Interferon-induced GTP-binding protein Mx1

Overview
NameInterferon-induced GTP-binding protein Mx1
Smed IDSMED30027887
Length (bp)3317
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Interferon-induced GTP-binding protein Mx1 (SMED30027887) t-SNE clustered cells

Violin plots show distribution of expression levels for Interferon-induced GTP-binding protein Mx1 (SMED30027887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Interferon-induced GTP-binding protein Mx1 (SMED30027887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Interferon-induced GTP-binding protein Mx1 (SMED30027887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027887SMESG000002025.1 dd_Smed_v4_7246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027887SMESG000002025.1 dd_Smed_v4_7246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027887SMESG000002025.1 dd_Smed_v4_7246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30027887SMESG000002025.1 dd_Smed_v4_7246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027887SMESG000002025.1 dd_Smed_v4_7246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027887SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027887SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027887SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027887SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027887SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig32248uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027887SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig32248newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027887SMESG000068632.1 SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig47704uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027887SMESG000068632.1 SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig47704newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30027887SMESG000002025.1 dd_Smed_v6_7246_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027887SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027887SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30027887SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027887SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30027887SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027887SMESG000002025.1 dd_Smed_v4_7246_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027887SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: MX2 (MX dynamin like GTPase 2 [Source:HGNC Symbol;Acc:HGNC:7533])

HSP 1 Score: 148.673 bits (374), Expect = 4.336e-36
Identity = 83/225 (36.89%), Postives = 129/225 (57.33%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKST----ETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K        RI  +      +D    E EI + Q     N   I+ + I++ I SPE   LTIIDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P N DI TT  +  A E +P+  R IG+LTK D +D      +  ++RN   P++KGY
Sbjct:  101 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGY 322          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 140.969 bits (354), Expect = 4.466e-36
Identity = 84/228 (36.84%), Postives = 130/228 (57.02%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  ++ ++  FSA   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  +T    +  + + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++
Sbjct:   10 IPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVV 235          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: DNM2 (dynamin 2 [Source:HGNC Symbol;Acc:HGNC:2974])

HSP 1 Score: 144.436 bits (363), Expect = 1.987e-34
Identity = 147/518 (28.38%), Postives = 253/518 (48.84%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXW-SLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKY-------RKE--NHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLP-LKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYF 2803
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  + D  R G  +    L  +L   I ++LP LRS + + L     +++ +  ++  D  +             KTK LL   +   FG D F+  +E +G  D +   E          +G   + N +F E F     K        R+E    ++NI+   RT    ++     F+ IV++ ++K +E + +CV L    ++ +I+    K   +   P L+++ ++I    ++E+E   ++ +  L   E++Y 
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEI-EAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMAD--RMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTR-------------KTKALLQMVQQ--FGVD-FEKRIEGSG--DQVDTLE---------LSG-GARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGV-RTG---LFTPDMAFEAIVKKQIVKLKEPSLKCVDLVVSELATVIKKCAEK---LSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYI 486          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 140.584 bits (353), Expect = 2.281e-34
Identity = 85/234 (36.32%), Postives = 139/234 (59.40%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY
Sbjct:   46 EEKVRPCIDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGY 275          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: DNM2 (dynamin 2 [Source:HGNC Symbol;Acc:HGNC:2974])

HSP 1 Score: 144.05 bits (362), Expect = 2.377e-34
Identity = 147/518 (28.38%), Postives = 253/518 (48.84%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXW-SLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKY-------RKE--NHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLP-LKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYF 2803
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  + D  R G  +    L  +L   I ++LP LRS + + L     +++ +  ++  D  +             KTK LL   +   FG D F+  +E +G  D +   E          +G   + N +F E F     K        R+E    ++NI+   RT    ++     F+ IV++ ++K +E + +CV L    ++ +I+    K   +   P L+++ ++I    ++E+E   ++ +  L   E++Y 
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEI-EAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMAD--RMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTR-------------KTKALLQMVQQ--FGVD-FEKRIEGSG--DQVDTLE---------LSG-GARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGV-RTG---LFTPDMAFEAIVKKQIVKLKEPSLKCVDLVVSELATVIKKCAEK---LSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYI 486          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 136.346 bits (342), Expect = 2.242e-32
Identity = 105/325 (32.31%), Postives = 160/325 (49.23%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            +  I  IN + +  S+    V  + +LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+ +   E    +  +   F D      EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  V  Q  D+ ++  ++   F+ +E  LI+ V PAN D+ T+  +K A E +P   R IGVLTKLD +DE   T   EI+ N+   + +GY G++     DI+   +       E+K       +  + D  R G S     L  +L   I  TLP LR ++   +      +  +  YQ  D  +K
Sbjct:    9 QALIPVINRVQDAFSQLGTSV--SFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG--TDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMAD--RLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRK 327          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 136.346 bits (342), Expect = 2.308e-32
Identity = 105/325 (32.31%), Postives = 160/325 (49.23%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            +  I  IN + +  S+    V  + +LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+ +   E    +  +   F D      EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  V  Q  D+ ++  ++   F+ +E  LI+ V PAN D+ T+  +K A E +P   R IGVLTKLD +DE   T   EI+ N+   + +GY G++     DI+   +       E+K       +  + D  R G S     L  +L   I  TLP LR ++   +      +  +  YQ  D  +K
Sbjct:    9 QALIPVINRVQDAFSQLGTSV--SFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG--TDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMAD--RLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRK 327          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 114.39 bits (285), Expect = 1.180e-25
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 114.39 bits (285), Expect = 1.180e-25
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 114.39 bits (285), Expect = 1.180e-25
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0333717)

HSP 1 Score: 139.043 bits (349), Expect = 5.214e-33
Identity = 104/333 (31.23%), Postives = 171/333 (51.35%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIEN 2281
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR  +   +     +++ F  +Q GD  ++ K + + I+ +++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQS 333          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301595)

HSP 1 Score: 138.658 bits (348), Expect = 6.131e-33
Identity = 104/333 (31.23%), Postives = 171/333 (51.35%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIEN 2281
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR  +   +     +++ F  +Q GD  ++ K + + I+ +++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQS 333          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301594)

HSP 1 Score: 138.658 bits (348), Expect = 6.131e-33
Identity = 104/333 (31.23%), Postives = 171/333 (51.35%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIEN 2281
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR  +   +     +++ F  +Q GD  ++ K + + I+ +++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQS 333          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074123)

HSP 1 Score: 138.658 bits (348), Expect = 6.131e-33
Identity = 104/333 (31.23%), Postives = 171/333 (51.35%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIEN 2281
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR  +   +     +++ F  +Q GD  ++ K + + I+ +++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQS 333          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074124)

HSP 1 Score: 138.658 bits (348), Expect = 6.131e-33
Identity = 104/333 (31.23%), Postives = 171/333 (51.35%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIEN 2281
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR  +   +     +++ F  +Q GD  ++ K + + I+ +++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQS 333          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: mxg (myxovirus (influenza virus) resistance G [Source:ZFIN;Acc:ZDB-GENE-030721-10])

HSP 1 Score: 145.591 bits (366), Expect = 1.502e-35
Identity = 86/226 (38.05%), Postives = 132/226 (58.41%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKST---ETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +RS     +++ L LP I+V+GDQSSGKSS+L+ +SG+ LPRG   VTRCP+ ++++K T     +  I YR +   F D S  E  +K  Q     N   I  + IT+ + SP+   LT+IDLPG+ +  V GQ  D+  +  ++   F+  + ++ + V+P N DI TT  +K A E +P+  R I VLTK D +D+     I  I++N+ +P+ KGY
Sbjct:   53 IDLIDTLRS---VGIHKDLALPTIVVIGDQSSGKSSVLETLSGVALPRGNGIVTRCPLELRLKKVTGGVSWKAVISYREKRTEFADPSMVERHVKTAQDELAGNGVGICDELITLEVMSPDVCNLTLIDLPGIARVPVAGQPDDIANQIKKLIIKFIVMQETINLVVVPCNIDIATTEALKLAQEVDPEGKRTIAVLTKPDIIDKGTEKNILAIVQNKVIPLRKGY 275          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: si:dkeyp-110c12.3 (si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126-68])

HSP 1 Score: 144.436 bits (363), Expect = 3.285e-35
Identity = 126/423 (29.79%), Postives = 208/423 (49.17%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIENKTKNLLVKGKHEIFG--------YDNFKCFLEKNGIL--DSIKEHETFLYMWHNVFNGLYGK----FN--CVFEELFNDGYGKYRK 2491
            I  ID MR      +   L LP I VVGDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK +        I Y    E F + +  ES +++ Q     +   I  D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   +   F+ ++ ++ + V+P N DI TT  ++ A   +PD SR + +LTK D +D+     I ++++ + +P++KGY   IV      DI +  +  E  + EK+       +S L + +R   S  +  L  EL   I  +LP LR  +   L     +L S++     + E    ++S+KI +  ++   L   G+ E           +  ++C L  +  L  +S+KE      M  N   G  G+    F+  CV+E +     G  ++
Sbjct:   20 IEMIDFMRR---IGIERELALPAIAVVGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKMSSGSGWTAVISYNDVRETFHEPAQVESFVRKAQNMLAGDGVGICDDLISLEITSPDVCDLTLIDLPGITRVPVKGQPEDIGDQIRRLILKFIAKKETINLVVVPCNVDIATTEALRMAQGVDPDGSRTLAILTKPDLVDKGAEADILQVLQGKVVPLKKGY--TIVRCRGQSDINENVSLSEATRQEKEFFSNHPHFSYLLEEQRATTSCLSTRLTKELVEHIKASLPSLRDQIHINLSAVRIELRSYADGPPLETERMGPYLSKKILEFSDQISELCRTGESETGNLYSLLRPVFKQWECHLSNSKALFRESVKE------MTENYDEGHRGRELVTFSDYCVYESMVKRHVGDLKQ 431          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: si:dkeyp-110c12.3 (si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126-68])

HSP 1 Score: 144.05 bits (362), Expect = 4.259e-35
Identity = 130/451 (28.82%), Postives = 218/451 (48.34%), Query Frame = 2
Query: 1238 LKFSSTLSQSKKRMTVAKEKWIKK----INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGD-EVQKKFISEKIKDIENKTKNLLVKGKHEIFG--------YDNFKCFLEKNGIL--DSIKEHETFLYMWHNVFNGLYGK----FN--CVFEELFNDGYGKYRK 2491
            L F S+     +   +  ++W  +    I  ID MR      +   L LP I VVGDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK +        I Y    E F + +  ES +++ Q     +   I  D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   +   F+ ++ ++ + V+P N DI TT  ++ A   +PD SR + +LTK D +D+     I ++++ + +P++KGY   IV      DI +  +  E  + EK+       +S L + +R   S  +  L  EL   I  +LP LR  +   L     +L S++     + E    ++S+KI +  ++   L   G+ E           +  ++C L  +  L  +S+KE      M  N   G  G+    F+  CV+E +     G  ++
Sbjct:    8 LDFDSSDENGHENSGIFLQQWDAQVRPYIEMIDFMRR---IGIERELALPAIAVVGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKMSSGSGWTAVISYNDVRETFHEPAQVESFVRKAQNMLAGDGVGICDDLISLEITSPDVCDLTLIDLPGITRVPVKGQPEDIGDQIRRLILKFIAKKETINLVVVPCNVDIATTEALRMAQGVDPDGSRTLAILTKPDLVDKGAEADILQVLQGKVVPLKKGY--TIVRCRGQSDINENVSLSEATRQEKEFFSNHPHFSYLLEEQRATTSCLSTRLTKELVEHIKASLPSLRDQIHINLSAVRIELRSYADGPPLETERMGPYLSKKILEFSDQISELCRTGESETGNLYSLLRPVFKQWECHLSNSKALFRESVKE------MTENYDEGHRGRELVTFSDYCVYESMVKRHVGDLKQ 447          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 144.05 bits (362), Expect = 4.839e-35
Identity = 89/249 (35.74%), Postives = 142/249 (57.03%), Query Frame = 2
Query: 1241 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            K S T SQ        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M +S E      RI  +   E F D ++ E +I+E Q         I+++ I++ I S     LT+IDLPG+ +  V+GQ  ++ ++   + R F+ ++ ++ + V+P N DI TT  ++ A   +P+  R +G+LTK D +D+     + +I+ N+ + + KGY
Sbjct:    3 KMSYTFSQQ------YEEKIRPCIDTIDNLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVPLPRGSGIVTRCPLELKMIRSKEDEKWHGRISYQNHEEDFDDPAEVEKKIREAQDEMAGAGVGISEELISLQITSANVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIRMFITKQETINLVVVPCNVDIATTEALQMAQAEDPEGERTLGILTKPDLVDKGTEGTVVDIVHNEVIHLTKGY 242          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: mxa (myxovirus (influenza) resistance A [Source:NCBI gene;Acc:360142])

HSP 1 Score: 143.28 bits (360), Expect = 6.813e-35
Identity = 88/249 (35.34%), Postives = 142/249 (57.03%), Query Frame = 2
Query: 1241 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            K S T SQ        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M ++ +      RI  K   E F D ++ E +I++ Q         I+++ I++ I S     LT+IDLPG+ +  V+GQ  ++ ++   + R F+ ++ ++ + V+P N DI TT  ++ A   +PD  R +G+LTK D +D+     + +I+ N+ + + KGY
Sbjct:    3 KLSYTFSQQ------YEEKIRPCIDTIDNLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVPLPRGSGIVTRCPLELKMIRTKDQDKWHGRISYKTYEEDFDDPAEVEKKIRQAQDEMAGAGVGISEELISLQITSANVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIRKFVTRQETINLVVVPCNVDIATTEALQMAQAEDPDGERTLGILTKPDLVDKGTEGTVVDIVHNEVIHLTKGY 242          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: rnpepl1 (arginyl aminopeptidase (aminopeptidase B)-like 1 [Source:Xenbase;Acc:XB-GENE-986293])

HSP 1 Score: 151.369 bits (381), Expect = 7.286e-39
Identity = 108/304 (35.53%), Postives = 165/304 (54.28%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEI--QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNV-DNLLKITN 2194
            I  ++ ++  FSA   N  + LPQI VVG QS+GKSS+L+ + G   LPRG   +TR P+V+Q+  S TE    +  +   + D S+   EI+E   + T  N  I+  PI++ I SP  + L++IDLPG+ K  V  Q  D+  +  ++  +F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   EI+ N+ LP+ +GY G++     DI    N +   + E+        +  + D  R G S+    L  +L   I +TLP LRS + D LL + +
Sbjct:   12 IPLVNRLQDAFSAIGQNYQVDLPQIAVVGGQSAGKSSVLENLVGRDFLPRGAGIITRRPLVLQLITSNTEYAEFLHCKGTKYTDFSEVRQEIEEETERATGLNKGISAIPISLRIYSPHVLNLSLIDLPGVTKVPVGDQPADIETQIRDMIMNFISRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TNAQEILENKLLPLRRGYVGVVNRSQKDIDGKKNINAALQAEQMFFLTHPAYRHMAD--RMGTSHLQKMLNQQLTNHIRETLPDLRSKLQDQLLSLQH 311          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: krt17 (keratin 17 [Source:Xenbase;Acc:XB-GENE-490369])

HSP 1 Score: 143.28 bits (360), Expect = 5.138e-37
Identity = 81/233 (34.76%), Postives = 137/233 (58.80%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++++K+ +      +I YR    K    +D E E+K  Q         I+ + I++ + SP+   LT+IDLPG+ +  +  Q  D+ ++  ++ R +++++ ++ + V+P+N DI TT  ++ A E +P+  R +G+LTK D +D    T +  ++RN    + KGY
Sbjct:   10 EEKIRPCIDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVTLPRGSGIVTRCPLELKLKKAMKKTTWSGKISYRDHEIKIASAADVEEEVKRAQNLMAGSGKGISDELISLEVISPDVPDLTLIDLPGITRVALPDQPKDIEQQIKKMIRKYIQKQETINLVVVPSNVDIATTEALEMAREVDPNGERTLGILTKPDLVDRGAETDVISVVRNLVYSLNKGY 239          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: krt17 (keratin 17 [Source:Xenbase;Acc:XB-GENE-490369])

HSP 1 Score: 142.124 bits (357), Expect = 9.367e-37
Identity = 81/233 (34.76%), Postives = 137/233 (58.80%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++++K+ +      +I YR    K    +D E E+K  Q         I+ + I++ + SP+   LT+IDLPG+ +  +  Q  D+ ++  ++ R +++++ ++ + V+P+N DI TT  ++ A E +P+  R +G+LTK D +D    T +  ++RN    + KGY
Sbjct:   10 EEKIRPCIDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVTLPRGSGIVTRCPLELKLKKAMKKTTWSGKISYRDHEIKIASAADVEEEVKRAQNLMAGSGKGISDELISLEVISPDVPDLTLIDLPGITRVALPDQPKDIEQQIKKMIRKYIQKQETINLVVVPSNVDIATTEALEMAREVDPNGERTLGILTKPDLVDRGAETDVISVVRNLVYSLNKGY 239          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 139.043 bits (349), Expect = 6.795e-33
Identity = 104/320 (32.50%), Postives = 164/320 (51.25%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            I  ++ ++  FS+   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+   STE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  L D  R G      AL  +L   I  TLP LR+ + + L     +++ +  ++  D  +K
Sbjct:   10 IPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLAD--RMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 139.043 bits (349), Expect = 7.430e-33
Identity = 104/320 (32.50%), Postives = 164/320 (51.25%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            I  ++ ++  FS+   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+   STE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  L D  R G      AL  +L   I  TLP LR+ + + L     +++ +  ++  D  +K
Sbjct:   10 IPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLAD--RMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx1 (MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MGI:97243])

HSP 1 Score: 142.895 bits (359), Expect = 3.450e-37
Identity = 84/233 (36.05%), Postives = 133/233 (57.08%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYR--SEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IGVLTK D +D      + +++RN   P++KGY
Sbjct:   11 EEKVRPCIDLIDTLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLKEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLVDRGAEGKVLDVMRNLVYPLKKGY 240          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Dnm2 (dynamin 2 [Source:MGI Symbol;Acc:MGI:109547])

HSP 1 Score: 144.821 bits (364), Expect = 9.525e-35
Identity = 148/517 (28.63%), Postives = 253/517 (48.94%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKY-------RKE--NHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLP-LKKDIQKISRRVLKEKEVEIENYLTFLFKSERTY 2800
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  + D  R G  +    L  +L   I ++LP LRS + + L     +++ +  ++  D  +             KTK LL   +   FG D F+  +E +G  D +   E          +G   + N +F E F     K        R+E    ++NI+   RT    ++     F+ IV++ L+K +E + +CV L    ++ +I+    K   +   P L+++ ++I    ++E+E   ++ +  L   E++Y
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEI-EAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMAD--RMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTR-------------KTKALLQMVQQ--FGVD-FEKRIEGSG--DQVDTLE---------LSG-GARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGV-RTG---LFTPDMAFEAIVKKQLVKLKEPSLKCVDLVVSELATVIKKCAEK---LSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSY 485          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Dnm2 (dynamin 2 [Source:MGI Symbol;Acc:MGI:109547])

HSP 1 Score: 144.821 bits (364), Expect = 1.033e-34
Identity = 148/517 (28.63%), Postives = 253/517 (48.94%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXW-SLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKY-------RKE--NHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLP-LKKDIQKISRRVLKEKEVEIENYLTFLFKSERTY 2800
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  + D  R G  +    L  +L   I ++LP LRS + + L     +++ +  ++  D  +             KTK LL   +   FG D F+  +E +G  D +   E          +G   + N +F E F     K        R+E    ++NI+   RT    ++     F+ IV++ L+K +E + +CV L    ++ +I+    K   +   P L+++ ++I    ++E+E   ++ +  L   E++Y
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEI-EAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMAD--RMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTR-------------KTKALLQMVQQ--FGVD-FEKRIEGSG--DQVDTLE---------LSG-GARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGV-RTG---LFTPDMAFEAIVKKQLVKLKEPSLKCVDLVVSELATVIKKCAEK---LSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSY 485          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx1 (MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MGI:97243])

HSP 1 Score: 141.354 bits (355), Expect = 3.100e-34
Identity = 84/233 (36.05%), Postives = 133/233 (57.08%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYR--SEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IGVLTK D +D      + +++RN   P++KGY
Sbjct:   12 EEKVRPCIDLIDTLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLKEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLVDRGAEGKVLDVMRNLVYPLKKGY 241          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 142.51 bits (358), Expect = 4.712e-34
Identity = 107/321 (33.33%), Postives = 164/321 (51.09%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            I  ++ ++  FSA   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  ST    +  + + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  L D  R G       L  +L   I  TLP LR+ + + L     ++D +  ++  D  +K
Sbjct:   10 IPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEI-EAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLAD--RMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q91192|MX1_ONCMY (Interferon-induced GTP-binding protein Mx1 OS=Oncorhynchus mykiss OX=8022 GN=mx1 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.391e-41
Identity = 131/437 (29.98%), Postives = 219/437 (50.11%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGL---YGKFNCVFE---ELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLF 2566
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K+LP L   ++  L  T+ +L+ +      D  ++ +                       F  D    F +    L + +E ++ + +  NVF+ L   +GK+    E   E+FN      R E  +++  K  R  ++P +I+ + F
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETISLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYGTGPPEDSAERLY-----------------------FLIDKVTAFTQDAINLSTGEEMKSGVRL--NVFSTLRKEFGKWKLHLERSGEIFNQ-----RIEGEVDDYEKTYRGRELPGFINYKTF 418          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q6PW23|MX_EPICO (Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.869e-40
Identity = 126/435 (28.97%), Postives = 222/435 (51.03%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRS--EPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVN-----DDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKK-FISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGL---YGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLF 2566
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I YR   +  +D SD E++I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + EI+ N+ + ++KGY  +IV      +   K++  + ++  +          +L +  +  +    + L  EL   I+++LP L   +++ L+ T  +L+ +      D  +K  F+ +K+        +L           ++ KC        D +           NVF+ L   + ++N    +L  + + K R E  +EN  +K R  ++P +I+ + F
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWYGKISYRGCEKELEDPSDVENKIREAQDEMAGVGVGISDDLISLEIASPDVPDLTLIDLPGIARVAVKGQPEDIGKQIKGLIQRFITRQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVEIVHNEVIHLKKGY--MIVRCRGQKEITEKVSLTEALESEKAFFRDHVHFHTLYNEGQATVPKLAEKLTLELVHHIERSLPRLEEQIEDKLEQTQAELERYGSGPPSDATEKLFFLIDKVTAFTQDAISLTTG--------EDLKCG-------DKL-----------NVFSALRREFARWNAHL-DLSGEKFNK-RIEKEVENYEEKYRGRELPGFINYKTF 417          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|P20593|MX_PERFL (Interferon-induced GTP-binding protein Mx (Fragment) OS=Perca fluviatilis OX=8168 GN=mx PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.634e-40
Identity = 85/233 (36.48%), Postives = 142/233 (60.94%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   +  +D +D E +I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ ++   + + F++++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +I+ N+ +P++KGY
Sbjct:   11 EEKVRPCIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRRQEGEEWYGKISYQDCEKEIEDPADVEKKIRDAQDEMAGVGVGISDDLISLEIASPDVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIQKFIKRQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIVHNEVIPLKKGY 240          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q91196|MX2_ONCMY (Interferon-induced GTP-binding protein Mx2 OS=Oncorhynchus mykiss OX=8022 GN=mx2 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 4.759e-40
Identity = 110/318 (34.59%), Postives = 178/318 (55.97%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLD 2206
            +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  + R E  +D SD E++I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K++P L+  ++  L+ T   L+
Sbjct:   10 EEKVRPSIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDREEEIEDPSDVENKIRKAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIVHNEVIQLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVQHIEKSMPRLKEQIEEKLEETRTALE 322          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q9N0Y3|MX1_CANLF (Interferon-induced GTP-binding protein Mx1 OS=Canis lupus familiaris OX=9615 GN=MX1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.196e-39
Identity = 143/517 (27.66%), Postives = 254/517 (49.13%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNV-DNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYM-WHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTI 2818
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     E R ++ Y+    +  D S+ E EI + Q         I+ + I++ + SP    LT+IDLPG+ +  V  Q  D+  +T ++ R ++ ++ ++ + V+P N DI TT  +  A E +PD  R IG+LTK D +D      + ++ +N    ++KGY  +IV      DI    +  E  + EK   ++   +  L +  R  + N  + L  EL   I KTLP+L + + +N  KIT  +L  +      DE +K F      +  N+  + L++G+                   +S+ E E+ L+    N F+    K++ V E+ F  GY    K+  +E    + R  ++P +++ + F+ I+++ + +  E   + +     ++     D+   +F+ +   L +  +     +  E E E E  +   F+ E+  + QD +
Sbjct:   49 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLINEDEWRGKVSYQDTEMEISDPSEVEVEINKAQDAIAGEGQGISHELISLEVSSPHVPDLTLIDLPGITRVAVGNQPADIGRQTKQLIRKYILKQETINLVVVPCNVDIATTEALSMAQEVDPDGDRTIGILTKPDLVDRGTEGKVVDVAQNLVCHLKKGY--MIVKCRGQQDIQDQVSLAEALQKEKDFFEDHPHFRVLLEEGRATVPNLAEKLTSELITHICKTLPLLENQIKENHEKITE-ELQKYGSDVPEDEHEKMFFLIDKLNAFNQDISSLIQGE-------------------ESVGEDESRLFTKIRNEFH----KWSAVIEKKFQRGYKAIYKQ--MEKFENRYRGRELPGFVNYKTFEIIIKQQIKELEEPAVDMLHTITDMVQVAFGDISKANFD-EFFNLYRTTKSKIEDIKFELEKEAEKSIRLHFQMEQIVYCQDHV 533          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: A0A5E4BIL4 (Uncharacterized protein OS=Marmota monax OX=9995 GN=MONAX_5E036522 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.368e-43
Identity = 166/617 (26.90%), Postives = 293/617 (47.49%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV-----NDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNV-DNLLKITNGKLDSFSKYQGGDEVQKK-----FISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAAL 3085
            +EK    I+ ID +R+     V   L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++M+K     E R ++ Y     +  + S  E EI + Q         I+ + I++ + SP    LT+IDLPG+ +  V  Q TD+  +   + R +++++ ++ + V+P+N DI TT  +  A E +PD  R IG+LTK D +D+     + +++RN    ++KGY  +IV     +D   +L+  + ++K +       +  +L D  +  +    + L  EL   I K+LP+L + + +N+ K+T        KY G D  +++     F+ +KI +  N+  N +V+ + E+ G +  + F          KE               + K++ V EE F  G+G  RKE  +     + R  ++P +++ R F+ I++E L    E   + +     ++     +   K+F  +   L K  +     +  E+E   E  +   F+ E+  + QD +  G      Q +        K  S+ QS S      +S E  ++   +I +H L  Y K A  ++  ++P  ++  +   F   L  A+
Sbjct:   47 EEKVRPCIDLIDSLRA---LGVERDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRMKKLGQEDEWRAKVSYLDMELELSEASQVEGEINKAQNLIAGTGLGISDELISLEVSSPSVPDLTLIDLPGITRVAVGNQPTDIGRQIKRLIRKYIQKQETINLVVVPSNVDIATTEALSMAQEVDPDGDRTIGILTKPDLVDKGTEDTVVDVVRNLVCHLKKGY--MIVKCRGQHDIQSRLSLAEALQKEKAFFEDHPQFSALLDEGKATIPCLAERLTTELIAHICKSLPLLENQIKENIQKVTEE-----LKYFGVDVPEEESLKTFFLIDKINEF-NQDINAIVQAE-EVVGPEEMRLFTRMR------KE---------------FHKWSTVIEENFQKGHGVLRKE--IRKFENQYRGRELPGFVNYRTFETIIKEQLRSLEEPAVDMLHTVTDMVRIAFTNASEKNF-AEFFNLHKTAKSKIEDIRLEQEQGAERCIRLHFQMEQIVYCQDQVYRG----ALQGVREKEAEEEKRKSHGQSQS------VSAE--ESSMAEIFQH-LDAYRKEAHNRISSLVPLIVQFFVLKTFGQQLQKAM 614          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: A0A3P9DLA0 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 4.165e-43
Identity = 161/601 (26.79%), Postives = 276/601 (45.92%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYR--SEPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK-KFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYG-KYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFRE----KTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASL 3073
            I+ ID++RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRGV  VTRCP+ ++M +  +      +I YR  +E  K  S  E +I+E Q     N   I+ D I++ I SP+   LT+IDLPG+ +  V GQ+ D+ E+   + ++ + ++ ++ + V+P N DI TT  ++ A + +P+  R +G+LTK D +D+     + +I+ N+ +P++KGY  ++V   +                      W L    +  +    + L  EL   I K+LP L   +   LK T   LD  S     D +++  F+ +++        + L KG+    GY +                         ++F+ L G+F    E +   G    +  +  +    +K R  ++P +I+ + F+ +++E + +  E    K  +  +L  + +  + Q  LV  F   +      I+ I  R  +E E E    +   F+ E   +TQDT      +L  +       A N L +N  S + L               ++LKH L  Y + A ++L D IP  I+  +   F+  L
Sbjct:   16 IDLIDKLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGVGIVTRCPLELKMTRKKKGEAWYGKISYRDYNEELKKPSLVEKKIREAQDKLVGNGTGISNDLISLEIASPDVPDLTLIDLPGITRVAVSGQSEDIGEQIKRLIQNNIRKQETISLVVVPCNVDIATTEALRMAQQVDPEGERTLGILTKPDLVDKGTEENVVKIVHNEVIPLKKGY--MVVKCRVCSF-------------------WKLCKQGQATVPKLAEKLTLELVHHIQKSLPRLDEQIQKKLKQTRANLDKLSNGPPSDAIERLGFLIDRVSAFTQDAIS-LTKGEELKCGYKS-------------------------SIFSLLRGQFAVWREAIETSGTNFNWNIQREVSQYERKYRGRELPGFINYKTFEAMIQEQIKQLEEPAVQKLKDVSELVKKELFELAQSSLV-GFPNLIRTAMLKIEDI--RTKREAEAEAILRIRGGFQMELIVYTQDTTYS--QMLAKRKREDKEEAVNSLVNNNSSGATL--------------KEMLKH-LKSYYQIAGQRLADQIPLVIRYQMLQQFANQL 546          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: A0A5C6N2S2 (Mx Interferon-inducible OS=Takifugu flavidus OX=433684 GN=D4764_04G0004390 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.777e-42
Identity = 166/627 (26.48%), Postives = 290/627 (46.25%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKY--RSEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVN-----DDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK-KFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRI--ISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDED 3145
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E       I Y  + E  +D +D E +I+E Q         I+ D I++ I SPE   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +II N+ + ++KGY  +IV      + I K++  +  +             +L D  +  +    + L  EL   I+K+LP L   ++  L  T  +L+ +      D  +K  F+ +K+    +   + L  G+    G + F    +K G              W    +    KFN   E    +   KYR       IN K        Y+     K++ E A+   ++  D   K+   +   SF     L+K  + K+  +K+ ++K + ++L+ +           FK E   +TQD     +   ++ +        ++    +++    FG  +  +N  T   +++ H L  Y + A ++L D IP  I+  +  +F+  L   + +++L   ++   F   D D
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRRKEGEPWYGNISYLDQEEVIEDPADVEKKIQEAQNEMAGVGVGISDDLISLEIASPEVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIAKQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIIHNEVIHLKKGY--MIVRCRGQKEIIDKVSLAEATETETAFFRDHAHFQTLYDNGQATIPKLAEKLTLELVNHIEKSLPRLEEQIEEKLAHTRAELERYGTGPPSDPAEKVTFLMDKLTAFTHDAIS-LTTGEDICCGENIFSTLRQKFG-------------EWIRHLDSSGVKFNVRLEREVQEYEVKYRGRELPGFINYKTFE-----YMVKEQVKQLEEPAVRNLKDIGDAVRKVFIHLAQTSFAGLPNLIKTAKAKIETIKQRMEKDAEKLLRTQ-----------FKMELLVYTQD-----RTYSSSLDESKKEEQEDEFPQIKKARLPAFGFPVKQDNHATLT-ELMMH-LKSYYRIASQRLSDQIPLVIRYHMLQEFAIQLQREM-LQLLQDRENTELFLKEDLD 599          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: A0A437DD33 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00044430 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 9.459e-42
Identity = 167/609 (27.42%), Postives = 284/609 (46.63%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET---RIQIKYR--SEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV-----NDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK-KFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFRE----KTDECVKLCCRIISFIIQDVLVKDFEVKLLP-LKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIE---GQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASL 3073
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M+K TE    + +I YR  +E  KD ++ E +I + Q         I+ + I++ I SP    LT+IDLPG+ +  ++GQ  D+ E+  ++   F+ +  ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +II N+ +P++KGY  +IV     N+   K++    ++K +    +     +L    R  +    + L  EL   I K+LP L   ++  LK T  KLD        +  +K  F+ +K+     +    L KG+    GY        K+ I   +++       W+++       F+             +  E  +    +K R +++P +I+ + F+ +V+E + +  E    K  E  ++  +    ++Q  LV       LP L +  +  +  ++ EKE   E+ L   FK E   +TQD       G+     Q +  TS+ G  L                         ++ KH L  Y + A ++L D IP  I   +  +F+  L
Sbjct:   65 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKKITEDQKWKGKIHYRGFAEEIKDPANVEEKIHQAQDKMAGVGVGISDELISLEIASPNVPDLTLIDLPGITRVAMKGQPADIGEQIKKLIWKFIGKRETINLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEENVVDIINNKAIPLKKGY--MIVKCRGQNEITKKVSLTKALEKEKTFFQEHSHFQTLYYDGRASVPKLAEKLTLELVHHIQKSLPRLEEQIETKLKQTQSKLDHLGCGPPSEPSEKLGFLIDKVTSF-TQDAVYLSKGEDLRCGY--------KSKIFSVLRQR---FSSWNHLIEDSGTTFS-------------WNIEKEVSQYERKYRGKELPGFINYKTFEAMVQEQVKQLEEPAVLKLKEVSEMAKKEFFALMQRSLVG------LPNLMRAAKLKTEAIMNEKEDLAESMLRTQFKMEMIVYTQDCRYSKKLGKRKSEGQLVKNTSDIGASL------------------------KEMAKH-LKSYYQIAGQRLADQIPLVIHYQMLQEFAVQL 612          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: I3MJX6 (MX dynamin like GTPase 1 OS=Ictidomys tridecemlineatus OX=43179 GN=MX1 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.294e-41
Identity = 167/613 (27.24%), Postives = 289/613 (47.15%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDIL-KLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNV-DNLLKITNGKLDSFSKYQGGDEVQKK-FISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAAL 3085
            +EK    I+ ID +R+     V   L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++M+K     E R ++ Y     +  + S  E EI + Q         I+ + I++ + SP    LT+IDLPG+ +  V  Q TD+  +   + R +++++ ++ + V+P+N DI TT  +  A E +PD  R IG+LTK D +D+     + +++RN    ++KGY  +IV      DI  +L+  + ++K +       +  +L D  +  +    + L  EL   I K+LP+L + + +N+ K+T  +L +F      +E  K  F+ +KI    N+  N +V+ + E+ G +  + F          KE     + W N             EE F  G+G  RKE  +     + R  ++P +++ R F+ I++E L    E   + +     ++     +   K+F  +   L K  +     +  E+E   E  +   F+ E+  + QD +  G      Q +        K  S+ QS        +S E  ++   +I +H L  Y K A  ++  ++P  I+  +   F   L  A+
Sbjct:   47 EEKVRPCIDLIDSLRA---LGVERDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRMKKLGQEDEWRGKVSYLDMELELSEASQVEEEINKAQNLIAGTGLGISDELISLEVSSPSVPDLTLIDLPGITRVAVGNQPTDIGRQIKRLIRKYIQKQETINLVVVPSNVDIATTEALSMAQEVDPDGDRTIGILTKPDLVDKGTEDTVVDVVRNLVCHLKKGY--MIVKCRGQQDIQSRLSLAEALQKEKAFFEDHPQFRALLDEGKATIPCLAERLTTELIAHICKSLPLLENQIKENIQKVTE-ELKNFGVDVPEEESLKTFFLIDKINQF-NQDINAIVQAE-EVVGPEEMRLFTRMR------KE----FHKWSN-----------EIEENFQKGHGVLRKE--IRRFENQYRGRELPGFVNYRTFETIIKEQLRSLEEPAVDMLHTVTDMVRVAFTNASEKNF-AEFFNLHKTAKSKIEDIRLEQEQGAERCIRLHFQMEQIVYCQDQVYRG----ALQGVREKEAEEEKRKSHGQSQP------VSAE--ESSMAEIFQH-LDAYRKEAHNRISSLVPLIIQFFVLKTFGQKLQTAM 614          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: mxa (interferon-induced GTP-binding protein Mx1-like [Source:NCBI gene;Acc:103043862])

HSP 1 Score: 168.703 bits (426), Expect = 3.250e-43
Identity = 168/599 (28.05%), Postives = 279/599 (46.58%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRK-ENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFRE----KTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSIL-----FGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIK 3040
            I+ ID +RS+    V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I      E   D ++ ES+I+E Q         I+ D I++ I S     LT+IDLPG+ +  V+GQ  D+ ++   + R F+ ++ ++ + V+P N DI TT  +K A   +P+  R +G+LTK D +D+     + EI+ N+ + + KGY  +IV      +I+   +  E  + EK   ++   +S L D  +  +    + L  EL   I+K+LP L   ++  L  T    D   KY  G  ++    SE+I                  +  D    F +    L   +E  T  ++  N+F+ L  KF    + L   G    R+ E  ++    K R  ++P +I+ + F+ +V++ + K  E    K  E   L  +    + Q+  V  F   L   K  I  I     +EKE E E+ L   FK E   +TQD+         +  L+   +   +    +  NS +     F + +S  N      ++++H L  Y   A ++L D +P  I+
Sbjct:   17 IDLIDSLRSQ---GVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRCREEDSWHGKISYDGYEEELDDPAEVESKIREAQDKIAGVGVGISDDLISLEITSSNVPDLTLIDLPGIARVAVKGQPEDIGDQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQVEDPNGERTLGILTKPDLVDKGTEETVVEIVNNEIINLTKGY--MIVRCRGQKEIIDRVSLTEATEKEKAFFRDHPHFSVLYDDGKATVPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETQ---DELEKYGNGPPMEP---SERI-----------------YYLIDKVTAFTQDALNLTMGEELRTAPHL--NIFSNLRIKFESWKQHLDQSGETFNRRIEKEVQEYEVKYRGRELPGFINYKTFEVMVKDQIKKLEEPAVRKLKEISDLIRKGFIQLAQNSFV-GFPNLLRTAKTRIDSIK----QEKEAEAESMLRTQFKMELIIYTQDSTY-------SNTLISLKHEEEEGEEQKGGNSYVVSGFGFSSLLSNTNNHATLQELMRH-LKSYYGIASKRLADQVPLMIR 572          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: mxa (interferon-induced GTP-binding protein Mx1-like [Source:NCBI gene;Acc:103043862])

HSP 1 Score: 168.703 bits (426), Expect = 3.250e-43
Identity = 168/599 (28.05%), Postives = 279/599 (46.58%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRK-ENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFRE----KTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSIL-----FGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIK 3040
            I+ ID +RS+    V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I      E   D ++ ES+I+E Q         I+ D I++ I S     LT+IDLPG+ +  V+GQ  D+ ++   + R F+ ++ ++ + V+P N DI TT  +K A   +P+  R +G+LTK D +D+     + EI+ N+ + + KGY  +IV      +I+   +  E  + EK   ++   +S L D  +  +    + L  EL   I+K+LP L   ++  L  T    D   KY  G  ++    SE+I                  +  D    F +    L   +E  T  ++  N+F+ L  KF    + L   G    R+ E  ++    K R  ++P +I+ + F+ +V++ + K  E    K  E   L  +    + Q+  V  F   L   K  I  I     +EKE E E+ L   FK E   +TQD+         +  L+   +   +    +  NS +     F + +S  N      ++++H L  Y   A ++L D +P  I+
Sbjct:   17 IDLIDSLRSQ---GVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRCREEDSWHGKISYDGYEEELDDPAEVESKIREAQDKIAGVGVGISDDLISLEITSSNVPDLTLIDLPGIARVAVKGQPEDIGDQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQVEDPNGERTLGILTKPDLVDKGTEETVVEIVNNEIINLTKGY--MIVRCRGQKEIIDRVSLTEATEKEKAFFRDHPHFSVLYDDGKATVPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETQ---DELEKYGNGPPMEP---SERI-----------------YYLIDKVTAFTQDALNLTMGEELRTAPHL--NIFSNLRIKFESWKQHLDQSGETFNRRIEKEVQEYEVKYRGRELPGFINYKTFEVMVKDQIKKLEEPAVRKLKEISDLIRKGFIQLAQNSFV-GFPNLLRTAKTRIDSIK----QEKEAEAESMLRTQFKMELIIYTQDSTY-------SNTLISLKHEEEEGEEQKGGNSYVVSGFGFSSLLSNTNNHATLQELMRH-LKSYYGIASKRLADQVPLMIR 572          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: ENSAMXT00000057014.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19594915:19607580:1 gene:ENSAMXG00000040238.1 transcript:ENSAMXT00000057014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 4.538e-41
Identity = 89/226 (39.38%), Postives = 137/226 (60.62%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S   + ++E Q     +   I  D IT+ I SPE   LT+IDLPG+ +  V+GQ  D+ ++   + R+F+E++ ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     + +I++NQ +P+ KGY
Sbjct:    1 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKLKGGVQWRATISYRDEYIEFDDPSLVGTYVEEAQNELAGDGVGICDDLITLEIMSPEVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIRNFIEKDQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNVLDIVKNQVIPLSKGY 223          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: ENSAMXT00000030993.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19620289:19647832:1 gene:ENSAMXG00000043681.1 transcript:ENSAMXT00000030993.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 6.919e-41
Identity = 89/226 (39.38%), Postives = 137/226 (60.62%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S  E+ ++E Q     +   I  D IT+ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+E+E ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     I ++++NQ +P+ KGY
Sbjct:   34 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKIKGGVQWRATISYRDEYIEFDDPSLVETYVEEAQNELAGDGVGICDDLITLEIMSPDVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIQSFIEKEQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNILDVVKNQVIPLSKGY 256          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: ENSAMXT00000016255.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19660250:19682854:1 gene:ENSAMXG00000015797.2 transcript:ENSAMXT00000016255.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.844 bits (403), Expect = 1.484e-40
Identity = 90/226 (39.82%), Postives = 135/226 (59.73%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S   + ++E Q     +   I  D IT+ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + R F+E+E ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     I +I+ NQ +P+ KGY
Sbjct:   30 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKIKGGVQWRATISYRDEYIEFDDPSLVGTYVEEAQNELAGDGVGICDDLITLEIMSPDVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIRSFIEKEQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNILDIVNNQVIPLSKGY 252          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 137.887 bits (346), Expect = 8.783e-34
Identity = 79/229 (34.50%), Postives = 130/229 (56.77%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKST---ETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITIS-------IQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      V++ + LP + V+GDQSSGKSS+L+A+SG++LPRG   VTRCP+ ++++++      RI+ + +        DT   + +    A  +E+T D + +S       + S     LT+IDLPG+ +  + GQA D+  +  ++ RD + ++ ++ + V+P N DI TT  +K A   +P   R +GVLTK D +DE        I++NQ  P+ KGY
Sbjct:   31 IDLIDTLRY---LGVDQDVGLPAVAVIGDQSSGKSSVLEALSGVQLPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDAVLQA-QSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGY 255          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 1.183e-26
Identity = 78/256 (30.47%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------------RKSTETRIQ-------------IKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  I++++  F+   +E+++LPQI+VVG QSSGKSS+L+++ G   LPRG   VTR P+V+Q+                   ST  R+              +  +++ + D ++   EI+    + T  N  I+ + I + I SP  + LT++DLPG+ K  V  Q  D+ ++  E+   F+   NS+I+ V  AN D+ T+  +K A E + D  R + V+TKLD +D     +  +I+  + +P++ G  G++
Sbjct:    5 IPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAM--DILTGRVIPVKLGIIGVV 258          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 4.387e-25
Identity = 67/182 (36.81%), Postives = 102/182 (56.04%), Query Frame = 2
Query: 1445 LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            LPRG   VTR P+++Q M    E    +  + + F D  +  +EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  E+   F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +D+   T   +I+ N+ LP+ +GY G++
Sbjct:    4 LPRGSGIVTRRPLILQLMFCKAEYAEFLHCKGKKFTDFEEVRAEI-EAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDG--TDARDILENKLLPLRRGYIGVV 182          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 90.1225 bits (222), Expect = 1.708e-18
Identity = 62/228 (27.19%), Postives = 120/228 (52.63%), Query Frame = 2
Query: 1334 SKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVN-TVTRCPVVMQMRKSTETRIQIKYRSEPFK-----DIS--DTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVT---LIPEIIRNQKLPIEK-GYYGLI 1978
            S + A+ N   +LP+++VVGDQSSGK+S+L+ I+  ++ PRG    +TR PV + + +        K  S  F      D++    E EI+  ++    + ++ + I++S++ P    + ++DLPG++     G A D  +    +++ +M+  N++I+C+   + D   +      +  +P   R I VLTK+D L EK +     I +I+  +  P++  GY+ ++
Sbjct:  208 SDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVV 434          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 89.7373 bits (221), Expect = 1.861e-18
Identity = 62/228 (27.19%), Postives = 120/228 (52.63%), Query Frame = 2
Query: 1334 SKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVN-TVTRCPVVMQMRKSTETRIQIKYRSEPFK-----DIS--DTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVT---LIPEIIRNQKLPIEK-GYYGLI 1978
            S + A+ N   +LP+++VVGDQSSGK+S+L+ I+  ++ PRG    +TR PV + + +        K  S  F      D++    E EI+  ++    + ++ + I++S++ P    + ++DLPG++     G A D  +    +++ +M+  N++I+C+   + D   +      +  +P   R I VLTK+D L EK +     I +I+  +  P++  GY+ ++
Sbjct:  218 SDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVV 444          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 115.546 bits (288), Expect = 8.747e-27
Identity = 85/277 (30.69%), Postives = 135/277 (48.74%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----RKSTETRIQI--------------KYRSEPFKDISDTESE---------------------------IKEI-QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            E  I  IN + +  +         + LPQI VVG QSSGKSS+L+ I G   LPRG   VTR P+V+Q+     +KS   ++                K + E  K  ++ +SE                           +KE  + T  N+ I+  PI + I SP  +TLT++DLPGL K  V  Q  D+  +  ++   ++ + N++I+ V  AN D+  +  +K A E +P+ +R IGVLTK+D +D+   T + +I+  + +P+  GY  +I
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQG--TDVIDILAGRVIPLRYGYIPVI 277          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 107.457 bits (267), Expect = 3.772e-24
Identity = 77/253 (30.43%), Postives = 123/253 (48.62%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTE------------------TRIQ--------IKYRSEP-----------------FKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + L LP + VVG QSSGKSSIL+ + G   LPRG   VTR P+V+Q+   +                   T+I         ++YR +                  F D  D + EI+    +    +  I+K PI + + SP  + LT++DLPG+ K  +  Q  D+ ++   +  D++   N LI+ V PAN D+  + ++K A E +P   R IGV+TKLD +D     L  +I+  +  P++ G+ G++
Sbjct:   24 DTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL--DILSGKMYPLKLGFVGVV 274          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 106.301 bits (264), Expect = 1.123e-23
Identity = 63/211 (29.86%), Postives = 119/211 (56.40%), Query Frame = 2
Query: 1364 LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTET-RIQIKY---RSEPFKDISDTESEIKEIQTTAFNNE-ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            L LP I+V+G QSSGKSS+L++I G + LP+G N VTR P+ + +  +  +  +   +   R    KD  + +  + E+      +E ++++PI ++I+S     L+++DLPG ++ +   Q  ++  K  ++   ++   N +I+ +  A+ D+  ++ +K +   +P   R IGV+TKLD +D ++      I+ N+K P+  GY G+I
Sbjct:  208 LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDPEKAR---SILNNKKYPLSMGYVGVI 414          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 140.584 bits (353), Expect = 4.236e-35
Identity = 98/283 (34.63%), Postives = 152/283 (53.71%), Query Frame = 2
Query: 1364 LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEI--KEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNV-DNLLKI 2188
            + LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q++ S     +  + R++ F D  + + EI  +  + T  N  I+  PI + + SP  ++LT++DLPG+ K  V  Q  D+  +   +  +F+ +EN LI+ V PAN D+  +  +K A E +P  +R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +       E+K       +  + D  + G       L  +L   I  TLP LRS + DNLL +
Sbjct:   29 IDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEG--TDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMAD--KMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLAL 307          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 125.561 bits (314), Expect = 2.139e-29
Identity = 83/262 (31.68%), Postives = 141/262 (53.82%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM----RKSTETRIQI---------KYRSEP-------------FKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTN 2008
            I  I++++  F+   +E+++LPQI+VVG QSSGKSS+L+ + G   LPRG   VTR P+++Q+     ++ E +I            + +EP             F+D +    EI+    + T  N  I+ +PI + I SP+ + LT++DLPG+ K  V  Q  D+ ++   +   ++   NS+I+ V PAN D+ T+  +K A E +PD  R + V TKLD +D     +  +++  + +P++ G  G +VN   L + N
Sbjct:    5 IPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAM--DVLYGRVIPVKLGIIG-VVNRSQLDINN 263          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 92.0485 bits (227), Expect = 5.913e-19
Identity = 59/230 (25.65%), Postives = 119/230 (51.74%), Query Frame = 2
Query: 1325 EMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGV-NTVTRCPVVMQMRKSTETRIQIKYRSEPF-----KDISDT--ESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEV--TLIPEIIRNQKLPIEK-GYYGLI 1978
            ++ +++    N    LP+++VVGDQS+GK+S+L+ I+  ++ PRG    +TR PV++ + +      Q K  S  F     K++ D   E E++  ++      ++ + I+++++ P    + ++DLPG++     G A        +I+R +ME  N++I+C+     D   +      +  +P   R I VLTK+D  ++ E   + I +I+     P++  GY+ ++
Sbjct:   14 DLLAEYDVSYNTTDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQFKGNSRQFDLTQEKELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVV 243          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: mxb (interferon-induced GTP-binding protein Mx [Source:NCBI gene;Acc:101163162])

HSP 1 Score: 154.066 bits (388), Expect = 1.680e-38
Identity = 106/313 (33.87%), Postives = 174/313 (55.59%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYR--SEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXW-SLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSF 2212
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M+K T+ +    +I YR  +E  ++ ++ E  I + Q         I+ + I++ I SP    LT+IDLPG+ +  V+GQ  ++ E+  ++   F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +II N+ +P++KGY  +IV      +I K  +     + E+   +E   + +L       +    + L  EL   I K+LP L   ++  LK T  KLD+ 
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKKITKGQKWNGKIHYRDFAEEIQEPANVEQNICQAQDKMAGVGVGISDELISLEIASPNVPDLTLIDLPGITRVAVKGQPANIGEQIKKLIWKFIGKQETINLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIINNKAIPLKKGY--MIVRCRGQKEITKKVSLTTALEKERNFFQEHSHFQTLYYDGHASVPKLAEKLTLELVHHIQKSLPHLEEQIETKLKQTQSKLDNL 323          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: ENSORLT00000002352.2 (pep primary_assembly:ASM223467v1:4:3837959:3851307:-1 gene:ENSORLG00000001885.2 transcript:ENSORLT00000002352.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 6.156e-36
Identity = 80/213 (37.56%), Postives = 124/213 (58.22%), Query Frame = 2
Query: 1352 VNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++L+LPQ+ VVG QSSGKSS+L+ + G   LPRG   VTR P+++Q+  ST    +  + + + F D +    EI+    + T  N  I   PI + I SP  + LT++DLPG+ K  V  Q  D+  +  +I   ++  EN LI+ V+PAN D+  +  +K A + +P   R  GV+TKLD +DE   T   EI+ N+ LP+ +GY G++
Sbjct:   28 LGQSLQLPQVAVVGGQSSGKSSVLENLVGRDFLPRGSGIVTRTPLILQLLHSTAEYGEFSHCKGKKFTDFNQIRMEIEAETCRLTGSNKGICSAPIVLQIHSPHVLNLTLVDLPGMTKVPVEDQPADIEYQIRDIIMQYICNENCLILAVVPANTDLPNSDALKLAKDVDPQGLRTFGVITKLDLMDEG--TDAKEILENRFLPLRRGYVGVV 238          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 144.05 bits (362), Expect = 1.369e-34
Identity = 108/321 (33.64%), Postives = 166/321 (51.71%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  S TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    + +     E+K       +  L D  R G       L ++L   I  TLP LRS + + L     +++ +  ++  D  +K
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEI-EAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLAD--RMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 144.05 bits (362), Expect = 1.448e-34
Identity = 108/321 (33.64%), Postives = 166/321 (51.71%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQK 2245
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  S TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    + +     E+K       +  L D  R G       L ++L   I  TLP LRS + + L     +++ +  ++  D  +K
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEI-EAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLAD--RMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: dnm2b (dynamin-2 [Source:NCBI gene;Acc:101155909])

HSP 1 Score: 143.665 bits (361), Expect = 1.465e-34
Identity = 152/525 (28.95%), Postives = 243/525 (46.29%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKY-------RKE--NHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVL--VKDFEVKL--LP-LKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYF 2803
            E+ I  IN + +  S      N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +   F D  +   EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+ LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +       E+K       +     +R G  +    L  +L   I  TLP LRS + + L     +++ F  ++  D  +             KTK LL   +   FG D  KC       +D+            N+  G   K N +F E F     K        RKE    ++NI+   RT    ++     F+ IV++ ++K +E        C + I  +IQ+++  V+    KL   P L+++ ++I    ++E++ + ++ +  L   E +Y 
Sbjct:    7 EELIPLINKLQDAFSSIGQSCN--LDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNSKTEHAEFLHCKGRKFVDFEEVRMEI-EAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMLLQFITKESCLILAVTPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDIRAALAAERKFFLSHPAYR-HLAERMGTPHLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEFKNFRPDDPAR-------------KTKALLQMVQQ--FGVDFEKCIEGSGDQVDT-----------SNLSGG--AKINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGV-RTG---LFTPDLAFEAIVKKQIIKLKEP-------CLKCIDLVIQELINTVRQCTNKLGSYPRLREETERIVTTYIRERDSKTKDQVLLLIDIELSYI 486          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002025.1 (SMESG000002025.1)

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 626/649 (96.46%), Postives = 638/649 (98.31%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNXXXXXXXXXXXXXXYSKRLNDFDS 3223
            M ++KE+WIKKI+FIDEMRS+FS   NE LKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKS+ T+ QI+YRSEPFKDISDTESEI EIQ  AFNNE+TKDPITISIQSPESVTLTIIDLPGLVKADV+GQA+DMIEKTHEIARDFM QENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDIL+LTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNELERLRESRKSLKEYSKRLNDFDS
Sbjct:    1 MYLSKEEWIKKIDFIDEMRSRFSVAENEMLKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSSVTKTQIRYRSEPFKDISDTESEINEIQRNAFNNEVTKDPITISIQSPESVTLTIIDLPGLVKADVQGQASDMIEKTHEIARDFMMQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILELTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNELERLRESRKSLKEYSKRLNDFDS 649          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002025.1 (SMESG000002025.1)

HSP 1 Score: 1194.1 bits (3088), Expect = 0.000e+0
Identity = 625/657 (95.13%), Postives = 638/657 (97.11%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLE--------DIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNXXXXXXXXXXXXXXYSKRLNDFDS 3223
            M ++KE+WIKKI+FIDEMRS+FS   NE LKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKS+ T+ QI+YRSEPFKDISDTESEI EIQ  AFNNE+TKDPITISIQSPESVTLTIIDLPGLVKADV+GQA+DMIEKTHEIARDFM QENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDIL+LTNKDEIKKTEKKILKEKKLWSL+        DIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNELERLRESRKSLKEYSKRLNDFDS
Sbjct:    1 MYLSKEEWIKKIDFIDEMRSRFSVAENEMLKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSSVTKTQIRYRSEPFKDISDTESEINEIQRNAFNNEVTKDPITISIQSPESVTLTIIDLPGLVKADVQGQASDMIEKTHEIARDFMMQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILELTNKDEIKKTEKKILKEKKLWSLDMSTKKKSKDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNELERLRESRKSLKEYSKRLNDFDS 657          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002216.1 (SMESG000002216.1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 497/648 (76.70%), Postives = 553/648 (85.34%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQ-NLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNXXXXXXXXXXXXXXYSKRLNDF 3217
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVT+CPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDIL+LTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLP+LR NVD LL  TNGKL++FSKY G +E+QKK++SEKIK+IENKTK LLV GKHEI  Y   K +LEK  IL SI EHETF+Y+W  VF+ L+ +F  +++ELF D  GKY  + +LE+INKKNRTE+IP++ISS LFKKIV EALL F++K DECV +CC IISFII+++L+ D E KL PLK DIQKISRRVL EK++EIE YLTFLF+SE TYFTQ  +I+   V   Q  LV   NA                   S EN QT NG+ILK CL  YL NA+RKLGDVIP FIKQSLF+DFS SL  ALE E+LYS  SLSYF+LTD+++ E+ERLR+++  L+EYS +LND+
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTKCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILQLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYYSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDECVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQ-----------------STENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKVEIERLRQTKLMLEEYSSKLNDY 631          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002004.1 (SMESG000002004.1)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 495/648 (76.39%), Postives = 551/648 (85.03%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQ-NLVPTSNAGNKLFSNQQSNSILFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNXXXXXXXXXXXXXXYSKRLNDF 3217
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVT+CPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFT ALVDELGWLIDKTLP+LR NVD LL  TNGKL++FSKY G +E+QKK++SEKIK+IENKTK LLV GKHEI  Y   K +LEK  IL SI EHETF+Y+W  VF+ L+ +F  +++ELF D  GKY  + +LE+INKKNRTE+IP++ISS LFKKIV EALL F++K D+CV +CC IISFII+++L+ D E KL PLK DIQKISRRVL EK++EIE YLTFLF+SE TYFTQ  +I+   V   Q  LV   NA                     EN QT NG+ILK CL  YL NA+RKLGDVIP FIKQSLF+DFS SL  ALE E+LYS  SLSYF+LTD+++ E+ERLR+++  L+EYS +LND+
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTKCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTYALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQ-----------------PTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDY 631          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002011.1 (SMESG000002011.1)

HSP 1 Score: 861.292 bits (2224), Expect = 0.000e+0
Identity = 463/649 (71.34%), Postives = 540/649 (83.20%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSILFGTNISP--ENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNXXXXXXXXXXXXXXYSKRLNDF 3217
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEI++IQTTAFN+EITK+PITISIQSPESVTLTIIDLPGLVK +V+GQ+  +I+KTHEIARDFM+QENSLIICVLPANQDICTTTTI+EA +CNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPI+KGYYGLIV+D+IL+LTNKDEI + EK+ILKEKKLW+LEDI RFGLSNFTDALV+ELG LIDKTLP+LR NVD LLK  NGKL++FSKYQ   E Q+K++  KIK+IE+KTK+LLVKGKHEI  Y   K  LE   IL+SI+EHETF+Y+W  VF+ L+ +F  ++++ F +  GKY  + HL++INKKNRTE+IP++IS+ LFKKIV EA+ KF++K D+CVKLC  IISFII +VL+ D E KL PLK DIQKISR+VL EK++EIENYL FLFKSE TYFTQ T+IE    L      P  + G               TN  P  E+  T+N KILK  L  YL NAIRKLGDVIP FIKQSLF+DFS SL  ALE E+LYS KSLSYF+LT +++ E+ERLRE++  L+EYS +LND+
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIRKIQTTAFNDEITKEPITISIQSPESVTLTIIDLPGLVKTNVQGQSRHIIQKTHEIARDFMKQENSLIICVLPANQDICTTTTIREAIQCNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIKKGYYGLIVSDEILELTNKDEIARIEKRILKEKKLWTLEDIGRFGLSNFTDALVEELGSLIDKTLPILRGNVDKLLKEINGKLETFSKYQETQEGQQKYMRMKIKEIESKTKHLLVKGKHEIIKYKKVKDHLENKRILNSIQEHETFIYLWETVFSNLFKEFFRIYKDFFGEYSGKYHSDQHLDDINKKNRTENIPVFISTTLFKKIVNEAMDKFKDKVDKCVKLCYDIISFIIHEVLIMDIEAKLSPLKMDIQKISRKVLDEKKLEIENYLKFLFKSEHTYFTQATMIES---LLGHQFQPAFSPGT-------------PTNSVPEFEDLPTKNWKILKDSLKTYLINAIRKLGDVIPSFIKQSLFLDFSESLIEALETEILYSKKSLSYFSLTAQEKEEIERLRETKLKLEEYSSKLNDY 633          
The following BLAST results are available for this feature:
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MX24.336e-3636.89MX dynamin like GTPase 2 [Source:HGNC Symbol;Acc:H... [more]
DNM14.466e-3636.84dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM21.987e-3428.38dynamin 2 [Source:HGNC Symbol;Acc:HGNC:2974][more]
MX12.281e-3436.32MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
DNM22.377e-3428.38dynamin 2 [Source:HGNC Symbol;Acc:HGNC:2974][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-12.242e-3232.31Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-12.308e-3232.31Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-11.180e-2532.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-11.180e-2532.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-11.180e-2532.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi5.214e-3331.23gene:FBgn0003392 transcript:FBtr0333717[more]
shi6.131e-3331.23gene:FBgn0003392 transcript:FBtr0301595[more]
shi6.131e-3331.23gene:FBgn0003392 transcript:FBtr0301594[more]
shi6.131e-3331.23gene:FBgn0003392 transcript:FBtr0074123[more]
shi6.131e-3331.23gene:FBgn0003392 transcript:FBtr0074124[more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxg1.502e-3538.05myxovirus (influenza virus) resistance G [Source:Z... [more]
si:dkeyp-110c12.33.285e-3529.79si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126... [more]
si:dkeyp-110c12.34.259e-3528.82si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126... [more]
mxb4.839e-3535.74myxovirus (influenza) resistance B [Source:NCBI ge... [more]
mxa6.813e-3535.34myxovirus (influenza) resistance A [Source:NCBI ge... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnpepl17.286e-3935.53arginyl aminopeptidase (aminopeptidase B)-like 1 [... [more]
krt175.138e-3734.76keratin 17 [Source:Xenbase;Acc:XB-GENE-490369][more]
krt179.367e-3734.76keratin 17 [Source:Xenbase;Acc:XB-GENE-490369][more]
ei246.795e-3332.50etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei247.430e-3332.50etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mx13.450e-3736.05MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MG... [more]
Dnm29.525e-3528.63dynamin 2 [Source:MGI Symbol;Acc:MGI:109547][more]
Dnm21.033e-3428.63dynamin 2 [Source:MGI Symbol;Acc:MGI:109547][more]
Mx13.100e-3436.05MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MG... [more]
Dnm14.712e-3433.33dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91192|MX1_ONCMY7.391e-4129.98Interferon-induced GTP-binding protein Mx1 OS=Onco... [more]
sp|Q6PW23|MX_EPICO1.869e-4028.97Interferon-induced GTP-binding protein Mx OS=Epine... [more]
sp|P20593|MX_PERFL2.634e-4036.48Interferon-induced GTP-binding protein Mx (Fragmen... [more]
sp|Q91196|MX2_ONCMY4.759e-4034.59Interferon-induced GTP-binding protein Mx2 OS=Onco... [more]
sp|Q9N0Y3|MX1_CANLF1.196e-3927.66Interferon-induced GTP-binding protein Mx1 OS=Cani... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4BIL41.368e-4326.90Uncharacterized protein OS=Marmota monax OX=9995 G... [more]
A0A3P9DLA04.165e-4326.79Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A5C6N2S22.777e-4226.48Mx Interferon-inducible OS=Takifugu flavidus OX=43... [more]
A0A437DD339.459e-4227.42Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
I3MJX61.294e-4127.24MX dynamin like GTPase 1 OS=Ictidomys tridecemline... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxa3.250e-4328.05interferon-induced GTP-binding protein Mx1-like [S... [more]
mxa3.250e-4328.05interferon-induced GTP-binding protein Mx1-like [S... [more]
ENSAMXT00000057014.14.538e-4139.38pep primary_assembly:Astyanax_mexicanus-2.0:12:195... [more]
ENSAMXT00000030993.16.919e-4139.38pep primary_assembly:Astyanax_mexicanus-2.0:12:196... [more]
ENSAMXT00000016255.21.484e-4039.82pep primary_assembly:Astyanax_mexicanus-2.0:12:196... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxb8.783e-3434.50myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000002816.11.183e-2630.47pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000006976.14.387e-2536.81pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
opa11.708e-1827.19OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
opa11.861e-1827.19OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS18.747e-2730.69Dynamin-like GTPase required for vacuolar sorting;... [more]
DNM13.772e-2430.43Dynamin-related GTPase involved in mitochondrial o... [more]
MGM11.123e-2329.86Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO321914.236e-3534.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348952.139e-2931.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403595.913e-1925.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxb1.680e-3833.87interferon-induced GTP-binding protein Mx [Source:... [more]
ENSORLT00000002352.26.156e-3637.56pep primary_assembly:ASM223467v1:4:3837959:3851307... [more]
dnm1a1.369e-3433.64dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a1.448e-3433.64dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm2b1.465e-3428.95dynamin-2 [Source:NCBI gene;Acc:101155909][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002025.10.000e+096.46SMESG000002025.1[more]
SMESG000002025.10.000e+095.13SMESG000002025.1[more]
SMESG000002216.10.000e+076.70SMESG000002216.1[more]
SMESG000002004.10.000e+076.39SMESG000002004.1[more]
SMESG000002011.10.000e+071.34SMESG000002011.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027887 ID=SMED30027887|Name=Interferon-induced GTP-binding protein Mx1|organism=Schmidtea mediterranea sexual|type=transcript|length=3317bp
ATTTTTTTAAAAGTTTTAAAATAAATGATTTACCCTAAATGTAAATTAAA
ATTTATTGACTCATATTTTTATTACACTTGATTTTTATTTCTTTCGATGA
TGTCATTAAAAACTTACTTAGAAATATTTAAAATATTTTTTTTTTTCGAT
AACTTTATGTTCAAATCAATCAATCAATCGAACTGACAAGTTTCCAATTT
ACTCTAATTCTTCATTTAACATCCTATTTAAACCAGTAAAAACATATTCA
CCGTTTTCGTTGATAAAATTGCAAATCGTTTGTCAATTCGAAATCGAAGA
AACCGTTTTTATTAATCCTGGAATTGAGAACAATTTGAAAAATAAAATCA
GCAACAAATATATGTCAGTAATCAATTGGCATAAGAACACGTACAGAGCA
ATCGAAATGATAATTCAATTTCATCCTTCAGCAAACAGATTGATTTTTGA
AATTTTATATTATAACGGAACTGGCAATCGATATAATGCTTTCAGGAATC
GTTCAGTTATGAATCGGATTTTCTCCGAACAAATTCAACTGAACATCGAT
GCGATTTTGGATTTTTATATCGCCACGCGAGATGGCCGAACCGATGGAGT
GAACAGCGAGGAAATGGCCGTAATATCGTGCGAATCCAAGAACGGAGTTC
CTCCAGGCCGGCCGATATTGAAATATATCGATCAGTTGGATGTGAAAAAC
CGGAAATTTCACGAGGCCGACAACAGAATCGTTGTCCATGCGTTCCTGAG
GAAATCCGACCACAATAAATACGTGAAATGCATGTCGACCGGCGTCACCG
AATATCGCTACATAAAGATCTTTCACCACCCGACAGCGCTCCAGTTACGG
CCCAATTATGCCGGAACCATGCCGAATGGATCCTCGGTCCTATGCACAGC
TGCTGATGGCTACCCGCCACCGACAATCAACTGGGAGTTCATCAGTGGAC
CTCCCAATGCCTCACAGTTCTACTCGATCACTGCCGGCAACAATCTGACC
ATCCTTCCGCATTGCCCGCTTCATACTCAATGGACGTTCAATTGCACCGC
CTTGAACAGCATTCCTAAATCCTATGACCTCGGCACGACTCGCTCCTTCA
CTTTCACTGTTTCCCAGGATATGAACGTGATTTCTTTTCTTTTCTCCGGA
ATCGTAATCAAATGTTTTGCTAGCTTTTTTGGTTTGCTCATCATTATATG
CATTGCAATGAAAAGGAAATCTGGTATCAAGGGTGAATTGAAGTTTTCGA
GTACATTGAGCCAATCTAAGAAACGAATGACTGTAGCGAAAGAAAAATGG
ATCAAAAAAATAAATTTCATTGACGAAATGAGATCAAAGTTTTCAGCCGA
CGTTAATGAAGCTCTGAAGCTTCCACAAATAATTGTCGTAGGAGACCAAA
GCTCGGGCAAAAGCTCAATTTTGCAAGCGATCTCCGGGATAAAGTTACCG
AGAGGAGTAAATACCGTCACAAGGTGCCCAGTCGTAATGCAAATGCGCAA
ATCAACTGAAACAAGAATCCAAATCAAATACAGATCGGAGCCATTTAAAG
ATATTTCTGACACTGAAAGCGAAATAAAGGAAATACAAACGACTGCTTTC
AATAATGAAATAACAAAGGACCCGATTACAATCAGCATTCAGTCCCCTGA
ATCTGTGACATTGACAATCATTGACTTGCCTGGCTTGGTCAAGGCAGATG
TTCGAGGACAAGCAACAGACATGATAGAGAAAACACATGAAATAGCAAGG
GACTTCATGGAGCAAGAGAACTCATTAATAATTTGCGTGCTGCCAGCAAA
TCAGGACATCTGTACAACGACAACTATTAAGGAGGCAACTGAATGCAATC
CGGACAAATCAAGAATAATCGGAGTGCTTACAAAACTGGACAAACTCGAC
GAGAAGGAAGTGACACTCATCCCAGAGATCATCAGGAATCAAAAGTTGCC
AATAGAGAAAGGATATTACGGTTTAATTGTCAATGATGACATTTTGAAAC
TTACTAATAAAGATGAAATAAAAAAAACGGAAAAGAAAATTTTAAAAGAA
AAAAAGTTATGGAGTCTTGAGGACATCAAACGTTTTGGACTCTCGAATTT
CACTGATGCACTTGTTGACGAGTTGGGCTGGTTGATAGATAAAACTTTGC
CAGTTCTGAGGAGTAATGTTGATAACTTACTCAAGATAACTAATGGGAAA
TTGGACTCATTCTCAAAATACCAGGGGGGTGACGAAGTTCAAAAGAAATT
TATAAGCGAAAAAATTAAAGATATCGAAAATAAAACTAAAAATCTACTTG
TAAAAGGAAAACATGAAATTTTTGGATATGATAATTTTAAATGTTTTTTG
GAAAAAAATGGAATTTTAGATTCTATCAAAGAACATGAAACATTTCTGTA
CATGTGGCACAATGTTTTCAATGGACTGTATGGGAAATTTAATTGTGTAT
TTGAAGAGCTTTTCAATGATGGTTATGGAAAATATCGGAAAGAAAACCAT
CTTGAAAATATAAACAAGAAAAATAGAACTGAAGATATTCCAATCTACAT
CAGTTCGAGGCTATTTAAAAAGATTGTCGAAGAGGCTTTACTAAAATTTA
GAGAAAAAACTGACGAGTGCGTCAAGCTTTGTTGTAGAATTATATCGTTC
ATCATCCAAGACGTCCTTGTCAAGGACTTTGAAGTTAAACTTTTACCTCT
TAAAAAAGATATTCAAAAAATCAGTCGCAGGGTACTCAAGGAAAAGGAAG
TGGAAATCGAAAATTATTTAACATTTCTATTCAAAAGCGAGCGCACGTAT
TTCACCCAGGACACCATAATCGAAGGTCAAGCCGTTCTTACTGCACAAAA
TTTGGTACCGACATCAAATGCTGGAAATAAATTATTTTCAAACCAACAAT
CAAATTCGATTTTATTTGGTACAAATATTTCTCCTGAAAATTTTCAAACA
GAGAATGGAAAAATATTAAAACATTGTTTGACAAAGTATTTAAAAAATGC
TATCCGGAAATTAGGAGACGTAATTCCCTGTTTTATCAAGCAAAGTTTAT
TTGTTGATTTCAGTGCGTCCTTGACAGCTGCTCTGGAAATGGAAGTTTTA
TACTCGAATAAGTCTCTGTCGTACTTTGCTTTAACTGATGAAGACAGAAA
TGAACTAGAGAGATTGCGCGAGTCTAGAAAAAGTTTGAAAGAATATAGCA
AAAGGTTAAATGATTTTGACAGTTGATTAATTTTTGATAATTATTTTGAA
ATGTCATATATTTTTTAGTTCTAATTATGTTGTTTTGTTTTAATTTTTTG
AGCTTTTGATTACCACA
back to top

protein sequence of SMED30027887-orf-1

>SMED30027887-orf-1 ID=SMED30027887-orf-1|Name=SMED30027887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=955bp
MSVINWHKNTYRAIEMIIQFHPSANRLIFEILYYNGTGNRYNAFRNRSVM
NRIFSEQIQLNIDAILDFYIATRDGRTDGVNSEEMAVISCESKNGVPPGR
PILKYIDQLDVKNRKFHEADNRIVVHAFLRKSDHNKYVKCMSTGVTEYRY
IKIFHHPTALQLRPNYAGTMPNGSSVLCTAADGYPPPTINWEFISGPPNA
SQFYSITAGNNLTILPHCPLHTQWTFNCTALNSIPKSYDLGTTRSFTFTV
SQDMNVISFLFSGIVIKCFASFFGLLIIICIAMKRKSGIKGELKFSSTLS
QSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGK
SSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISD
TESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQ
ATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKS
RIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNK
DEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLR
SNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGK
HEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEEL
FNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKT
DECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIE
NYLTFLFKSERTYFTQDTIIEGQAVLTAQNLVPTSNAGNKLFSNQQSNSI
LFGTNISPENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDF
SASLTAALEMEVLYSNKSLSYFALTDEDRNELERLRESRKSLKEYSKRLN
DFDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR001401Dynamin_GTPase
IPR000375Dynamin_central
IPR027417P-loop_NTPase
IPR030381G_DYNAMIN_dom
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0005515protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0045087innate immune response
GO:0051607defense response to virus
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0048471perinuclear region of cytoplasm