COMM domain-containing protein 4

Overview
NameCOMM domain-containing protein 4
Smed IDSMED30027897
Length (bp)1068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of COMM domain-containing protein 4 (SMED30027897) t-SNE clustered cells

Violin plots show distribution of expression levels for COMM domain-containing protein 4 (SMED30027897) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of COMM domain-containing protein 4 (SMED30027897) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for COMM domain-containing protein 4 (SMED30027897) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027897

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027897SMESG000046681.1 Contig2611GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30027897SMESG000046681.1 dd_Smed_v4_2501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027897SMESG000046681.1 dd_Smed_v4_2501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of COMM domain-containing protein 4 vs. Ensembl Human
Match: COMMD4 (COMM domain containing 4 [Source:HGNC Symbol;Acc:HGNC:26027])

HSP 1 Score: 105.916 bits (263), Expect = 1.764e-26
Identity = 66/211 (31.28%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+   V W +            LS S +  + +P++ + +    A  +    + +++S   F +  +E+ +    M+SL 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAG-VGWRV---------DYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 199          
BLAST of COMM domain-containing protein 4 vs. Ensembl Human
Match: COMMD4 (COMM domain containing 4 [Source:HGNC Symbol;Acc:HGNC:26027])

HSP 1 Score: 105.916 bits (263), Expect = 1.764e-26
Identity = 66/211 (31.28%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+   V W +            LS S +  + +P++ + +    A  +    + +++S   F +  +E+ +    M+SL 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAG-VGWRV---------DYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 199          
BLAST of COMM domain-containing protein 4 vs. Ensembl Human
Match: COMMD4 (COMM domain containing 4 [Source:HGNC Symbol;Acc:HGNC:26027])

HSP 1 Score: 102.064 bits (253), Expect = 5.079e-25
Identity = 63/189 (33.33%), Postives = 104/189 (55.03%), Query Frame = 2
Query:   77 KMKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMS 634
            + +F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+   V W +   + +     +L  S   P+     + +R   A A    + P+ MS
Sbjct:   27 RARFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAG-VGWRVDYTLSS-----SLLQSVEEPM-----VHLRLEVAAAPGTPAQPVAMS 202          
BLAST of COMM domain-containing protein 4 vs. Ensembl Human
Match: COMMD4 (COMM domain containing 4 [Source:HGNC Symbol;Acc:HGNC:26027])

HSP 1 Score: 98.5969 bits (244), Expect = 1.571e-24
Identity = 51/115 (44.35%), Postives = 76/115 (66.09%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADN 415
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY + 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEK 113          
BLAST of COMM domain-containing protein 4 vs. Ensembl Human
Match: COMMD4 (COMM domain containing 4 [Source:HGNC Symbol;Acc:HGNC:26027])

HSP 1 Score: 92.4337 bits (228), Expect = 9.289e-22
Identity = 58/208 (27.88%), Postives = 102/208 (49.04%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  L+K+   K+L L+++                       +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+   V W +            LS S +  + +P++ + +    A  +    + +++S   F +  +E+ +    M+SL 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKMYE-KILKLTAD--------------------AKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAG-VGWRV---------DYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 177          
BLAST of COMM domain-containing protein 4 vs. Ensembl Celegans
Match: T28F2.2 (pep chromosome:WBcel235:I:3637353:3638819:1 gene:WBGene00020901.1 transcript:T28F2.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28F2.2)

HSP 1 Score: 66.2402 bits (160), Expect = 8.990e-13
Identity = 40/119 (33.61%), Postives = 68/119 (57.14%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEI-VNLSKLSNIKVLSL---SSNLIKCILEK----DTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYAD 412
            MK+ F GD++CP WLL EI  N S L+ +K   L   +S+L+ C  +K    DT + I        + +N++  ++   ++++++ A YD   + L +E+ QLGLP EH +Q+ K Y +
Sbjct:    1 MKYHFLGDMECPSWLLEEICTNFSNLTVLKFKELCNRASHLVLCGHDKPILSDTSEGI--------NSVNNHTNLVLIGNWLLLKPAGYDCPSTDLEKEVVQLGLPPEHGIQLRKVYEN 111          
BLAST of COMM domain-containing protein 4 vs. Ensembl Celegans
Match: T28F2.2 (pep chromosome:WBcel235:I:3637575:3638768:1 gene:WBGene00020901.1 transcript:T28F2.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28F2.2)

HSP 1 Score: 53.9138 bits (128), Expect = 1.426e-8
Identity = 35/111 (31.53%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  104 LDCPDWLLLEI-VNLSKLSNIKVLSL---SSNLIKCILEK----DTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYAD 412
            ++CP WLL EI  N S L+ +K   L   +S+L+ C  +K    DT + I        + +N++  ++   ++++++ A YD   + L +E+ QLGLP EH +Q+ K Y +
Sbjct:    1 MECPSWLLEEICTNFSNLTVLKFKELCNRASHLVLCGHDKPILSDTSEGI--------NSVNNHTNLVLIGNWLLLKPAGYDCPSTDLEKEVVQLGLPPEHGIQLRKVYEN 103          
BLAST of COMM domain-containing protein 4 vs. Ensembl Fly
Match: CG34039 (gene:FBgn0054039 transcript:FBtr0301014)

HSP 1 Score: 88.5817 bits (218), Expect = 1.921e-20
Identity = 46/109 (42.20%), Postives = 70/109 (64.22%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLS--SNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVK 400
            MKF+FCG+ DCPDW+L EI+  S LSN+ + +L   S+L+   +  +T +   + KSL S   N+ K  +A ++FM+  AA+Y  + S   EEIQQLGLPK+H+  + +
Sbjct:    1 MKFRFCGEGDCPDWVLAEII--STLSNLSIENLEQLSDLVAQRICGETFEEAKI-KSLTSTLTNEGKTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMCR 106          
BLAST of COMM domain-containing protein 4 vs. Ensembl Zebrafish
Match: commd4 (COMM domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-060929-600])

HSP 1 Score: 102.834 bits (255), Expect = 1.404e-25
Identity = 56/141 (39.72%), Postives = 85/141 (60.28%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNI 493
            M+F+FCGDLDCPDW+L EI  L+++S++K+  L   ++K +L+ + ID   + K L SD   D  D KA +  L F++  AAK+D    +LS E+QQLGLPKEH+  + K Y D    +   L+  ++   R +  V W +
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLARISSVKMKLLCVQVVKDLLD-EGIDYDKVSK-LTSDAKFDSGDIKACIGVLSFILSSAAKHDVDSESLSSELQQLGLPKEHTTGLCKSYEDKHSALQEKLRESSLRLGR-LQTVNWRV 138          
BLAST of COMM domain-containing protein 4 vs. Ensembl Xenopus
Match: commd4 (COMM domain containing 4 [Source:NCBI gene;Acc:496531])

HSP 1 Score: 102.449 bits (254), Expect = 2.594e-25
Identity = 63/209 (30.14%), Postives = 119/209 (56.94%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSL 697
            M+F+FCGDLDCPDW+L EI  LS++S++K+  + + ++K +L  + ID   + K L SD   +  D KA +A L F++  AAK++ +  +LS E+QQLGLP+EH+  + + Y +    +   L+  ++  +R I+ + W +   + +   K           +PL+ + +    AG +   ++ ++ S +  L+  +E+ + ++ MN+L
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLSRISSVKLKLICAQVLKKLL-GEQIDYEKIIK-LTSDARFESGDIKATVAVLCFILSSAAKHNVSSDSLSSELQQLGLPREHAASLCRSYEEKQNALQETLRESSLRLTR-ISSLNWRVDQILSSSIVKQV--------NEPLVHLNLNVTDAGCNQPLTMTVSASKLRVLI--TELKQALEMMNAL 196          
BLAST of COMM domain-containing protein 4 vs. Ensembl Xenopus
Match: commd4 (COMM domain containing 4 [Source:NCBI gene;Acc:496531])

HSP 1 Score: 100.138 bits (248), Expect = 1.709e-24
Identity = 62/208 (29.81%), Postives = 118/208 (56.73%), Query Frame = 2
Query:   83 KFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSL 697
            +F+FCGDLDCPDW+L EI  LS++S++K+  + + ++K +L  + ID   + K L SD   +  D KA +A L F++  AAK++ +  +LS E+QQLGLP+EH+  + + Y +    +   L+  ++  +R I+ + W +   + +   K           +PL+ + +    AG +   ++ ++ S +  L+  +E+ + ++ MN+L
Sbjct:    3 RFRFCGDLDCPDWVLAEISTLSRISSVKLKLICAQVLKKLL-GEQIDYEKIIK-LTSDARFESGDIKATVAVLCFILSSAAKHNVSSDSLSSELQQLGLPREHAASLCRSYEEKQNALQETLRESSLRLTR-ISSLNWRVDQILSSSIVKQV--------NEPLVHLNLNVTDAGCNQPLTMTVSASKLRVLI--TELKQALEMMNAL 197          
BLAST of COMM domain-containing protein 4 vs. Ensembl Xenopus
Match: commd4 (COMM domain containing 4 [Source:NCBI gene;Acc:496531])

HSP 1 Score: 100.138 bits (248), Expect = 3.175e-24
Identity = 64/220 (29.09%), Postives = 123/220 (55.91%), Query Frame = 2
Query:   47 SYLFNYFYFRKMKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSL 697
            S + ++F     +F+FCGDLDCPDW+L EI  LS++S++K+  + + ++K +L  + ID   + K L SD   +  D KA +A L F++  AAK++ +  +LS E+QQLGLP+EH+  + + Y +    +   L+  ++  +R I+ + W +   + +   K           +PL+ + +    AG +   ++ ++ S +  L+  +E+ + ++ MN+L
Sbjct:   18 SLMLSFF----QRFRFCGDLDCPDWVLAEISTLSRISSVKLKLICAQVLKKLL-GEQIDYEKIIK-LTSDARFESGDIKATVAVLCFILSSAAKHNVSSDSLSSELQQLGLPREHAASLCRSYEEKQNALQETLRESSLRLTR-ISSLNWRVDQILSSSIVKQV--------NEPLVHLNLNVTDAGCNQPLTMTVSASKLRVLI--TELKQALEMMNAL 220          
BLAST of COMM domain-containing protein 4 vs. Ensembl Mouse
Match: Commd4 (COMM domain containing 4 [Source:MGI Symbol;Acc:MGI:1913449])

HSP 1 Score: 106.686 bits (265), Expect = 6.252e-27
Identity = 65/211 (30.81%), Postives = 117/211 (55.45%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+ + V W +            LS S +  + +P++ ++++   A  +    + +++S   F +  +E+ +    M +L 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKISSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKEHATSLCRCYEEKQSPLQEHLRACSLRVNRLAS-VGWRV---------DYTLSSSLLHSVEEPMVHLQLQVVPAPGTQAQPVSMSLSADKFQVLLAELKQAQTMMTALG 199          
BLAST of COMM domain-containing protein 4 vs. Ensembl Mouse
Match: Commd4 (COMM domain containing 4 [Source:MGI Symbol;Acc:MGI:1913449])

HSP 1 Score: 89.7373 bits (221), Expect = 7.552e-21
Identity = 56/209 (26.79%), Postives = 103/209 (49.28%), Query Frame = 2
Query:   83 KFKFCGDLDCPDWLLLEIVNLSKLS--NIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            +F+FCGDLDCPDW+L EI  L+K+     K+L L+++                       +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+ + V W +            LS S +  + +P++ ++++   A  +    + +++S   F +  +E+ +    M +L 
Sbjct:    2 RFRFCGDLDCPDWVLAEISTLAKIGIDYEKILKLTAD--------------------AKFESGDVKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKEHATSLCRCYEEKQSPLQEHLRACSLRVNRLAS-VGWRV---------DYTLSSSLLHSVEEPMVHLQLQVVPAPGTQAQPVSMSLSADKFQVLLAELKQAQTMMTALG 180          
BLAST of COMM domain-containing protein 4 vs. Ensembl Mouse
Match: Commd4 (COMM domain containing 4 [Source:MGI Symbol;Acc:MGI:1913449])

HSP 1 Score: 88.9669 bits (219), Expect = 8.866e-21
Identity = 54/157 (34.39%), Postives = 87/157 (55.41%), Query Frame = 2
Query:   83 KFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPK-----------------EHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNI 493
            +F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPK                 EH+  + +CY +    +   L+  ++  +R+ + V W +
Sbjct:    2 RFRFCGDLDCPDWVLAEISTLAKISSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKVSTRHLSRAPSELRLPAEHATSLCRCYEEKQSPLQEHLRACSLRVNRLAS-VGWRV 155          
BLAST of COMM domain-containing protein 4 vs. Ensembl Mouse
Match: Commd4 (COMM domain containing 4 [Source:MGI Symbol;Acc:MGI:1913449])

HSP 1 Score: 71.2478 bits (173), Expect = 2.482e-15
Identity = 39/103 (37.86%), Postives = 56/103 (54.37%), Query Frame = 2
Query:   98 GDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCY 406
            GDLDCPDW+L EI  L+K+   K+L L+++                       +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY
Sbjct:    1 GDLDCPDWVLAEISTLAKIYE-KILKLTAD--------------------AKFESGDVKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKEHATSLCRCY 82          
BLAST of COMM domain-containing protein 4 vs. Ensembl Mouse
Match: Commd4 (COMM domain containing 4 [Source:MGI Symbol;Acc:MGI:1913449])

HSP 1 Score: 70.0922 bits (170), Expect = 1.013e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:   98 GDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPK 376
            GDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPK
Sbjct:    2 GDLDCPDWVLAEISTLAKISSVKLRLLCSQVLKELLGQ-GIDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPK 95          
BLAST of COMM domain-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q9CQ02|COMD4_MOUSE (COMM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Commd4 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.373e-26
Identity = 65/211 (30.81%), Postives = 117/211 (55.45%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+ + V W +            LS S +  + +P++ ++++   A  +    + +++S   F +  +E+ +    M +L 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKISSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKEHATSLCRCYEEKQSPLQEHLRACSLRVNRLAS-VGWRV---------DYTLSSSLLHSVEEPMVHLQLQVVPAPGTQAQPVSMSLSADKFQVLLAELKQAQTMMTALG 199          
BLAST of COMM domain-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q9H0A8|COMD4_HUMAN (COMM domain-containing protein 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 8.473e-26
Identity = 66/211 (31.28%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L S ++K +L +  ID   + K L +D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R+   V W +            LS S +  + +P++ + +    A  +    + +++S   F +  +E+ +    M+SL 
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQG-IDYEKILK-LTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAG-VGWRV---------DYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 199          
BLAST of COMM domain-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q5E9V6|COMD4_BOVIN (COMM domain-containing protein 4 OS=Bos taurus OX=9913 GN=COMMD4 PE=2 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 1.886e-24
Identity = 61/188 (32.45%), Postives = 101/188 (53.72%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMS 634
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L   ++K +L    ID   + K L  D   +  D KA +A L F++  AAK+     +LS E+QQLGLPKEH+  + +CY +    +   L+  ++  +R++  V W +   + +   +           +PL  + +R   A +    + P+ MS
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLAKISSVKLRLLCGQVLKDLL-GGGIDYEKILK-LTMDARFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSSLQARLRACSLRVNRLVG-VGWRVDYTLSSSLLRTV--------EEPL--VHLRLEVAASPGAPAQPVAMS 175          
BLAST of COMM domain-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q550I8|COMD4_DICDI (COMM domain-containing protein 4 OS=Dictyostelium discoideum OX=44689 GN=commd4 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.321e-10
Identity = 34/94 (36.17%), Postives = 57/94 (60.64%), Query Frame = 2
Query:  152 LSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDD--LNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKI 427
            ++NI++  L+  +I  +   + ID   ++K +      + D KA++AA+HF+I  + K D   STLS E+QQLGLPKEH   I + + ++ EK+
Sbjct:    1 MTNIRIKLLTVQVITSLASGENIDFEKVEKLVKDAGFVIGDIKALIAAIHFIIFNSVKNDVDESTLSTELQQLGLPKEHCDSISRAFREHKEKL 94          
BLAST of COMM domain-containing protein 4 vs. TrEMBL
Match: T1IZI0 (COMM domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.318e-28
Identity = 74/173 (42.77%), Postives = 105/173 (60.69%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYR 589
            MKFKFCGDLDCPDW+L EI  LSKL+++KV  L S ++  +L   +ID   +QK L SD   D+   KA +AA+ ++I  A KY T   TLS E+QQLGLPKEHS  I K YADN+ K+   L   ++  S  ++ ++W +   I +      LSD      +PL+ ++++ R
Sbjct:    1 MKFKFCGDLDCPDWILAEITTLSKLTSVKVKLLCSQVLNDVL-GGSIDYEKVQK-LTSDAKLDIGGIKASIAAISYIITSAVKYSTEEHTLSNELQQLGLPKEHSTAICKVYADNYAKLQKELNNNSLRLS-YLDDLQWRLDYIISSSH----LSDVS----EPLLHLKMKVR 162          
BLAST of COMM domain-containing protein 4 vs. TrEMBL
Match: A0A0L8ID29 (COMM domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021663mg PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.562e-28
Identity = 79/211 (37.44%), Postives = 117/211 (55.45%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISK---LMDKMNS 694
            MKF+FCGDLDCPDW+L EI  LSKL+++K+  L + +I  IL  + ID   + K + +D   D+ D KA +AAL+F+I  AAK D    TLS E+QQLGLPKEHS  + K Y DN  K    L+ +++  S  +N ++W +   I ++  K            P + I ++       N   +   MS   F +F +E+ +   +MD +NS
Sbjct:    1 MKFRFCGDLDCPDWVLAEINILSKLTSVKMRLLCAQVISSILTAN-IDYEKVAK-ITADAKFDIGDIKASIAALYFIIRSAAKCDVDSDTLSNELQQLGLPKEHSTPLCKLYGDNVTKFQEQLRKQSLRISH-MNSIQWRVDYVISSKSLKTVNK--------PNVQICLKVVNPDTGNSKPVVFNMSAEKFRVFLNELKQVDTIMDNLNS 200          
BLAST of COMM domain-containing protein 4 vs. TrEMBL
Match: Q6WRH8 (COMM domain-containing protein OS=Branchiostoma belcheri tsingtauense OX=155462 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.471e-28
Identity = 76/211 (36.02%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  LSKL+++K+  L   ++K +L + +ID   + K L +D   +  D KA +AAL F++  AAKY     +LS E+QQLGLPKEHS  + K YADN   +      +++  S+ +   +W +            LS S +  + +P++ + +R R     N T     M+   F LF SE+ +    M  LA
Sbjct:    1 MRFRFCGDLDCPDWVLAEISILSKLTSVKMKLLCVQVVKDLLGQ-SIDYDKVHK-LTADAKYEAGDVKASIAALSFILSSAAKYQVDGDSLSNELQQLGLPKEHSSSLCKTYADNLGNLQAQFMRQSLKLSQ-LESAEWRV---------DYILSSSELQEVQEPMVQLRLRVRNPDTGNVTPHSFNMTADKFRLFVSELKQAHQVMEGLA 199          
BLAST of COMM domain-containing protein 4 vs. TrEMBL
Match: S4TAL9 (COMM domain-containing protein 4 OS=Branchiostoma lanceolatum OX=7740 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 7.413e-28
Identity = 76/211 (36.02%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLA 700
            M+F+FCGDLDCPDW+L EI  LSKL+++K+  L   ++K +L + +ID   + K L +D   +  D KA +AAL F++  AAKY     +LS E+QQLGLPKEHS  + K YADN   +      +++  S+ +   +W +            LS S +  + +P++ + +R R     N      TM+   F LF SE+ +    M  LA
Sbjct:    1 MRFRFCGDLDCPDWVLAEISILSKLTSVKMKLLCVQVVKDLLGQ-SIDYDKVHK-LTADAKYEAGDVKASIAALSFILSSAAKYQVDGDSLSNELQQLGLPKEHSSSLCKTYADNLGNLQAQFMRQSLKLSQ-LESAEWRV---------DYILSSSELQEVQEPMVQLRLRVRNPDTGNVAPHSFTMTADKFRLFLSELKQAHQVMEGLA 199          
BLAST of COMM domain-containing protein 4 vs. TrEMBL
Match: A0A369SGH6 (COMM domain-containing protein 4 OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_002932 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 8.854e-28
Identity = 60/139 (43.17%), Postives = 86/139 (61.87%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKD-TIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNI 493
            MKFKFCGDLDCPDW+L EI NLSK+S++K+  L + +IKC+LE +   D +    +    DL+D K  +A  HF++  AAKY+     L  E+QQLGLPKEH+  + + Y DN EK+   L+  ++  S+      W +
Sbjct:    1 MKFKFCGDLDCPDWVLAEITNLSKMSSVKMKLLITQVIKCMLEGELNYDKVYKLTADAKFDLSDIKGSIATSHFILCNAAKYNMESDALCNELQQLGLPKEHATGLCRAYHDNVEKLRQVLQDTSLRLSK-FKSCDWRV 138          
BLAST of COMM domain-containing protein 4 vs. Ensembl Cavefish
Match: commd4 (COMM domain-containing protein 4 [Source:NCBI gene;Acc:103023069])

HSP 1 Score: 109.383 bits (272), Expect = 4.444e-28
Identity = 73/211 (34.60%), Postives = 119/211 (56.40%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRK-AGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSL 697
            M+F+FCGDLDCPDW+L EI  L+++S++K+  L   +IK +L++D ID   + K L SD   +  D KA +A L F++  AAK+D    +LS E+QQLGLPKEH+  + K Y D    +   LK  ++   R +  V W +            LS S +  + +P++ + ++ +     S+ETS+ +T+    F +  +E+ +    MN+L
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLARISSVKMKLLCVQVIKDLLDED-IDYEKVSK-LTSDAKFESGDIKASVAVLSFILSSAAKHDVDGESLSSELQQLGLPKEHTTGLCKSYEDKHAALQQKLKESSLRLGR-LEVVNWRV---------DYTLSSSELKEVNEPVVQLRLQSQNPESGSSETSV-VTVGAEKFRVLLTELKQAQAMMNAL 198          
BLAST of COMM domain-containing protein 4 vs. Ensembl Cavefish
Match: commd4 (COMM domain-containing protein 4 [Source:NCBI gene;Acc:103023069])

HSP 1 Score: 105.145 bits (261), Expect = 1.812e-26
Identity = 59/141 (41.84%), Postives = 87/141 (61.70%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNI 493
            M+F+FCGDLDCPDW+L EI  L+++S++K+  L   +IK +L++D ID   + K L SD   +  D KA +A L F++  AAK+D    +LS E+QQLGLPKEH+  + K Y D    +   LK  ++   R +  V W +
Sbjct:    1 MRFRFCGDLDCPDWVLAEISTLARISSVKMKLLCVQVIKDLLDED-IDYEKVSK-LTSDAKFESGDIKASVAVLSFILSSAAKHDVDGESLSSELQQLGLPKEHTTGLCKSYEDKHAALQQKLKESSLRLGR-LEVVNWRV 138          
BLAST of COMM domain-containing protein 4 vs. Ensembl Cavefish
Match: commd4 (COMM domain-containing protein 4 [Source:NCBI gene;Acc:103023069])

HSP 1 Score: 89.3521 bits (220), Expect = 6.406e-21
Identity = 64/206 (31.07%), Postives = 103/206 (50.00%), Query Frame = 2
Query:   86 FKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRK-AGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSL 697
            F+FCGDLDCPDW+L EI  L+++   KV  L+S+                     S D+   KA +A L F++  AAK+D    +LS E+QQLGLPKEH+  + K Y D    +   LK  ++   R +  V W +            LS S +  + +P++ + ++ +     S+ETS+ +T+    F +  +E+ +    MN+L
Sbjct:    2 FRFCGDLDCPDWVLAEISTLARIYE-KVSKLTSD-----------------AKFESGDI---KASVAVLSFILSSAAKHDVDGESLSSELQQLGLPKEHTTGLCKSYEDKHAALQQKLKESSLRLGR-LEVVNWRV---------DYTLSSSELKEVNEPVVQLRLQSQNPESGSSETSV-VTVGAEKFRVLLTELKQAQAMMNAL 175          
BLAST of COMM domain-containing protein 4 vs. Ensembl Nematostella
Match: EDO49332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHE2])

HSP 1 Score: 110.923 bits (276), Expect = 4.415e-29
Identity = 61/141 (43.26%), Postives = 92/141 (65.25%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNI 493
            MKF+FCGDLDCPDW+L EI  LSK+S+IK+  L + ++K +L  +TID   +QK L SD   +++D KA++AAL F+++ AAKY     +L  E+QQLGLPKEH   + K YA++   +    +  ++    I N ++W +
Sbjct:    1 MKFRFCGDLDCPDWVLAEISTLSKMSSIKMKLLCAQVVKDLL-GETIDYAKVQK-LTSDAKFEVSDVKAVIAALCFILLSAAKYTVDSDSLGNELQQLGLPKEHCGALCKVYAESLSPLQDRFRETSLKFDGICN-LEWRV 138          
BLAST of COMM domain-containing protein 4 vs. Ensembl Medaka
Match: commd4 (COMM domain containing 4 [Source:NCBI gene;Acc:101165052])

HSP 1 Score: 108.997 bits (271), Expect = 6.969e-28
Identity = 70/210 (33.33%), Postives = 116/210 (55.24%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSD---DLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPL-DPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSL 697
            M+F+FCGDLDCPDW+L EI  L+K+S++K+  L   ++K +L  + ID   + K L +D   +  D KA +A L F++  AAK+D    +LS E+QQLGLPKEH+  + K Y D    +   L+  ++   R ++ V W +            LS S +  + +PLI ++++ + A +    +   ++S   F +  SE+ +    MN+L
Sbjct:    1 MRFRFCGDLDCPDWVLAEITTLAKMSSVKMKLLCGQVLKDLL-GEGIDYEKIVK-LTADAKFESGDIKASVAVLSFILSSAAKHDVDSESLSSELQQLGLPKEHASGLCKSYEDKHSALQDKLRETSLRLGR-LDSVSWRV---------DYTLSSSELSEVNEPLIHLKLQKQGAESGCSETAAFSISADKFRVLLSELKQAQALMNTL 198          
BLAST of COMM domain-containing protein 4 vs. Planmine SMEST
Match: SMESG000046681.1 (SMESG000046681.1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.505e-147
Identity = 207/209 (99.04%), Postives = 208/209 (99.52%), Query Frame = 2
Query:   80 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLAKS 706
            MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKW+IKT IENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLAKS
Sbjct:    1 MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLISLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKEHSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWSIKTLIENRFAKIALSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLMDKMNSLAKS 209          
The following BLAST results are available for this feature:
BLAST of COMM domain-containing protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COMMD41.764e-2631.28COMM domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
COMMD41.764e-2631.28COMM domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
COMMD45.079e-2533.33COMM domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
COMMD41.571e-2444.35COMM domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
COMMD49.289e-2227.88COMM domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T28F2.28.990e-1333.61pep chromosome:WBcel235:I:3637353:3638819:1 gene:W... [more]
T28F2.21.426e-831.53pep chromosome:WBcel235:I:3637575:3638768:1 gene:W... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG340391.921e-2042.20gene:FBgn0054039 transcript:FBtr0301014[more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd41.404e-2539.72COMM domain containing 4 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
commd42.594e-2530.14COMM domain containing 4 [Source:NCBI gene;Acc:496... [more]
commd41.709e-2429.81COMM domain containing 4 [Source:NCBI gene;Acc:496... [more]
commd43.175e-2429.09COMM domain containing 4 [Source:NCBI gene;Acc:496... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Commd46.252e-2730.81COMM domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
Commd47.552e-2126.79COMM domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
Commd48.866e-2134.39COMM domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
Commd42.482e-1537.86COMM domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
Commd41.013e-1444.79COMM domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9CQ02|COMD4_MOUSE4.373e-2630.81COMM domain-containing protein 4 OS=Mus musculus O... [more]
sp|Q9H0A8|COMD4_HUMAN8.473e-2631.28COMM domain-containing protein 4 OS=Homo sapiens O... [more]
sp|Q5E9V6|COMD4_BOVIN1.886e-2432.45COMM domain-containing protein 4 OS=Bos taurus OX=... [more]
sp|Q550I8|COMD4_DICDI1.321e-1036.17COMM domain-containing protein 4 OS=Dictyostelium ... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IZI02.318e-2842.77COMM domain-containing protein OS=Strigamia mariti... [more]
A0A0L8ID295.562e-2837.44COMM domain-containing protein OS=Octopus bimaculo... [more]
Q6WRH86.471e-2836.02COMM domain-containing protein OS=Branchiostoma be... [more]
S4TAL97.413e-2836.02COMM domain-containing protein 4 OS=Branchiostoma ... [more]
A0A369SGH68.854e-2843.17COMM domain-containing protein 4 OS=Trichoplax sp.... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
commd44.444e-2834.60COMM domain-containing protein 4 [Source:NCBI gene... [more]
commd41.812e-2641.84COMM domain-containing protein 4 [Source:NCBI gene... [more]
commd46.406e-2131.07COMM domain-containing protein 4 [Source:NCBI gene... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493324.415e-2943.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd46.969e-2833.33COMM domain containing 4 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of COMM domain-containing protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000046681.15.505e-14799.04SMESG000046681.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027897 ID=SMED30027897|Name=COMM domain-containing protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1068bp
ATTAACTCTTATTTATAGAATTTTGTATTCTATTCCTTAATAAATATCAT
ATTTATTTAATTATTTTTATTTCAGAAAAATGAAATTTAAATTTTGTGGT
GATTTAGACTGTCCTGATTGGCTTTTATTAGAAATAGTGAATCTTTCTAA
ATTGTCAAATATCAAAGTTTTAAGTCTATCTTCAAATTTAATAAAATGCA
TTTTGGAAAAAGATACTATCGATCTAATTAGTCTTCAAAAAAGTTTACCC
AGTGATGATTTAAATGACAATAAAGCTATTATGGCTGCTCTTCATTTTAT
GATAATACAAGCAGCAAAGTATGACACTGCACCTTCTACATTATCGGAAG
AAATTCAGCAATTGGGTTTGCCCAAAGAACATTCTGTACAAATTGTAAAG
TGTTACGCCGATAATTTTGAAAAGATTGTTCTATTTTTAAAAACCAAAAC
AATTATGAATAGTAGAATAATCAATCCTGTCAAATGGAACATCAAAACTC
CAATCGAAAATCGATTTGCCAAAATCGCATTATCTGATTCTCGAATATTC
CCTTTAGATCCCTTGATTTCAATTGAAATTAGATATCGAAAGGCTGGAGC
TAGCAATGAAACTAGTCTGCCTTTAACGATGAGTTACGTAGATTTCCTCT
TGTTTAAATCGGAAATCAGTAAGCTAATGGACAAAATGAATTCATTGGCA
AAGTCATAATAGTACTATAAGTTTTCATCACCTGAACTTTATAATTTTTG
AAAAAAAATCTAAAAAATATTTCACTTTAAATTTAAATGAAATTAATTGG
CTTTTAAATTATTGATTAATATACAAACCCTAGTAAAAAATTAAAAATTA
ATTTTATTAATGATTTATTGATTATATCTAACTCACTAGATTGTGAAAAT
TTATTACTCTGAACAAGTTAGAATCATATAATAAAATTTTTATCCAGCGT
GACAAGATACCCAACAAAAATAAGCAAATGTACTCAAGGTCATCTATGTT
CTTATGTAGGTGATACGACTCACACGAAACCAATTACTTGATTAATTCAA
AAAGTTTAGCGTGTAAGT
back to top

protein sequence of SMED30027897-orf-1

>SMED30027897-orf-1 ID=SMED30027897-orf-1|Name=SMED30027897-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MKFKFCGDLDCPDWLLLEIVNLSKLSNIKVLSLSSNLIKCILEKDTIDLI
SLQKSLPSDDLNDNKAIMAALHFMIIQAAKYDTAPSTLSEEIQQLGLPKE
HSVQIVKCYADNFEKIVLFLKTKTIMNSRIINPVKWNIKTPIENRFAKIA
LSDSRIFPLDPLISIEIRYRKAGASNETSLPLTMSYVDFLLFKSEISKLM
DKMNSLAKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017920COMM
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR16231FAMILY NOT NAMEDcoord: 1..204
NoneNo IPR availablePANTHERPTHR16231:SF4COMM DOMAIN-CONTAINING PROTEIN 4coord: 1..204