1126.88Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
strap4.375e-4352.98serine/threonine kinase receptor associated protei... [more]
strap6.059e-4352.98serine/threonine kinase receptor associated protei... [more]
EIF3I3.087e-1327.10eukaryotic translation initiation factor 3 subunit... [more]
snrnp404.558e-1229.52small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
snrnp405.355e-1229.52small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of Serine/threonine kinase receptor associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035983.11.448e-128100.00SMESG000035983.1[more]
SMESG000034899.14.847e-1228.00SMESG000034899.1[more]
SMESG000034899.11.304e-1129.06SMESG000034899.1[more]
SMESG000034899.12.023e-1129.73SMESG000034899.1[more]
SMESG000034899.12.344e-1129.73SMESG000034899.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027898 ID=SMED30027898|Name=Serine/threonine kinase receptor associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=889bp
ATTTAATGTGTTTATTTTCTAAAATGAATAAAAACTCATTTTTCAACATT
CAATCTTTTTAGTTCTTCTTGACTATTGTTTTAACATTTTATTATTCGTT
TATTGAGTTTAATATGATAATTATGTTTTTAATATTTTAGCAAATTTACA
CAATGGAAAAGCTAAATAATAAAGCACTCAGACAAAACTCTATTCAATGC
TCGGGTCATACGAGACCAGTTGTTGATTTACATTTTAGTCGTTTAAATGA
TGATAAAACATATTATGTAATATCTGCTAGCAAAGACAGTGTTCCAATGC
TACGGTTCGGTCACACTGGTGATTGGATAGGCAGCTTTAAAGGACATAAA
GGAGCTGTTTGGTCATGCACTTTATCGAACGATGCTTCAAAAGCTGCAAC
TGGTGCTGCTGATTTCACAGCTAAAGTTTGGGATTGTGAAAATGGTAAAG
CTATTACTTCAATCGATCACAACCACATTGTACGATGTGTTGATTTTAAT
GAAACTGCTAATCAGTTAGTGACTGCTACCAACAAATTTGGAATTGAAAT
TCACGATTTAAAATCACCTGGAAAACCTATAATGAATTTCAACGGCCATA
CCGACATGATCCATCGAACGATGTGGCTCAATGATGATCAGAAAATAATA
TCGGTATCCAAAGATAAAACAATAAGGTCATCATAATTCCTAATTTTGAG
TTTATTTTAATTGTAAAAATGTTAAATAATATTCAACGTATCAGCTGATT
ATTTAATTGTACTTTTTGAGTTACCCACTTTAATTTGATTAAATCTAGTT
TTATATTTACAAAGAATTAGAGTTGCTTAATAAATTGAAAAATGGACTAT
TAAAATTCTTAAAAAAATTACTATTTTGATAATTTACAC
back to top

protein sequence of SMED30027898-orf-1

>SMED30027898-orf-1 ID=SMED30027898-orf-1|Name=SMED30027898-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MEKLNNKALRQNSIQCSGHTRPVVDLHFSRLNDDKTYYVISASKDSVPML
RFGHTGDWIGSFKGHKGAVWSCTLSNDASKAATGAADFTAKVWDCENGKA
ITSIDHNHIVRCVDFNETANQLVTATNKFGIEIHDLKSPGKPIMNFNGHT
DMIHRTMWLNDDQKIISVSKDKTIRSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR011528NERD
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 55..94
e-value: 2.9E-6
score: 36.8
coord: 9..54
e-value: 230.0
score: 2.1
coord: 97..135
e-value: 0.8
score: 17.6
coord: 139..176
e-value: 3.0
score: 14.0
IPR001680WD40 repeatPFAMPF00400WD40coord: 59..94
e-value: 4.6E-4
score: 20.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 62..103
score: 12.681
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 12..143
e-value: 6.2E-31
score: 109.8
NoneNo IPR availablePANTHERPTHR19877WD40 REPEAT PROTEINcoord: 11..174
NoneNo IPR availablePANTHERPTHR19877:SF4F9L1.42 PROTEINcoord: 11..174
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 81..95
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 62..177
score: 13.923
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 14..175