RIBOSOMAL_L9 domain-containing protein

Overview
NameRIBOSOMAL_L9 domain-containing protein
Smed IDSMED30027861
Length (bp)848
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RIBOSOMAL_L9 domain-containing protein (SMED30027861) t-SNE clustered cells

Violin plots show distribution of expression levels for RIBOSOMAL_L9 domain-containing protein (SMED30027861) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RIBOSOMAL_L9 domain-containing protein (SMED30027861) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RIBOSOMAL_L9 domain-containing protein (SMED30027861) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027861

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027861h1SMcG0009994 SmedASXL_008054SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Fly
Match: mRpL9 (gene:FBgn0038319 transcript:FBtr0083084)

HSP 1 Score: 50.8322 bits (120), Expect = 3.696e-7
Identity = 41/150 (27.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 IKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLN--VLPPVDKPILVGDSYLTFRK---LENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFP---ESFEVLINIDNIEKAVVTCKMFFY 664
            I+V+LK  + G+G K  VV +     Y  L    LA   TPE +        +K  +   S    R    LE ++L++ +N +  WVL    +K + RK G   ++E  I LP++ I   D     + F   + I+ +E+A + C++  +
Sbjct:   68 IEVVLKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKSTVKHSSPYAQRTVNMLETIVLAVVMNKDEPWVLEPWHIKASLRKTGFYCREEC-ITLPKERIEGPDLKKENKDFYCTVTINKLEQARLKCRLHHW 216          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VF89|RM09_DROME (39S ribosomal protein L9, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mRpL9 PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.705e-6
Identity = 41/150 (27.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 IKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLN--VLPPVDKPILVGDSYLTFRK---LENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFP---ESFEVLINIDNIEKAVVTCKMFFY 664
            I+V+LK  + G+G K  VV +     Y  L    LA   TPE +        +K  +   S    R    LE ++L++ +N +  WVL    +K + RK G   ++E  I LP++ I   D     + F   + I+ +E+A + C++  +
Sbjct:   68 IEVVLKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKSTVKHSSPYAQRTVNMLETIVLAVVMNKDEPWVLEPWHIKASLRKTGFYCREEC-ITLPKERIEGPDLKKENKDFYCTVTINKLEQARLKCRLHHW 216          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. TrEMBL
Match: A0A4S2M5Y9 (RIBOSOMAL_L9 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003480 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.805e-38
Identity = 76/229 (33.19%), Postives = 131/229 (57.21%), Query Frame = 2
Query:  101 VLQRKFPCK-PSVEWHKGKYPELEVKYNTWNLLSDISSNKLYTISV------LIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDK----PILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKE 754
            +L RK P + PS EW  G  P+L+V+             ++Y ++V       ++V+L  ++PGLG    VV++H+ RF+RYL+PL+LAE+ T +++N    + K    P L GD+Y + ++L N+ L IP+N   +W LN K VK+AFR++G ++ DE  I LP Q+++       F + + ID++    V+C++F Y+K++  T T P     + + + +W +   E
Sbjct:   24 ILTRKHPIEAPSREWDAGLIPKLKVE------------QQIYEVTVKDEVDHTLEVLLTADVPGLGTTGTVVKIHRNRFWRYLYPLQLAELPTEDRVNYFRSLSKKSGRPTLCGDAYESEQRLRNMTLYIPMNPAIDWQLNPKHVKIAFRRYGFVV-DEESITLPSQSVTRNSSSSPFTISVKIDHVVDVPVSCRIFLYQKLDNFTCTQPPTDVFKPIHLDDWMNDFPE 239          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. TrEMBL
Match: G7YWA7 (Putative methyltransferase NSUN4 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_112370 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.021e-35
Identity = 74/209 (35.41%), Postives = 122/209 (58.37%), Query Frame = 2
Query:  104 LQRKFPCK-PSVEWHKGKYPELEVKYNTWNLLSDISSNKLYTISV------LIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDK----PILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHP 697
            L RK P + PS EW  G  P+L+V+             ++Y ++V       ++V+L  ++PGLG    VV++H+ RF+RYL+PL+LAE+ T +++     + K    PIL GD+Y + ++L N+ L IP+N   +W LN K VK+AFR++G ++ DE  I LP Q ++       F + + ID++    V+C++F Y+K++  T T P
Sbjct:  787 LTRKHPIEAPSREWDAGIIPKLKVE------------QQIYEVTVKDEVDHTLEVLLTSDVPGLGTTGTVVKIHRNRFWRYLYPLQLAELPTKDRVKYFRSLSKNSGRPILCGDAYESEQRLRNMTLYIPMNPAVDWQLNPKHVKIAFRRYGFVV-DEESITLPSQPVTRNSSASPFTISVKIDHVVDVPVSCRIFLYQKLDNFTCTQP 982          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. TrEMBL
Match: A0A095A1X0 (39S ribosomal protein L9, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_07928 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.276e-34
Identity = 83/230 (36.09%), Postives = 132/230 (57.39%), Query Frame = 2
Query:  104 LQRKFPCK-PSVEWHKGKYPEL---EVKYNTWNLLSDISSNKLYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNV--LPPVDKP-ILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVS 772
            L +K+P K PS+   +G  P+L   ++ Y   N+ ++ SS         I V+L  N+PGLG+   V  VH+ +F+RYL+   LAE+ T E++N   L    +P +L G+SY+  ++L N+ L IP+N + EW LNK  VKVA R++G  IK E+ I LP++ I+ K+   SF++ + ID+I   VV C +F Y+K++    T P      ++ I +W +   E  + VS
Sbjct:   23 LTKKYPRKVPSILLAEGILPKLTADDIVYEEVNIETNESS--------CINVLLTHNVPGLGSVGTVTPVHRNKFWRYLYIKGLAELPTEERINEMKLKQTGRPTVLCGESYVLQQRLSNMTLYIPMNPSREWTLNKTHVKVALRRYGFAIK-EHYITLPKEEITSKNSTSSFKISVYIDDIVNVVVPCSIFLYQKLDKGMCTQPPTNVFRKIKIEDWTADFSETDILVS 243          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. TrEMBL
Match: A0A3R7GR98 (5-methylcytosine rRNA methyltransferase NSUN4 (Fragment) OS=Clonorchis sinensis OX=79923 GN=NSUN4 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.690e-34
Identity = 74/210 (35.24%), Postives = 122/210 (58.10%), Query Frame = 2
Query:  101 VLQRKFPCK-PSVEWHKGKYPELEVKYNTWNLLSDISSNKLYTISV------LIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDK----PILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHP 697
             L RK P + PS EW  G  P+L+V+             ++Y ++V       ++V+L  ++PGLG    VV++H+ RF+RYL+PL+LAE+ T +++     + K    PIL GD+Y + ++L N+ L IP+N   +W LN K VK+AFR++G ++ DE  I LP Q ++       F + + ID++    V+C++F Y+K++  T T P
Sbjct:    4 TLTRKHPIEAPSREWDAGIIPKLKVE------------QQIYEVTVKDEVDHTLEVLLTSDVPGLGTTGTVVKIHRNRFWRYLYPLQLAELPTKDRVKYFRSLSKNSGRPILCGDAYESEQRLRNMTLYIPMNPAVDWQLNPKHVKIAFRRYGFVV-DEESITLPSQPVTRNSSASPFTISVKIDHVVDVPVSCRIFLYQKLDNFTCTQP 200          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. TrEMBL
Match: A0A183LWC2 (RIBOSOMAL_L9 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS8097 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 5.822e-34
Identity = 82/227 (36.12%), Postives = 133/227 (58.59%), Query Frame = 2
Query:  104 LQRKFPCK-PSVEWHKGKYPELEVKYNTWNLLSDISSNKLYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPP--VDKP-ILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVS 772
            L +K+P K PS+   +G  P+L      +  + +I SN+    S  I V+L +N+PGLG+   V  VH+ +F++YL+   LAE+ T E++N +      KP +L G+SY+  ++L N+ L IP+N + EW LNK  VKVA R++G  IK E+ I LP++ I+ K+   SF++ +NID+I   VV C +F Y+K++    T P      ++ I +W +   +  + VS
Sbjct:   23 LTKKYPRKVPSILLAEGILPKLTADDLVYQEV-NIESNE----SPCINVLLTDNVPGLGSVGTVTPVHRNKFWKYLYIKGLAELPTEERINEMKSKQTGKPTVLCGESYVLQQRLSNMTLYIPMNPSREWTLNKTHVKVALRRYGFAIK-EHYITLPKEEITSKNSTSSFKISVNIDDIINVVVPCSIFLYQKLDKGMCTQPPTNVFRKIKIEDWTADFSKTDILVS 243          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Planmine SMEST
Match: SMESG000055928.1 (SMESG000055928.1)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 261/263 (99.24%), Postives = 262/263 (99.62%), Query Frame = 2
Query:    2 MNSKKILSHINRLFSSQSKVKNKKIIGMFVPGNVLQRKFPCKPSVEWHKGKYPELEVKYNTWNLLSDISSNKLYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVSYNVDVS 790
            MNSKKILSHINRLFSSQSKVKNKKIIGMFVPGNVLQRKFPCKPSVEWHKGKYPELEVKYNTWNLLSDISSN LYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLT+RKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVSYNVDVS
Sbjct:    1 MNSKKILSHINRLFSSQSKVKNKKIIGMFVPGNVLQRKFPCKPSVEWHKGKYPELEVKYNTWNLLSDISSNNLYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLTYRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVSYNVDVS 263          
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Planmine SMEST
Match: SMESG000055928.1 (SMESG000055928.1)

HSP 1 Score: 473.781 bits (1218), Expect = 2.479e-171
Identity = 234/236 (99.15%), Postives = 235/236 (99.58%), Query Frame = 2
Query:   83 MFVPGNVLQRKFPCKPSVEWHKGKYPELEVKYNTWNLLSDISSNKLYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLTFRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVSYNVDVS 790
            MFVPGNVLQRKFPCKPSVEWHKGKYPELEVKYNTWNLLSDISSN LYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLT+RKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVSYNVDVS
Sbjct:    1 MFVPGNVLQRKFPCKPSVEWHKGKYPELEVKYNTWNLLSDISSNNLYTISVLIKVILKENIPGLGAKNAVVEVHKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLTYRKLENVILSIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESFEVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLKEIPVKVSYNVDVS 236          
The following BLAST results are available for this feature:
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpL93.696e-727.33gene:FBgn0038319 transcript:FBtr0083084[more]
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9VF89|RM09_DROME3.705e-627.3339S ribosomal protein L9, mitochondrial OS=Drosoph... [more]
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M5Y95.805e-3833.19RIBOSOMAL_L9 domain-containing protein OS=Opisthor... [more]
G7YWA73.021e-3535.41Putative methyltransferase NSUN4 (Fragment) OS=Clo... [more]
A0A095A1X04.276e-3436.0939S ribosomal protein L9, mitochondrial OS=Schisto... [more]
A0A3R7GR984.690e-3435.245-methylcytosine rRNA methyltransferase NSUN4 (Fra... [more]
A0A183LWC25.822e-3436.12RIBOSOMAL_L9 domain-containing protein OS=Schistos... [more]
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIBOSOMAL_L9 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055928.10.000e+099.24SMESG000055928.1[more]
SMESG000055928.12.479e-17199.15SMESG000055928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027861 ID=SMED30027861|Name=RIBOSOMAL_L9 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=848bp
CATGAATTCGAAAAAAATTTTATCTCATATTAATAGATTATTTTCTAGTC
AATCTAAAGTTAAAAATAAAAAAATAATAGGCATGTTTGTTCCTGGAAAT
GTTTTGCAACGCAAATTTCCTTGTAAGCCATCTGTGGAATGGCATAAAGG
CAAATATCCAGAATTGGAAGTTAAATATAACACATGGAATCTTTTATCAG
ATATTTCCTCAAACAAACTCTACACAATTTCTGTGCTAATTAAAGTAATT
TTGAAAGAGAATATACCAGGTCTTGGCGCCAAAAATGCTGTTGTCGAAGT
TCATAAAACAAGATTTTATAGATATTTGTTTCCATTAAAGTTAGCAGAAA
TGGCGACTCCTGAAAAATTAAATGTTTTACCTCCCGTTGATAAACCAATT
CTTGTTGGAGATTCTTATCTAACTTTCAGAAAGTTAGAGAACGTTATTTT
GAGTATTCCCGTCAATTATAATTACGAATGGGTTTTGAATAAGAAAATGG
TTAAAGTTGCATTTAGAAAATTTGGAATTATTATTAAAGACGAAAATCAA
ATTGAGTTACCTCAGCAAACGATCTCCTACAAAGATTTTCCAGAATCATT
TGAGGTTTTAATAAATATTGATAATATTGAGAAAGCAGTGGTAACCTGCA
AAATGTTCTTTTACGAGAAGATAAATCCAACCACAGTGACACATCCGAAA
TTGACTTTCAAAGAAGAATTAATAATTACAAATTGGTGCTCTTTGTTAAA
AGAAATTCCAGTTAAAGTTAGTTATAATGTAGACGTGTCAAAACTTAAAC
AAAAACTTTAATTGTTTTAAAAATAAATTGTTATAAATTCCAAAACAA
back to top

protein sequence of SMED30027861-orf-1

>SMED30027861-orf-1 ID=SMED30027861-orf-1|Name=SMED30027861-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=270bp
MNSKKILSHINRLFSSQSKVKNKKIIGMFVPGNVLQRKFPCKPSVEWHKG
KYPELEVKYNTWNLLSDISSNKLYTISVLIKVILKENIPGLGAKNAVVEV
HKTRFYRYLFPLKLAEMATPEKLNVLPPVDKPILVGDSYLTFRKLENVIL
SIPVNYNYEWVLNKKMVKVAFRKFGIIIKDENQIELPQQTISYKDFPESF
EVLINIDNIEKAVVTCKMFFYEKINPTTVTHPKLTFKEELIITNWCSLLK
EIPVKVSYNVDVSKLKQKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036935Ribosomal_L9_N_sf
IPR020070Ribosomal_L9_N
IPR009027Ribosomal_L9/RNase_H1_N
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036935Ribosomal protein L9, N-terminal domain superfamilyGENE3DG3DSA:3.40.5.10coord: 80..129
e-value: 2.7E-9
score: 38.4
IPR020070Ribosomal protein L9, N-terminalPFAMPF01281Ribosomal_L9_Ncoord: 80..124
e-value: 2.8E-13
score: 49.2
IPR009027Ribosomal protein L9/RNase H1, N-terminalSUPERFAMILYSSF55658L9 N-domain-likecoord: 80..127