Zinc finger protein

Overview
NameZinc finger protein
Smed IDSMED30027858
Length (bp)4784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein (SMED30027858) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein (SMED30027858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein (SMED30027858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein (SMED30027858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027858SMESG000060422.1 SmedASXL_017142SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30027858SMESG000060422.1 dd_Smed_v4_14937_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027858SMESG000060422.1 dd_Smed_v4_14937_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027858SMESG000060422.1 dd_Smed_v4_14937_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027858SMESG000060422.1 dd_Smed_v6_15232_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027858SMESG000060422.1 dd_Smed_v6_14315_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027858SMESG000060422.1 dd_Smed_v6_14937_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027858SMESG000060422.1 OX_Smed_1.0.04671ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027858SMESG000060422.1 OX_Smed_1.0.13377ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF816 (zinc finger protein 816 [Source:HGNC Symbol;Acc:HGNC:26995])

HSP 1 Score: 107.842 bits (268), Expect = 4.451e-23
Identity = 82/246 (33.33%), Postives = 122/246 (49.59%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + ++CN C K ++ +SSL+ H   H      K +     Y  +   +L +H  I+  E +     +C +CD++F S+  L +H R+HT +  Y+C +C +    K  L+YH  +H  EKPY C  + C + F   + L  H    H+L   +     + C  VF R+SHL+RH  +H GEK Y C    C+++FR+   L  H   HTGEKP+KC  C     QK  L  H R
Sbjct:  354 SALVIHKAIHTGEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRR--SHLERHRKIHTGEGSY----KCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTC--NECGKVFSRRENLARH----HRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKC--KVCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQR 585          

HSP 2 Score: 91.6633 bits (226), Expect = 5.588e-18
Identity = 73/253 (28.85%), Postives = 115/253 (45.45%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+    +  L  H   H   + ++CN C K ++ +SSLR H + H      K      ++       + K +H            +C+ C + F+ +  L+ H  +HT +  Y+C++C      +  L  H  +H  E  Y C +  CD+ FR+  YL  H+      +P K     + C   F RKS L+ H  +H GEK Y C+  +C + F  +E L  H   H GEKP+KCE CD    +++ L  H R
Sbjct:  291 GKTFTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPY------KCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKCKV--CDKVFRSDSYLAEHQRVHTGEKPYK----CNKCGRSFSRKSSLQYHHTLHTGEKPYTCN--ECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRR 529          

HSP 3 Score: 91.2781 bits (225), Expect = 7.491e-18
Identity = 72/242 (29.75%), Postives = 117/242 (48.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H I+H   ++++C+ C K +  +  +  H + H      K      +++     +L+ H  ++  E    +  +C+ C + F+ +  L+ H R+HT +  Y+C +C K       L  H  +H  EKPY C  + C + F     L+ H    H L   +     + C  V+ R+SHL+RH  +H GE +Y C    C++ FR+   L  H   HTGEKP+KC  C  S  +K+SL YH
Sbjct:  244 LRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQ--MSSLVCHRRLHTGE----KPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPYKC--NECGKTFSQKSSLQCH----HILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKC--KVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYH 471          

HSP 4 Score: 80.8777 bits (198), Expect = 1.118e-14
Identity = 72/242 (29.75%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H   H     ++C  C+K + + S L  H + H      K      S+S   +K+ L++ H  H          C+ C ++F+    L  H R+H  +  Y+C++C K    +  L  H  +H  EKPY C +  CD+AFR+   L NH       +P K     + C  VF +K  L +H  +H GEK Y C+  +C + F  + +L  H   HT EKP+KC  C  +   +++L +H
Sbjct:  412 LERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFS---RKSSLQYHHTLHTGEKPYT---CNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLANHTRVHTGEKPYK----CNKCAKVFNQKGILAQHQRVHTGEKPYKCN--ECGKVFNQKASLAKHQRVHTAEKPYKCNECGKAFTGQSTLIHH 639          

HSP 5 Score: 75.0998 bits (183), Expect = 7.850e-13
Identity = 56/185 (30.27%), Postives = 81/185 (43.78%), Query Frame = 2
Query: 1292 NLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +LL+  HI H+   +    +CD+C ++F  +  +  H R HT + TY+C +C K       L  H  +H  EKPY C+                                   C   F  KS L+ H  +H GEK Y C+  +C ++F     L +H   HTGEKP+KC  C  +  QK+SL  H
Sbjct:  242 SLLRRHHITHSREREY---KCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSLVCHRRLHTGEKPYKCN----------------------------------ECGKTFSEKSSLRCHRRLHTGEKPYKCN--ECGKTFGRNSALVIHKAIHTGEKPYKCNECGKTFSQKSSLQCH 387          

HSP 6 Score: 61.2326 bits (147), Expect = 1.316e-8
Identity = 39/116 (33.62%), Postives = 57/116 (49.14%), Query Frame = 2
Query: 1505 EKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            EKP  C  + C +AF     L+ H    H    ++     D C  +F +K ++  H   H GEK Y C+  +C ++F    +L  H   HTGEKP+KC  C  +  +K+SL  H R
Sbjct:  226 EKP--CQSNECGKAFNYSSLLRRH----HITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCN--ECGKTFTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRR 333          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF816 (zinc finger protein 816 [Source:HGNC Symbol;Acc:HGNC:26995])

HSP 1 Score: 107.842 bits (268), Expect = 4.451e-23
Identity = 82/246 (33.33%), Postives = 122/246 (49.59%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + ++CN C K ++ +SSL+ H   H      K +     Y  +   +L +H  I+  E +     +C +CD++F S+  L +H R+HT +  Y+C +C +    K  L+YH  +H  EKPY C  + C + F   + L  H    H+L   +     + C  VF R+SHL+RH  +H GEK Y C    C+++FR+   L  H   HTGEKP+KC  C     QK  L  H R
Sbjct:  354 SALVIHKAIHTGEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRR--SHLERHRKIHTGEGSY----KCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTC--NECGKVFSRRENLARH----HRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKC--KVCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQR 585          

HSP 2 Score: 91.6633 bits (226), Expect = 5.588e-18
Identity = 73/253 (28.85%), Postives = 115/253 (45.45%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+    +  L  H   H   + ++CN C K ++ +SSLR H + H      K      ++       + K +H            +C+ C + F+ +  L+ H  +HT +  Y+C++C      +  L  H  +H  E  Y C +  CD+ FR+  YL  H+      +P K     + C   F RKS L+ H  +H GEK Y C+  +C + F  +E L  H   H GEKP+KCE CD    +++ L  H R
Sbjct:  291 GKTFTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPY------KCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKCKV--CDKVFRSDSYLAEHQRVHTGEKPYK----CNKCGRSFSRKSSLQYHHTLHTGEKPYTCN--ECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRR 529          

HSP 3 Score: 91.2781 bits (225), Expect = 7.491e-18
Identity = 72/242 (29.75%), Postives = 117/242 (48.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H I+H   ++++C+ C K +  +  +  H + H      K      +++     +L+ H  ++  E    +  +C+ C + F+ +  L+ H R+HT +  Y+C +C K       L  H  +H  EKPY C  + C + F     L+ H    H L   +     + C  V+ R+SHL+RH  +H GE +Y C    C++ FR+   L  H   HTGEKP+KC  C  S  +K+SL YH
Sbjct:  244 LRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQ--MSSLVCHRRLHTGE----KPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPYKC--NECGKTFSQKSSLQCH----HILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKC--KVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYH 471          

HSP 4 Score: 80.8777 bits (198), Expect = 1.118e-14
Identity = 72/242 (29.75%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H   H     ++C  C+K + + S L  H + H      K      S+S   +K+ L++ H  H          C+ C ++F+    L  H R+H  +  Y+C++C K    +  L  H  +H  EKPY C +  CD+AFR+   L NH       +P K     + C  VF +K  L +H  +H GEK Y C+  +C + F  + +L  H   HT EKP+KC  C  +   +++L +H
Sbjct:  412 LERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFS---RKSSLQYHHTLHTGEKPYT---CNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLANHTRVHTGEKPYK----CNKCAKVFNQKGILAQHQRVHTGEKPYKCN--ECGKVFNQKASLAKHQRVHTAEKPYKCNECGKAFTGQSTLIHH 639          

HSP 5 Score: 75.0998 bits (183), Expect = 7.850e-13
Identity = 56/185 (30.27%), Postives = 81/185 (43.78%), Query Frame = 2
Query: 1292 NLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +LL+  HI H+   +    +CD+C ++F  +  +  H R HT + TY+C +C K       L  H  +H  EKPY C+                                   C   F  KS L+ H  +H GEK Y C+  +C ++F     L +H   HTGEKP+KC  C  +  QK+SL  H
Sbjct:  242 SLLRRHHITHSREREY---KCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSLVCHRRLHTGEKPYKCN----------------------------------ECGKTFSEKSSLRCHRRLHTGEKPYKCN--ECGKTFGRNSALVIHKAIHTGEKPYKCNECGKTFSQKSSLQCH 387          

HSP 6 Score: 61.2326 bits (147), Expect = 1.316e-8
Identity = 39/116 (33.62%), Postives = 57/116 (49.14%), Query Frame = 2
Query: 1505 EKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            EKP  C  + C +AF     L+ H    H    ++     D C  +F +K ++  H   H GEK Y C+  +C ++F    +L  H   HTGEKP+KC  C  +  +K+SL  H R
Sbjct:  226 EKP--CQSNECGKAFNYSSLLRRH----HITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCN--ECGKTFTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRR 333          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF782 (zinc finger protein 782 [Source:HGNC Symbol;Acc:HGNC:33110])

HSP 1 Score: 107.457 bits (267), Expect = 7.137e-23
Identity = 83/250 (33.20%), Postives = 126/250 (50.40%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            L +H  +H   + F CN C K +++ S LR+H + H    E+ YKC++C  + + +  L KH   +  E    +  +C+ C + F  +  L+ H R+HT +  Y+C  C +    K  LR H   H  EKPY C+   C + FR    L+ H+      +P +     + C   F  KS L++H   H GEK Y+C+   C  +F  +  L VH   HTGEKP+KC+ C  +  QK+SL  H + AH  D
Sbjct:  465 LIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTG--ERPYKCDECGKAFKLKSGLRKHHRTHTGE----KPYKCNQCGKAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCE--ECGKTFRQKSNLRGHQRTHTGEKPYE----CNECGKAFSEKSVLRKHQRTHTGEKPYNCN--QCGEAFSQKSNLRVHQRTHTGEKPYKCDKCGRTFSQKSSLREH-QKAHPGD 699          

HSP 2 Score: 94.7449 bits (234), Expect = 6.237e-19
Identity = 79/254 (31.10%), Postives = 125/254 (49.21%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            G+   +   L  H  +H   + ++C+ C+K ++ +S LR H + H    EK ++C +C  S  Y+  L+ H   +  E    +   C+ C + F+    L++H R HT +  Y+C +C K  K K  LR H   H  EKPY C  + C +AF     L+ H    H++   +     + C   F +KS+L+ H   H GEK Y C   +C ++FR +  L  H   HTGEKP++C  C  +  +K+ L  H R 
Sbjct:  400 GKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTG--EKPFECHECGKSFNYKSILIVHQRTHTGE----KPFECNECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKC--NQCGKAFGQKSQLRGH----HRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQC--EECGKTFRQKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKHQRT 639          

HSP 3 Score: 92.0485 bits (227), Expect = 4.346e-18
Identity = 72/239 (30.13%), Postives = 108/239 (45.19%), Query Frame = 2
Query: 1139 SHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            SH   + + C  C K ++ +S LR H + H      K      ++S++    + +  H             C  C + F  + +L  H R HT +  ++C +C K       LR H   H  E+PY CD   C +AF+    L+ H       +P K     + C   F +KS L+ H  +H GEK Y C+   C  +F  +  L VH   HTGEKP++CE C  + RQK++L  H R 
Sbjct:  387 SHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTGEKPFE------CHECGKSFNYKSILIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTGERPYKCD--ECGKAFKLKSGLRKHHRTHTGEKPYK----CNQCGKAFGQKSQLRGHHRIHTGEKPYKCN--HCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFRQKSNLRGHQRT 611          

HSP 4 Score: 56.9954 bits (136), Expect = 2.632e-7
Identity = 50/186 (26.88%), Postives = 78/186 (41.94%), Query Frame = 2
Query: 1316 NHAEINDTQHCRCDIC------DRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            +H E NDT +C C I        + F+ +  +++H R+H     ++  +   +  T      H   H  +K    D   C   F        H+    + +P ++    + C       SHL      H GEK Y C  P+C ++F  +  L  H   HTGEKP+KC+ CD +   K+ L  H R 
Sbjct:  269 SHYEFNDTGNCFCRITHKTLTGGKSFSQKSHIREHHRVHIGVKPFEYGKSFNRNSTLPV---HQRTHATDK--YSDYHPCTETFSYQSTFSVHQKVHIRAKPYEY----NECGKSCSMNSHLIWPQKSHTGEKPYEC--PECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRT 443          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF782 (zinc finger protein 782 [Source:HGNC Symbol;Acc:HGNC:33110])

HSP 1 Score: 107.457 bits (267), Expect = 7.137e-23
Identity = 83/250 (33.20%), Postives = 126/250 (50.40%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            L +H  +H   + F CN C K +++ S LR+H + H    E+ YKC++C  + + +  L KH   +  E    +  +C+ C + F  +  L+ H R+HT +  Y+C  C +    K  LR H   H  EKPY C+   C + FR    L+ H+      +P +     + C   F  KS L++H   H GEK Y+C+   C  +F  +  L VH   HTGEKP+KC+ C  +  QK+SL  H + AH  D
Sbjct:  465 LIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTG--ERPYKCDECGKAFKLKSGLRKHHRTHTGE----KPYKCNQCGKAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCE--ECGKTFRQKSNLRGHQRTHTGEKPYE----CNECGKAFSEKSVLRKHQRTHTGEKPYNCN--QCGEAFSQKSNLRVHQRTHTGEKPYKCDKCGRTFSQKSSLREH-QKAHPGD 699          

HSP 2 Score: 94.7449 bits (234), Expect = 6.237e-19
Identity = 79/254 (31.10%), Postives = 125/254 (49.21%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            G+   +   L  H  +H   + ++C+ C+K ++ +S LR H + H    EK ++C +C  S  Y+  L+ H   +  E    +   C+ C + F+    L++H R HT +  Y+C +C K  K K  LR H   H  EKPY C  + C +AF     L+ H    H++   +     + C   F +KS+L+ H   H GEK Y C   +C ++FR +  L  H   HTGEKP++C  C  +  +K+ L  H R 
Sbjct:  400 GKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTG--EKPFECHECGKSFNYKSILIVHQRTHTGE----KPFECNECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKC--NQCGKAFGQKSQLRGH----HRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQC--EECGKTFRQKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKHQRT 639          

HSP 3 Score: 92.0485 bits (227), Expect = 4.346e-18
Identity = 72/239 (30.13%), Postives = 108/239 (45.19%), Query Frame = 2
Query: 1139 SHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            SH   + + C  C K ++ +S LR H + H      K      ++S++    + +  H             C  C + F  + +L  H R HT +  ++C +C K       LR H   H  E+PY CD   C +AF+    L+ H       +P K     + C   F +KS L+ H  +H GEK Y C+   C  +F  +  L VH   HTGEKP++CE C  + RQK++L  H R 
Sbjct:  387 SHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTGEKPFE------CHECGKSFNYKSILIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTGERPYKCD--ECGKAFKLKSGLRKHHRTHTGEKPYK----CNQCGKAFGQKSQLRGHHRIHTGEKPYKCN--HCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFRQKSNLRGHQRT 611          

HSP 4 Score: 56.9954 bits (136), Expect = 2.632e-7
Identity = 50/186 (26.88%), Postives = 78/186 (41.94%), Query Frame = 2
Query: 1316 NHAEINDTQHCRCDIC------DRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            +H E NDT +C C I        + F+ +  +++H R+H     ++  +   +  T      H   H  +K    D   C   F        H+    + +P ++    + C       SHL      H GEK Y C  P+C ++F  +  L  H   HTGEKP+KC+ CD +   K+ L  H R 
Sbjct:  269 SHYEFNDTGNCFCRITHKTLTGGKSFSQKSHIREHHRVHIGVKPFEYGKSFNRNSTLPV---HQRTHATDK--YSDYHPCTETFSYQSTFSVHQKVHIRAKPYEY----NECGKSCSMNSHLIWPQKSHTGEKPYEC--PECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRT 443          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF28 (zinc finger protein 28 [Source:HGNC Symbol;Acc:HGNC:13073])

HSP 1 Score: 107.071 bits (266), Expect = 1.209e-22
Identity = 88/242 (36.36%), Postives = 130/242 (53.72%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  HSI H   + ++CN C K +  QS+L  H + H    EK YKCE+C    + + +L +H  I+  E    +  +C +CD+ F S+  L +H R+HT +  Y C +C K   TK  L  H  +H  EKPY C+   C++ F    +++ H+      +P K  C V  C   F+R SHL +H  +H GEK Y C+  +C ++FR   +L +H   HTGEKP+KC  C  +  Q +SL YH
Sbjct:  426 LAKHSIIHTGEKPYKCNECGKVFNQQSTLARHHRLH--TAEKPYKCEECDKVFRCKSHLERHRRIHTGE----KPYKCKVCDKAFRSDSCLTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLHTAEKPYKCE--ECEKVFSRKSHMERHRRIHTGEKPYK--CKV--CDKAFRRDSHLAQHQRVHTGEKPYKCN--ECGKTFRQTSSLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYH 653          

HSP 2 Score: 88.9669 bits (219), Expect = 4.395e-17
Identity = 87/308 (28.25%), Postives = 133/308 (43.18%), Query Frame = 2
Query: 1031 NPQSYPVNDMRSQFHISMMMNGQGNVDVDP--------LPIHSISHPHIQDFRCNYCNKCYTNQSSL------------------------RSHLKKHMNIDXXXXXXXXXXXXXQYQKN--LLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            + +S+  + +  +  I+ +   Q   DV          L  H  SH   + ++CN C K + + +SL                        +SHL+ H  I       +       +  N  L KH  I+  E    +  +C+ C ++F     L  H R+HT +  Y+C++C K    K  L  H  +H  EKPY C +  CD+AF    YL  H       +P K     + C  VF ++S L RH  +H  EK Y C   +C++ FR +  L  H   HTGEKP+KC++CD + R  + L  H R
Sbjct:  220 SGKSFNCSSLLKKHQITHLEEKQCKCDVYGKVFNQKRYLACHRRSHIDEKPYKCNECGKIFGHNTSLFLHKALHTADKPYECEECDKVFSRKSHLETHKIIYTGGKPYKCKVCDKAFTCNSYLAKHTIIHTGE----KPYKCNECGKVFNRLSTLARHRRLHTGEKPYECEECEKVFSRKSHLERHKRIHTGEKPYKCKV--CDKAFAYNSYLAKHSIIHTGEKPYK----CNECGKVFNQQSTLARHHRLHTAEKPYKC--EECDKVFRCKSHLERHRRIHTGEKPYKCKVCDKAFRSDSCLTEHQR 515          

HSP 3 Score: 79.337 bits (194), Expect = 3.783e-14
Identity = 76/242 (31.40%), Postives = 116/242 (47.93%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H   H   + ++C  C+K + + S L  H + H    EK Y C +C      + NL  H  ++ AE    +  +C+ C+++F+ +  ++ H R+HT +  Y+C+ C K  +    L  H  VH  EKPY C+   C + FR    L  H+      +P K     + C   F + S L  H  +H GEK Y C+  +C + F  Q  L  H   HTGEKP+KC  C  +  Q ++L YH
Sbjct:  482 LERHRRIHTGEKPYKCKVCDKAFRSDSCLTEHQRVHTG--EKPYMCNECGKVFSTKANLACHHKLHTAE----KPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKVCDKAFRRDSHLAQHQRVHTGEKPYKCN--ECGKTFRQTSSLIIHRRLHTGEKPYK----CNECGKTFSQMSSLVYHHRLHSGEKPYKCN--ECGKVFNQQAHLAQHQRVHTGEKPYKCNECGKTFSQMSNLVYH 709          

HSP 4 Score: 70.0922 bits (170), Expect = 3.150e-11
Identity = 69/223 (30.94%), Postives = 108/223 (48.43%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKP 1789
            L  H   H   + + CN C K ++ +++L  H K H    EK YKCE+C      + ++ +H  I+  E    +  +C +CD+ F  +  L  H R+HT +  Y+C +C K  +    L  H  +H  EKPY C+   C + F     L  H    H+L   +     + C  VF +++HL +H  +H GEK Y C+  +C ++F     L  H   H+GEKP
Sbjct:  510 LTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLH--TAEKPYKCEECEKVFSRKSHMERHRRIHTGE----KPYKCKVCDKAFRRDSHLAQHQRVHTGEKPYKCNECGKTFRQTSSLIIHRRLHTGEKPYKCN--ECGKTFSQMSSLVYH----HRLHSGEKPYKCNECGKVFNQQAHLAQHQRVHTGEKPYKCN--ECGKTFSQMSNLVYHHRLHSGEKP 718          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 78.1814 bits (191), Expect = 3.362e-14
Identity = 62/251 (24.70%), Postives = 100/251 (39.84%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G      L  H  SH   + + C++C K +  +++L+ H + H   +            +QY    + H    H  I +    +C  CD++ +S   L  H + H                              +K + CD   C + F    YLK H  + H+   +KH C    C   F     L+ H+  H GE+ Y C +  C ++F +Q  L  H   HTGE+P+ C+ C  +  QK+ L  H
Sbjct:  110 GKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTG-ERPYKCRYCEKTFAQYGTKTV-HEKSAHLGIRNY---KCPKCDKLLSSPSALYTHKKTHG-----------------------------DKTFRCDF--CPKTFALKNYLKLHVKQVHEQNERKHVCVY--CNKGFAYAGSLQVHVRTHTGERPYVCKF--CPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAH 320          

HSP 2 Score: 71.2478 bits (173), Expect = 4.934e-12
Identity = 67/236 (28.39%), Postives = 106/236 (44.92%), Query Frame = 2
Query: 1139 SHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +H  I++++C  C+K  ++ S+L +H K H +   +   C K      Y K  +K +H    E N+ +H  C  C++ FA    L+ H+R HT +  Y C+ C K   ++  L+ H   H  E+PY C    C R F     L  H  E   L  K    P  T   +      +  H  +     NY C +  CN+ +    +L +H+ +HT +  + C+ C     QK SLN H
Sbjct:  182 AHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH----EQNERKHV-CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQF--CQRTFIQKSQLTAH--ESTHLTQKHSVNPDSTTADILPVAGSVTDHQMV----GNYECTF--CNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIH 402          

HSP 3 Score: 64.6994 bits (156), Expect = 5.321e-10
Identity = 37/101 (36.63%), Postives = 53/101 (52.48%), Query Frame = 2
Query: 1604 KKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAH-------AKDCERLL 1885
            K+H C V  C   F   S L+ H   H GEK Y+CH+  C ++F  + TL VH   HTGE+P+KC  C+ +  Q  +   H ++AH          C++LL
Sbjct:  102 KRHICTV--CGKGFSYFSILESHKRSHTGEKPYNCHF--CQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLL 198          

HSP 4 Score: 64.6994 bits (156), Expect = 5.321e-10
Identity = 54/197 (27.41%), Postives = 80/197 (40.61%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVC----------------------DIDN-----CDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAM--HDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            C +C + F+   +L+ H R HT +  Y C  C K    K  L+ H   H  E+PY C                       I N     CD+   +P  L  HK        +  FCP       F  K++LK H+       E+ + C +  CN+ F    +L VH+  HTGE+P+ C+ C  +   + +L  H R 
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPK-----TFALKNYLKLHVKQVHEQNERKHVCVY--CNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERT 295          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058695:1067525:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 78.1814 bits (191), Expect = 3.362e-14
Identity = 62/251 (24.70%), Postives = 100/251 (39.84%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G      L  H  SH   + + C++C K +  +++L+ H + H   +            +QY    + H    H  I +    +C  CD++ +S   L  H + H                              +K + CD   C + F    YLK H  + H+   +KH C    C   F     L+ H+  H GE+ Y C +  C ++F +Q  L  H   HTGE+P+ C+ C  +  QK+ L  H
Sbjct:  110 GKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTG-ERPYKCRYCEKTFAQYGTKTV-HEKSAHLGIRNY---KCPKCDKLLSSPSALYTHKKTHG-----------------------------DKTFRCDF--CPKTFALKNYLKLHVKQVHEQNERKHVCVY--CNKGFAYAGSLQVHVRTHTGERPYVCKF--CPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAH 320          

HSP 2 Score: 71.2478 bits (173), Expect = 4.934e-12
Identity = 67/236 (28.39%), Postives = 106/236 (44.92%), Query Frame = 2
Query: 1139 SHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +H  I++++C  C+K  ++ S+L +H K H +   +   C K      Y K  +K +H    E N+ +H  C  C++ FA    L+ H+R HT +  Y C+ C K   ++  L+ H   H  E+PY C    C R F     L  H  E   L  K    P  T   +      +  H  +     NY C +  CN+ +    +L +H+ +HT +  + C+ C     QK SLN H
Sbjct:  182 AHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH----EQNERKHV-CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQF--CQRTFIQKSQLTAH--ESTHLTQKHSVNPDSTTADILPVAGSVTDHQMV----GNYECTF--CNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIH 402          

HSP 3 Score: 64.6994 bits (156), Expect = 5.321e-10
Identity = 37/101 (36.63%), Postives = 53/101 (52.48%), Query Frame = 2
Query: 1604 KKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAH-------AKDCERLL 1885
            K+H C V  C   F   S L+ H   H GEK Y+CH+  C ++F  + TL VH   HTGE+P+KC  C+ +  Q  +   H ++AH          C++LL
Sbjct:  102 KRHICTV--CGKGFSYFSILESHKRSHTGEKPYNCHF--CQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLL 198          

HSP 4 Score: 64.6994 bits (156), Expect = 5.321e-10
Identity = 54/197 (27.41%), Postives = 80/197 (40.61%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVC----------------------DIDN-----CDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAM--HDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            C +C + F+   +L+ H R HT +  Y C  C K    K  L+ H   H  E+PY C                       I N     CD+   +P  L  HK        +  FCP       F  K++LK H+       E+ + C +  CN+ F    +L VH+  HTGE+P+ C+ C  +   + +L  H R 
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPK-----TFALKNYLKLHVKQVHEQNERKHVCVY--CNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERT 295          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: klu-1 (KLUmpfuss related [Source:UniProtKB/TrEMBL;Acc:O46016])

HSP 1 Score: 70.8626 bits (172), Expect = 5.302e-12
Identity = 42/121 (34.71%), Postives = 58/121 (47.93%), Query Frame = 2
Query: 1514 YVCDIDNCDRAFRTPKYLKNHKDEFHKLQP-------KKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            Y C +  C +AF     L  H    H+ +        K H C  + C   F R   L RHM +H G K Y C  P CN+ F   + L+ HL  HTGEKP+ C +C+YS  ++  ++ H R 
Sbjct:  332 YPCTL--CGQAFAVHDRLAKHIASRHRQRSCTLDDASKVHKC--NMCSKSFSRSDMLTRHMRLHTGAKPYSC--PTCNQVFSRSDHLSTHLRTHTGEKPYACPMCNYSASRRDMISRHMRT 446          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: F47E1.3 (pep chromosome:WBcel235:X:9046213:9054885:1 gene:WBGene00018567.1 transcript:F47E1.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F47E1.3)

HSP 1 Score: 68.1662 bits (165), Expect = 3.340e-11
Identity = 47/170 (27.65%), Postives = 76/170 (44.71%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAH 1861
            C+ C ++F+ E+    HL+                        Y   V N  + + C I  C+R+F     L+ H    H+   + H C V  C+  F + S L +H+ +H GE+ Y C +  C ++F     L  H+ +H+GEKPFKC  C  +    A+ + H R +H
Sbjct:  465 CERCGKVFSYEYYRDKHLK------------------------YTRCVDNGNRKFPCTI--CNRSFEKRDRLRIHILHVHE-NHRPHVCSV--CQKSFSQSSSLNKHLRVHSGERPYKCSF--CPKAFTASSILRTHVRQHSGEKPFKCAHCGKAFASHAAHDSHVRRSH 603          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: klf-3 (Kruppel-Like Factor (Zinc finger protein) [Source:UniProtKB/TrEMBL;Acc:P91329])

HSP 1 Score: 66.2402 bits (160), Expect = 4.299e-11
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 2
Query: 1610 HFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            H C    C   + + SHLK H   H GEK + C W +C+  F   + L  H+ +HTG+KPF+C LCD +  +   L+ H +
Sbjct:  224 HACTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMK 304          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: dwg (gene:FBgn0000520 transcript:FBtr0070487)

HSP 1 Score: 97.8265 bits (242), Expect = 2.337e-20
Identity = 78/231 (33.77%), Postives = 111/231 (48.05%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            + C  C K +  Q  L  H++ H  +DEK+Y+CE+C    ++ +N  +HM + H  +   Q   C IC R + +   L  H R H     Y C QC +       LR H   H  E+PY CD+  CD+A+     L+ HK        KK F   + C +   +KS  K+HM +H G K + C    C  +F     LN H+  H+GEKPFKCE+C  +   K  L  H R
Sbjct:  305 YVCTVCQKAFRQQCRLNQHMRSH--VDEKQYECEECGKRLKHLRNYKEHM-LTHTNVKPHQ---CSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDL--CDKAYYDSSSLRQHKISH---TGKKAF-TCEICGVGLSQKSGYKKHMMVHSGVKAHKCDV--CGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMR 521          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: Kr-h1 (gene:FBgn0266450 transcript:FBtr0344437)

HSP 1 Score: 90.1225 bits (222), Expect = 9.416e-18
Identity = 56/153 (36.60%), Postives = 76/153 (49.67%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELC 1807
            +C++C + FA    L  H R HT +  ++C+ C K    K  L+ H  +H  E+PY CD+  C RAF     L  H       +P  H C V  C+  F +   L  HM  H GEK Y C  P C + F   + L VH   HTGEKP+ C++C
Sbjct:  218 QCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDV--CGRAFEHSGKLHRHMRIHTGERP--HKCSV--CEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDIC 364          

HSP 2 Score: 74.7146 bits (182), Expect = 6.378e-13
Identity = 65/232 (28.02%), Postives = 95/232 (40.95%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            ++CN C K +   + L  H + H    E+ ++CE C      ++NL  H  I+  E    +  +CD+C R F     L  H+R+HT +  ++C  C K      +L  H   H  EKPY C    C + F                          TC         LK H   H GEK YHC    C R F     L +H ++H G K +KC +CD + + K  +  H + 
Sbjct:  217 YQCNVCQKTFAVPARLIRHYRTHTG--ERPFECEFCHKLFSVKENLQVHRRIHTKE----RPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGF--------------------------TC------SKQLKVHSRTHTGEKPYHCDI--CFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKG 408          

HSP 3 Score: 57.7658 bits (138), Expect = 7.938e-8
Identity = 37/123 (30.08%), Postives = 56/123 (45.53%), Query Frame = 2
Query: 1487 ADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            A+V     PY C++  C + F  P  L  H       +P +     + C  +F  K +L+ H  +H  E+ Y C    C R+F     L+ H+  HTGE+P KC +C+ +  Q   L  H R 
Sbjct:  208 ANVAAGADPYQCNV--CQKTFAVPARLIRHYRTHTGERPFE----CEFCHKLFSVKENLQVHRRIHTKERPYKCDV--CGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRT 322          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: Kr-h1 (gene:FBgn0266450 transcript:FBtr0344438)

HSP 1 Score: 90.1225 bits (222), Expect = 9.911e-18
Identity = 56/153 (36.60%), Postives = 76/153 (49.67%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELC 1807
            +C++C + FA    L  H R HT +  ++C+ C K    K  L+ H  +H  E+PY CD+  C RAF     L  H       +P  H C V  C+  F +   L  HM  H GEK Y C  P C + F   + L VH   HTGEKP+ C++C
Sbjct:  272 QCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDV--CGRAFEHSGKLHRHMRIHTGERP--HKCSV--CEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDIC 418          

HSP 2 Score: 74.7146 bits (182), Expect = 5.606e-13
Identity = 65/232 (28.02%), Postives = 95/232 (40.95%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            ++CN C K +   + L  H + H    E+ ++CE C      ++NL  H  I+  E    +  +CD+C R F     L  H+R+HT +  ++C  C K      +L  H   H  EKPY C    C + F                          TC         LK H   H GEK YHC    C R F     L +H ++H G K +KC +CD + + K  +  H + 
Sbjct:  271 YQCNVCQKTFAVPARLIRHYRTHTG--ERPFECEFCHKLFSVKENLQVHRRIHTKE----RPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGF--------------------------TC------SKQLKVHSRTHTGEKPYHCDI--CFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKG 462          

HSP 3 Score: 57.7658 bits (138), Expect = 8.648e-8
Identity = 37/123 (30.08%), Postives = 56/123 (45.53%), Query Frame = 2
Query: 1487 ADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            A+V     PY C++  C + F  P  L  H       +P +     + C  +F  K +L+ H  +H  E+ Y C    C R+F     L+ H+  HTGE+P KC +C+ +  Q   L  H R 
Sbjct:  262 ANVAAGADPYQCNV--CQKTFAVPARLIRHYRTHTGERPFE----CEFCHKLFSVKENLQVHRRIHTKERPYKCDV--CGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRT 376          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: CG12299 (gene:FBgn0032295 transcript:FBtr0080113)

HSP 1 Score: 89.3521 bits (220), Expect = 1.460e-17
Identity = 71/230 (30.87%), Postives = 112/230 (48.70%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVH-NPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            F+C +C   + N   L  H++ H  I  K ++C  C  +  +  +L  H+ I+  E    +  +C++C + F     L  H+R H+    +QC QC K       L  H   H  P + ++C    C+R F+    L    DE  ++  ++       C+  F+  S L +HM  H GEK + C    C+RSF    +LN+H+  HTGEKPF+C+LCD    Q +SL+ H
Sbjct:  254 FQCTHCEASFPNAGDLSKHVRSH--ITNKPFQCSICQKTFTHIGSLNTHIRIHSGE----KPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICP--ECEREFKAEALL----DEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSL--CDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVH 469          

HSP 2 Score: 89.3521 bits (220), Expect = 1.778e-17
Identity = 71/240 (29.58%), Postives = 103/240 (42.92%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            IHS   P    ++C  C K +T  SSL  H++ H ++ +     +       Y   LL         I  T+   C  C+R F +E LL +H+RMHT +  YQC  C +  +   +L  H   H  EKP+ C +  CDR+F                                 +   L  HM +H GEK + C    C++ F    +L+VH+  H GEKP+ C +C  S  Q+A LN H
Sbjct:  303 IHSGEKP----YKCELCPKAFTQSSSLMVHMRSH-SVRKPHQCVQCDKGFINYSSLLLH----QKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSL--CDRSFT--------------------------------QSGSLNIHMRIHTGEKPFQCKL--CDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKH 497          

HSP 3 Score: 62.7734 bits (151), Expect = 2.392e-9
Identity = 62/205 (30.24%), Postives = 83/205 (40.49%), Query Frame = 2
Query: 1328 INDTQHC-RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDG-EKNYHCHWPDCNRSFRTQETLNVHLIRHT----------------------------GEKPFKCELCDYSCRQKASLNYHCR 1852
            +N  Q C +C  C+  F +   L  H+R H  +  +QC  C K       L  H  +H+ EKPY C++  C +AF     L  H    H ++ K H C    C   F   S L  H   H    + + C  P+C R F+ +  L+ H+  HT                            GEKPF C LCD S  Q  SLN H R
Sbjct:  247 LNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYKCEL--CPKAFTQSSSLMVHMRS-HSVR-KPHQC--VQCDKGFINYSSLLLHQKTHIAPTETFIC--PECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMR 443          

HSP 4 Score: 52.7582 bits (125), Expect = 2.949e-6
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query: 1631 CKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            C+  F     L +H+  H   K + C    C ++F    +LN H+  H+GEKP+KCELC  +  Q +SL  H R+
Sbjct:  259 CEASFPNAGDLSKHVRSHITNKPFQCSI--CQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRS 331          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: Phs (gene:FBgn0036522 transcript:FBtr0075570)

HSP 1 Score: 86.2705 bits (212), Expect = 1.680e-16
Identity = 60/167 (35.93%), Postives = 84/167 (50.30%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C+ C + F     ++DHLR+HT +  Y C QC +  + K++L  H   H  EK Y CDI  C     T + L  H    H    +++ C  D C   F R S L  H+ +H GEK Y C    C ++FR ++ L VH   H G+KP +CELCD    +K  +  H R
Sbjct:  631 CNFCGKTFKRFSRMQDHLRLHTGEKPYVCGQCGRAFRLKMRLVEHQLRHRAEKAYKCDI--CSMPLATKQDLSLHM--RHHKNDRRYKC--DKCNKGFVRSSDLSIHVRIHTGEKPYSCDL--CGKAFRARQNLVVHRRTHLGDKPIQCELCDKRFARKIDMRVHMR 789          

HSP 2 Score: 73.559 bits (179), Expect = 1.351e-12
Identity = 66/203 (32.51%), Postives = 100/203 (49.26%), Query Frame = 2
Query: 1166 CNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRH 1774
            CN+C K +   S ++ HL+ H    EK Y C +C  + + +  L++H   + AE    +  +CDIC    A++  L  H+R H ND  Y+C +C K       L  H  +H  EKPY CD+  C +AFR  + L  H+      +P       + C   F RK  ++ HM  H GEK Y+C    C R + ++    V+L+RH
Sbjct:  631 CNFCGKTFKRFSRMQDHLRLHTG--EKPYVCGQCGRAFRLKMRLVEHQLRHRAE----KAYKCDICSMPLATKQDLSLHMRHHKNDRRYKCDKCNKGFVRSSDLSIHVRIHTGEKPYSCDL--CGKAFRARQNLVVHRRTHLGDKP----IQCELCDKRFARKIDMRVHMRRHTGEKPYNCDA--CQRGYSSR----VNLLRH 815          

HSP 3 Score: 54.6842 bits (130), Expect = 7.280e-7
Identity = 51/245 (20.82%), Postives = 81/245 (33.06%), Query Frame = 2
Query: 1130 HSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHA 1864
            H + H   + ++C+ C+     +  L  H++ H N                                   +  +CD C++ F     L  H+R+HT                             EKPY CD+  C +AFR  +                         LV  R++HL        G+K   C    C++ F  +  + VH+ RHTGEKP+ C+ C      + +L  H    H 
Sbjct:  675 HQLRHRAEKAYKCDICSMPLATKQDLSLHMRHHKN----------------------------------DRRYKCDKCNKGFVRSSDLSIHVRIHTG----------------------------EKPYSCDL--CGKAFRARQ------------------------NLVVHRRTHL--------GDKPIQCEL--CDKRFARKIDMRVHMRRHTGEKPYNCDACQRGYSSRVNLLRHQEREHG 821          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: CR450780.2 (pep chromosome:GRCz11:4:63075252:63080760:-1 gene:ENSDARG00000112928.1 transcript:ENSDART00000167958.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR450780.2)

HSP 1 Score: 108.227 bits (269), Expect = 1.264e-24
Identity = 90/290 (31.03%), Postives = 135/290 (46.55%), Query Frame = 2
Query:  995 NFDYSKQARHGVNP------QSYPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            ++++SK+  H V        Q+  +   R + H +    G+   +   L  H   H   + F C  C K +  Q+SL +H+K H    +K + C +C  S     NL  HM I+  E   T    C  C + F  +  LK H+R+HT + T+ C QC K    +  L++H  +H  EK + C   +C + F    +L +H     K+   +       C   F + SHL  HM +H GEK + C  P C +SF  Q +L +H+  HTGEKPF C  C  S  Q + LN H
Sbjct:   38 SYEWSKEEEHHVKIEDKSHLQTDGILKRRDKNHFTCTQCGKTLANKSKLKNHMRIHTGEKQFTCTQCGKSFGLQNSLTNHMKIH--TGKKPFICTQCGRSFNQSSNLNNHMKIHTGEKPFT----CTQCGKSFGIQSSLKIHMRIHTREKTFTCSQCGKSFGIQSSLKFHMRIHTREKTFTCT--HCGKGFIQSSHLYDHM----KIHTGEKPFTCTQCGRSFNQSSHLNNHMKIHTGEKPFTC--PQCGKSFGLQGSLTIHMRIHTGEKPFTCAQCGKSFNQSSHLNQH 313          

HSP 2 Score: 87.8113 bits (216), Expect = 8.695e-18
Identity = 75/231 (32.47%), Postives = 107/231 (46.32%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            F C  C K   N+S L++H++ H    EK++ C +C  S   Q +L  HM I+  +        C  C R F     L +H+++HT +  + C QC K    +  L+ H  +H  EK + C    C ++F     LK H     ++  ++       C   F + SHL  HM +H GEK + C    C RSF     LN H+  HTGEKPF C  C  S   + SL  H R
Sbjct:   71 FTCTQCGKTLANKSKLKNHMRIH--TGEKQFTCTQCGKSFGLQNSLTNHMKIHTGKKPFI----CTQCGRSFNQSSNLNNHMKIHTGEKPFTCTQCGKSFGIQSSLKIHMRIHTREKTFTCS--QCGKSFGIQSSLKFHM----RIHTREKTFTCTHCGKGFIQSSHLYDHMKIHTGEKPFTC--TQCGRSFNQSSHLNNHMKIHTGEKPFTCPQCGKSFGLQGSLTIHMR 287          

HSP 3 Score: 75.0998 bits (183), Expect = 1.611e-13
Identity = 75/254 (29.53%), Postives = 108/254 (42.52%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNH------KDEFHKLQPKKHFC------------------PVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGE 1783
            G  N   + + IH+   P    F C  C + +   S+L +H+K H    EK + C +C  S   Q +L  HM I+  E   T    C  C + F  +  LK H+R+HT + T+ C  C K       L  H  +H  EKP+ C    C R+F    +L NH      +  F   Q  K F                       C   F + SHL +HM +H GEK++ C    C +SF    +L+ H+  H+GE
Sbjct:  109 GLQNSLTNHMKIHTGKKP----FICTQCGRSFNQSSNLNNHMKIH--TGEKPFTCTQCGKSFGIQSSLKIHMRIHTREKTFT----CSQCGKSFGIQSSLKFHMRIHTREKTFTCTHCGKGFIQSSHLYDHMKIHTGEKPFTCT--QCGRSFNQSSHLNNHMKIHTGEKPFTCPQCGKSFGLQGSLTIHMRIHTGEKPFTCAQCGKSFNQSSHLNQHMTIHTGEKSFKC--TQCGKSFTCSSSLSRHMRIHSGE 348          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: BX324212.2 (pep chromosome:GRCz11:4:38589553:38608436:-1 gene:ENSDARG00000110372.1 transcript:ENSDART00000191971.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX324212.2)

HSP 1 Score: 106.301 bits (264), Expect = 4.297e-24
Identity = 83/246 (33.74%), Postives = 112/246 (45.53%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTP----KYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L IH I H   + F C  C K +   SSL  H++ H    EK + C +C  S     NL +H+ I+  E   T    C +C + F     L  H+R HT +  + C QC K          H  +H  EKP+ C    C ++FR      K+++ H  E           P    +  F   S L RHM +H GEK + C    C +SFR    LN+H++ HTGEKPFKC  C  S  Q + LN H
Sbjct:   80 LKIHMIIHTGEKPFTCTQCGKSFRQASSLNKHMRIH--TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPIT----CTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCT--QCGKSFRQASSLNKHMRTHTGEK----------PFTCTQKSFSNLSSLYRHMRIHTGEKPFTC--TQCGKSFRQSSNLNLHMMIHTGEKPFKCTQCGKSFSQSSHLNQH 305          

HSP 2 Score: 87.4261 bits (215), Expect = 9.231e-18
Identity = 57/168 (33.93%), Postives = 81/168 (48.21%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            C  C ++ AS+  LK H+ +HT +  + C QC K  +    L  H  +H  EKP+ C    C ++F     L    D+  ++   +       C   F++ S L +HM  H GEK + C    C +SF      N+H+  HTGEKPF C  C  S RQ +SLN H R 
Sbjct:   67 CTQCGKILASKSKLKIHMIIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPFTCT--QCGKSFNRSSNL----DQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTC--TQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRT 226          

HSP 3 Score: 53.1434 bits (126), Expect = 1.707e-6
Identity = 57/205 (27.80%), Postives = 80/205 (39.02%), Query Frame = 2
Query: 1088 MNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNY 1702
             N   N+D   + IH+   P      C  C K +   SSL  H++ H             S+S     NL  HM I+  E   T    C  C + F     L  H+R HT +  + C Q      + L    H  +H  EKP+ C    C ++FR    L  H       +P K       C   F + SHL +H+ +H GEK +
Sbjct:  130 FNRSSNLD-QHIRIHTGEKP----ITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNL--HMRIHTGEKPFT----CTQCGKSFRQASSLNKHMRTHTGEKPFTCTQKSFSNLSSLYR--HMRIHTGEKPFTCT--QCGKSFRQSSNLNLHMMIHTGEKPFK----CTQCGKSFSQSSHLNQHIMIHTGEKPF 315          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf1026 (zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE-110913-157])

HSP 1 Score: 107.842 bits (268), Expect = 6.303e-24
Identity = 83/255 (32.55%), Postives = 117/255 (45.88%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQK--NLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+       L IH I H   + F C  C K +    S  SHL +HM I   +           + +  +L++HM I+  E   T    C  C + F++   L  H+R+HT +  + C QC K  +    L  H  +H  EKP+ C    C ++F    +L  H       +P K       C   F + S L +HM +H GEK + C  P C +SFR   +LN H + HTGEKPF C  C+ S  Q +SLN H R
Sbjct:   71 GKILASKSKLKIHMIIHTGEKPFTCTQCGKSFRQSFSRLSHLNRHMMIHTGEKPFTCTQCGKSFSRLSHLIRHMMIHTGEKPFT----CSQCRKSFSNLSSLYRHMRIHTGEKPFTCTQCGKSFRQSSNLNLHMMIHTEEKPFKCT--QCGKSFSQSSHLNQHIMIHTGEKPFK----CTQCGKSFIQSSSLNQHMMIHTGEKPFTC--PKCGKSFRKSSSLNEHRMIHTGEKPFTCPKCEMSFSQSSSLNKHMR 313          

HSP 2 Score: 84.3445 bits (207), Expect = 2.751e-16
Identity = 83/277 (29.96%), Postives = 121/277 (43.68%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCH--------------------------WPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+    +  L  H + H   + F C+ C K ++N SSL  H++ H    EK + C +C  S +   NL  HM I+  E    +  +C  C + F+    L  H+ +HT +  ++C QC K       L  H  +H  EKP+ C    C ++FR    L  H+      +P    CP   C++ F + S L +HM +H GEK + C                            P C +SF     LN H+  HTGEKPF C  C  S  + +SLN H
Sbjct:  131 GKSFSRLSHLIRHMMIHTGEKPFTCSQCRKSFSNLSSLYRHMRIH--TGEKPFTCTQCGKSFRQSSNLNLHMMIHTEE----KPFKCTQCGKSFSQSSHLNQHIMIHTGEKPFKCTQCGKSFIQSSSLNQHMMIHTGEKPFTCP--KCGKSFRKSSSLNEHRMIHTGEKP--FTCP--KCEMSFSQSSSLNKHMRIHTGEKPFTCTQCGKSFNQTSSLKDHMRIHTGEKPFTCPKCGKSFNQSSHLNHHMRIHTGEKPFTCTQCGKSFSRPSSLNKH 395          

HSP 3 Score: 73.559 bits (179), Expect = 8.096e-13
Identity = 67/240 (27.92%), Postives = 101/240 (42.08%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQY--QKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELC 1807
            G+       L +H + H   + F+C  C K +    S  SHL +H+ I   +   +       +    +L +HM I+  E   T    C  C + F     L +H  +HT +  + C +C         L  H  +H  EKP+ C    C ++F     LK+H       +P    CP   C   F + SHL  HM +H GEK + C    C +SF    +LN H+  HTG + + C  C
Sbjct:  187 GKSFRQSSNLNLHMMIHTEEKPFKCTQCGKSF----SQSSHLNQHIMIHTGEKPFKCTQCGKSFIQSSSLNQHMMIHTGEKPFT----CPKCGKSFRKSSSLNEHRMIHTGEKPFTCPKCEMSFSQSSSLNKHMRIHTGEKPFTCT--QCGKSFNQTSSLKDHMRIHTGEKP--FTCP--KCGKSFNQSSHLNHHMRIHTGEKPFTC--TQCGKSFSRPSSLNKHMKIHTGVRAYMCLKC 410          

HSP 4 Score: 58.151 bits (139), Expect = 5.135e-8
Identity = 65/229 (28.38%), Postives = 92/229 (40.17%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTG 1780
            G+  +    L  H + H   + F C  C K +   SSL  H  + ++  EK + C KC  S     +L KHM I+  E   T    C  C + F     LKDH+R+HT +  + C +C K       L +H  +H  EKP+ C    C ++F  P                                S L +HM +H G + Y C    C ++F T E L  H   HTG
Sbjct:  243 GKSFIQSSSLNQHMMIHTGEKPFTCPKCGKSFRKSSSLNEH--RMIHTGEKPFTCPKCEMSFSQSSSLNKHMRIHTGEKPFT----CTQCGKSFNQTSSLKDHMRIHTGEKPFTCPKCGKSFNQSSHLNHHMRIHTGEKPFTC--TQCGKSFSRP--------------------------------SSLNKHMKIHTGVRAYMC--LKCKKTFITAEDLKRHQRIHTG 429          

HSP 5 Score: 52.7582 bits (125), Expect = 3.069e-6
Identity = 29/66 (43.94%), Postives = 36/66 (54.55%), Query Frame = 2
Query: 1631 CKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQET----LNVHLIRHTGEKPFKCELCDYS 1816
            C  +   KS LK HM +H GEK + C    C +SFR   +    LN H++ HTGEKPF C  C  S
Sbjct:   70 CGKILASKSKLKIHMIIHTGEKPFTC--TQCGKSFRQSFSRLSHLNRHMMIHTGEKPFTCTQCGKS 133          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: BX005085.5 (pep chromosome:GRCz11:3:7141360:7147226:-1 gene:ENSDARG00000114108.1 transcript:ENSDART00000178155.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX005085.5)

HSP 1 Score: 105.145 bits (261), Expect = 2.690e-23
Identity = 80/253 (31.62%), Postives = 114/253 (45.06%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+G   +  L  H   H   + F C  C K +   +SL  H+K H  +          S+S     NL +HM I+  E   T    C  C + F+    L  H+++HT +  + C QC K      +L  H  +H  EKPY C    C + F    +LK H +     +P         C   F + S+LK+H+ +H GEK Y C  P C RSF    ++N+H+  HTGEKP+ C  C  S     S+N H R
Sbjct:  146 GKGFRQISRLNKHKEIHTGEKPFTCTQCGKSFVFSTSLNKHMKVHTGVKPYTCTQCGKSFS--VSSNLYRHMRIHTGEKPFT----CSQCGKSFSISSNLHQHMKVHTGEKPFICSQCGKSFSQLAQLNQHVIIHTGEKPYTCT--QCGKTFSQSSHLKLHSNVHTGEKPY----ACTQCGKSFSQPSNLKQHLRIHTGEKPYTC--PQCGRSFNHSSSINLHMRIHTGEKPYSCTQCGKSFSHLPSINLHMR 384          

HSP 2 Score: 78.9518 bits (193), Expect = 1.078e-14
Identity = 58/189 (30.69%), Postives = 75/189 (39.68%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKD------EFHKLQPKKHFC------------------PVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            C  C + F+       H R+HT +  + C +C         L+ H  +H  EKP+ C    C + FR    L  HK+       F   Q  K F                       C   F   S+L RHM +H GEK + C    C +SF     L+ H+  HTGEKPF C  C  S  Q A LN H
Sbjct:   86 CTQCGKSFSQSSQFNQHRRIHTGEKPFTCTECGTNFSRSSNLKLHMKIHTGEKPFTC--TQCGKGFRQISRLNKHKEIHTGEKPFTCTQCGKSFVFSTSLNKHMKVHTGVKPYTCTQCGKSFSVSSNLYRHMRIHTGEKPFTC--SQCGKSFSISSNLHQHMKVHTGEKPFICSQCGKSFSQLAQLNQH 270          

HSP 3 Score: 77.7962 bits (190), Expect = 2.417e-14
Identity = 81/281 (28.83%), Postives = 111/281 (39.50%), Query Frame = 2
Query: 1028 VNPQSYPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
             N Q+  +   R +   S    G+    +  L  H   H   + F C  C K ++  S    H + H    EK + C +C  +     NL  HM I+  E   T    C  C + F     L  H  +HT +  + C QC K       L  H  VH   KPY C    C ++F     L  H       +P         C   F   S+L +HM +H GEK + C    C +SF     LN H+I HTGEKP+ C  C  +  Q + L  H  N H  +
Sbjct:   40 TNLQNCGILKTRDKKPFSCTQCGKSFRHISTLNKHKKIHTGEKPFTCTQCGKSFSQSSQFNQHRRIH--TGEKPFTCTECGTNFSRSSNLKLHMKIHTGEKPFT----CTQCGKGFRQISRLNKHKEIHTGEKPFTCTQCGKSFVFSTSLNKHMKVHTGVKPYTC--TQCGKSFSVSSNLYRHMRIHTGEKPF----TCSQCGKSFSISSNLHQHMKVHTGEKPFIC--SQCGKSFSQLAQLNQHVIIHTGEKPYTCTQCGKTFSQSSHLKLH-SNVHTGE 305          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: si:ch73-367f21.4 (si:ch73-367f21.4 [Source:ZFIN;Acc:ZDB-GENE-120214-27])

HSP 1 Score: 105.145 bits (261), Expect = 6.495e-23
Identity = 83/242 (34.30%), Postives = 111/242 (45.87%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            IH+  HP    F C  C+KC+T + SL SHLK H                   +K                    C  C + F  +  L+ H+R+HT +  Y+C++C K  + K  L  H  +H  EKPY C    C R FR  K L+NH       +P         C + F  K +LKRHM +H GEK Y C  P+C RSFR ++ L  H+  HTGEKPF C+ C  S  +  +L  H R
Sbjct:   86 IHTGDHP----FTCPECDKCFTMKHSLESHLKIHTG-----------------EKPFT-----------------CPDCGKKFRIKHSLEGHMRIHTGEKPYKCRECGKNFREKQILDKHLTIHTGEKPYSCP--ECGRNFRVKKCLENHIKTHTGEKPY----TCQDCGISFAVKQNLKRHMRIHTGEKPYSC--PECGRSFRVKQDLKSHVRIHTGEKPFSCQQCGKSFSENKTLESHMR 281          

HSP 2 Score: 90.5077 bits (223), Expect = 3.920e-18
Identity = 79/242 (32.64%), Postives = 116/242 (47.93%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            + IH+   P    + C  C + +  +  L+SH++ H    EK + C++C  S    K L  HM I+  E   T    C  C + F  +  LK H+R+HT D  Y C QC K    +  L  H   H  EKP+ CD   C + F     L+ H       +P    CP   C   F  ++ L+RH  +H GEK + CH   C +SF  +++L++H+  HTGEKP+ C+ C    R+K  L  H
Sbjct:  224 MRIHTGEKP----YSCPECGRSFRVKQDLKSHVRIHTG--EKPFSCQQCGKSFSENKTLESHMRIHTGEKPFT----CSQCGKNFRRKQNLKSHMRLHTGDKPYSCPQCGKSYNEQKSLENHIRTHTGEKPFACD--QCGKTFTQQSTLRGHIKIHTGEKP--FTCP--QCGKSFIERTKLERHKKIHSGEKPFDCHH--CKKSFTMKQSLDIHMRIHTGEKPYTCQQCGKCFREKRKLVSH 447          

HSP 3 Score: 71.2478 bits (173), Expect = 4.932e-12
Identity = 53/165 (32.12%), Postives = 80/165 (48.48%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            C  C  +F +   L+ H  +HT ++ + C +C K       L+ H  +H  + P+ C    CD+ F     L++H       +P    CP   C   F+ K  L+ HM +H GEK Y C   +C ++FR ++ L+ HL  HTGEKP+ C  C  + R K  L  H
Sbjct:   39 CKQCGEIFTTNQSLESHKVIHTGEHIFICSECGKSFTQMRYLKNHRKIHTGDHPFTC--PECDKCFTMKHSLESHLKIHTGEKP--FTCP--DCGKKFRIKHSLEGHMRIHTGEKPYKCR--ECGKNFREKQILDKHLTIHTGEKPYSCPECGRNFRVKKCLENH 195          

HSP 4 Score: 62.003 bits (149), Expect = 3.523e-9
Identity = 63/240 (26.25%), Postives = 93/240 (38.75%), Query Frame = 2
Query: 1076 ISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDT--CKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKP 1789
             S    G+   +   L  H   H   + F C+ C K +  + +L+SH++ H                                         C  C + +  +  L++H+R HT +  + C QC K    +  LR H  +H  EKP+ C    C ++F     L+ HK + H  +      P D   CK  F  K  L  HM +H GEK Y C    C + FR +  L  H+  HT EKP
Sbjct:  261 FSCQQCGKSFSENKTLESHMRIHTGEKPFTCSQCGKNFRRKQNLKSHMRLHTGDKPYS----------------------------------CPQCGKSYNEQKSLENHIRTHTGEKPFACDQCGKTFTQQSTLRGHIKIHTGEKPFTC--PQCGKSFIERTKLERHK-KIHSGEK-----PFDCHHCKKSFTMKQSLDIHMRIHTGEKPYTCQ--QCGKCFREKRKLVSHMKVHTEEKP 456          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000024787.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:105945142])

HSP 1 Score: 105.916 bits (263), Expect = 1.694e-22
Identity = 79/240 (32.92%), Postives = 106/240 (44.17%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
             H + H   + F C  C K +T + SL SH+KKH              ++ +Y   L+ HM I+  E   T    C  C + FA ++ L  H+++HT D  Y C  C K    K  L  H  +H  EKPY C    C + F     L +H     KL   +       C   F RKS L  HM +H GEK + C   +C ++F  +  L  H+  HTGEKPF C  C     QK  L  H
Sbjct:   89 THFVIHTGEKPFTCTECGKGFTQKKSLVSHMKKHAGERPYTCSECGKGFAQKY--TLVSHMKIHTGEKPYT----CSECGKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTC--SECGKGFARKNNLLSHM----KLHTGEKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTC--TECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSH 314          

HSP 2 Score: 88.9669 bits (219), Expect = 2.845e-17
Identity = 80/251 (31.87%), Postives = 112/251 (44.62%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G      L  H   H   + F C  C K +  +S L SH+K H    EK + C +C      +K L+ HM I+  E   T    C  CD+ FA +  L  H+++HT +N + C +C K    K  L  H  +H  EKP+ C    C + F     L +H     K+   +       C   F +K HL  H+ +H GEK + C   +C + F  +  L  H+  HTGEKPF C  C     QK  L  H
Sbjct:  246 GKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTG--EKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFT----CTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTCT--ECGKGFAQKNNLLSHM----KIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTC--KECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSH 482          

HSP 3 Score: 86.6557 bits (213), Expect = 1.616e-16
Identity = 77/250 (30.80%), Postives = 114/250 (45.60%), Query Frame = 2
Query: 1097 QGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            Q  V V  + IH+   P    F C  C+K +  +++L SH+K H   +          ++ +   NL+ HM I+  E   T    C  C + FA +  L  H+++HT +  + C +C K    K  L  H  +H  EKP+ C    C + F T KY+     + H    +K F     C   F +K+HL  HM +H GEK + C   +C + F  +  L  H+  HTGEKPF C  C     +K  L  H
Sbjct:  307 QKKVLVSHMSIHTGEKP----FTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKK--NNLVSHMKIHTGEKPFT----CTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCK--ECGKGF-TQKYVLVSHIKIH--TGEKPF-TCSECGKGFTQKNHLVSHMKIHTGEKPFTC--TECGKGFALKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSH 538          

HSP 4 Score: 86.2705 bits (212), Expect = 2.262e-16
Identity = 79/251 (31.47%), Postives = 113/251 (45.02%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G      L  H   H   + + C+ C K + +++SL SHLK H    EK Y C +C      + NLL HM ++  E   T    C  C + FA +  L  H+++HT +  + C +C K    K  L  H  +H  EKP+ C    C + F   K L +H       +P         C   F  K++L  HM +H GE  + C   +C + F  +  L  H+  HTGEKPF C  C     QK +L  H
Sbjct:  162 GKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTG--EKPYTCSECGKGFARKNNLLSHMKLHTGEKRFT----CTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCT--ECGKGFTQKKVLVSHMSIHTGEKPF----TCTECDKGFAYKNNLVSHMKIHTGENPFTC--TECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSH 398          

HSP 5 Score: 84.7297 bits (208), Expect = 5.845e-16
Identity = 76/248 (30.65%), Postives = 116/248 (46.77%), Query Frame = 2
Query: 1103 NVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            N  V  L IH+   P    + C+ C K +  +++L SH+K H    EK++ C +C      + +L+ HM ++  E   T    C  C + FA +  L  H+++HT +  + C +C K    K  L  H  +H  EKP+ C    CD+ F     L +H     K+   ++      C   F +K++L  HM +H GEK + C   +C + F  +  L  H+  HTGEKPF C  C     QK  L  H
Sbjct:  197 NSLVSHLKIHTGEKP----YTCSECGKGFARKNNLLSHMKLHTG--EKRFTCTECGKGFARKSDLVSHMKLHTGEKPFT----CTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCT--ECDKGFAYKNNLVSHM----KIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGEKPFTC--TECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSH 426          

HSP 6 Score: 84.7297 bits (208), Expect = 7.005e-16
Identity = 75/251 (29.88%), Postives = 115/251 (45.82%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G    + L  H   H   + F C  C K +  +++L SH+K H    EK + C +C      +K+L+ H+ I+  E   T    C  C + F  +++L  H+++HT +  + C +C K    K  L  H  +H  EKP+ C    C + F     LKN+     ++   +       C   F +K+ L  HM +H GEK + C   +C + F  +  L  HL  HTGEKPF C  C     +K  L  H
Sbjct:  358 GKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTG--EKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFT----CKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCT--ECGKGFA----LKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSHMKIHTGEKPFTC--TECGKGFAHKNDLVSHLKIHTGEKPFTCTECGKGFAKKNQLVSH 594          

HSP 7 Score: 79.7221 bits (195), Expect = 2.543e-14
Identity = 74/251 (29.48%), Postives = 113/251 (45.02%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G    + L  H   H   + F C  C K +  +S L SH+K H    EK + C +C  +   + +L+ HM ++  E   T    C  C + F  + +L  H+ +HT +  + C +C K    K  L  H  +H  E P+ C    C + F     L +H     K+   +       C   F +K++L  HM +H GEK + C   +C + F  ++ L  H+  HTGEKPF C+ C     QK  L  H
Sbjct:  218 GKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHMKLHTG--EKPFTCTECGKAFARKSDLVSHMKLHTGEKPFT----CTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCT--ECGKGFTKKNNLVSHM----KIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTC--TECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSH 454          

HSP 8 Score: 75.0998 bits (183), Expect = 7.390e-13
Identity = 67/235 (28.51%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC 1798
            G+G    + L  H   H   + F C  C K +T +  L SH+K H        K     ++ +Y   L+ H+ I+  E   T    C  C + F  +  L  H+++HT +  + C +C K    K  L  H  +H  EKP+ C    C + F     L +H     K+   +       C   F  K+ L  H+ +H GEK + C   +C + F  +  L  H+  HTGEKPF C
Sbjct:  386 GKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYV--LVSHIKIHTGEKPFT----CSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIRIHTGEKPFTCT--ECGKGFAKKNQLVSHM----KIHTGEKPFTCTECGKGFAHKNDLVSHLKIHTGEKPFTC--TECGKGFAKKNQLVSHMKIHTGEKPFTC 606          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000054824.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29736705:29767598:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 4.084e-20
Identity = 83/258 (32.17%), Postives = 122/258 (47.29%), Query Frame = 2
Query: 1073 HISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H +    G+G  D      H   H   + F C  C K +T +SSL++H K H   +          ++ + +  LL+HM ++  E   T    C  C + F  + +L+ H R+HT +N + C +C K     L L+ H  +H  EKP+VC    C R F   + L++H ++ H  + K   C    C   F +K+ L  H  +H GEK + C   +C RSF  ++TL  H   HTGEKPF C  C  S  Q  SL  H
Sbjct:  355 HFTCTECGKGFTDKGKHLRHMRIHLGEKPFTCTECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGK--LLRHMRVHTGEKPFT----CTECGKHFIDDIMLQKHKRIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVC--TECGRCFTEKRTLQHH-NKIHTGE-KPFIC--TECGKGFTQKTSLLNHNKIHTGEKPFTC--TECGRSFTEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNH 598          

HSP 2 Score: 87.8113 bits (216), Expect = 8.505e-17
Identity = 78/245 (31.84%), Postives = 116/245 (47.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            + IH+   P    F C  C +C+T + +L+ H K H    EK + C +C      + +LL H  I+  E   T    C  C R F  +  L++H ++HT +  + C  C K     + L+ H  +H  EKP+ C    C ++F   K L++H  + H  +  K F   D  K   QR S L+ H+  H GEK + C   +C + F  +  L +H   HTGEKPF C  C  S  +K +L  H R 
Sbjct:  487 IKIHTGEKP----FVCTECGRCFTEKRTLQHHNKIHTG--EKPFICTECGKGFTQKTSLLNHNKIHTGEKPFT----CTECGRSFTEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNHVTIHTGEKPFTCT--ECGKSFSERKTLRDH-SKIHTGE--KPFTCTDCGKSFIQRIS-LQIHVNSHTGEKPFTC--TECGKCFTQKINLKIHNRIHTGEKPFTCTECGKSFTEKKTLVKHNRT 713          

HSP 3 Score: 83.5741 bits (205), Expect = 1.773e-15
Identity = 73/242 (30.17%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            IH+I +P    F C  C K + +   L++H+K H    EK + C +C      ++ L  H  I+  E    +   C  C + F  +  L +H ++HT +  + C +C +    K  LR H+ +H  EKP+ C   +C ++F     L+NH       +P         C   F  +  L+ H  +H GEK + C   DC +SF  + +L +H+  HTGEKPF C  C     QK +L  H R
Sbjct:  461 IHTIENP----FTCTECGKGFPHMLILQNHIKIHTG--EKPFVCTECGRCFTEKRTLQHHNKIHTGE----KPFICTECGKGFTQKTSLLNHNKIHTGEKPFTCTECGRSFTEKKTLRNHSKIHTGEKPFTCS--DCGKSFAQIISLQNHVTIHTGEKPFT----CTECGKSFSERKTLRDHSKIHTGEKPFTC--TDCGKSFIQRISLQIHVNSHTGEKPFTCTECGKCFTQKINLKIHNR 684          

HSP 4 Score: 81.6481 bits (200), Expect = 7.456e-15
Identity = 73/255 (28.63%), Postives = 105/255 (41.18%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHC-----HWPD---------------------CNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            F C  C K +T +SSL++H K H              ++ + +   L+HM I+  E   T    C  C + F  +  L++H ++HT    + C +C K    K K   H  +H  EKP+ C    C ++F     L+NHK    K+       P   C   F  K  L RHM +H GEK + C     H+ D                     C + F     L  H+  HTGEKPF C  C     +K +L +H
Sbjct:  272 FTCTECGKSFTLKSSLQNHKKTHTGKKHFTCTECGNGFTDKGKH--LRHMRIHIGEKTFT----CTECGKTFTRKASLQNHKKIHTGKKHFTCTECGKGFTDKGKHLRHMRIHLGEKPFTC--TECGKSFTLKSSLQNHK----KIHSGNERFPCMECGKGFTDKGKLLRHMRVHTGEKPFTCTECGKHFIDDIMLQKHKRIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVCTECGRCFTEKRTLQHH 514          

HSP 5 Score: 78.1814 bits (191), Expect = 9.034e-14
Identity = 75/258 (29.07%), Postives = 111/258 (43.02%), Query Frame = 2
Query: 1073 HISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H +    G G  D      H   H   + F C  C K +T ++SL++H K H              ++ + +   L+HM I+  E   T    C  C + F  +  L++H ++H+ +  + C +C K    K KL  H  VH  EKP+ C    C + F     L+ HK    ++   ++      C   F     L+ H+ +H GEK + C   +C R F  + TL  H   HTGEKPF C  C     QK SL  H
Sbjct:  299 HFTCTECGNGFTDKGKHLRHMRIHIGEKTFTCTECGKTFTRKASLQNHKKIHTGKKHFTCTECGKGFTDKGKH--LRHMRIHLGEKPFT----CTECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGKLLRHMRVHTGEKPFTC--TECGKHFIDDIMLQKHK----RIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVC--TECGRCFTEKRTLQHHNKIHTGEKPFICTECGKGFTQKTSLLNH 542          

HSP 6 Score: 67.3958 bits (163), Expect = 1.643e-10
Identity = 66/216 (30.56%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1130 HSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHT 1777
            H+  H   + F C  C K +T ++SL +H K H    EK + C +C  S   +K L  H  I+  E   T    C  C + FA    L++H+ +HT +  + C +C K    +  LR H+ +H  EKP+ C   +C ++F     L+ H +     +P         C   F +K +LK H  +H GEK + C   +C +SF  ++TL  H   HT
Sbjct:  514 HNKIHTGEKPFICTECGKGFTQKTSLLNHNKIHTG--EKPFTCTECGRSFTEKKTLRNHSKIHTGEKPFT----CSDCGKSFAQIISLQNHVTIHTGEKPFTCTECGKSFSERKTLRDHSKIHTGEKPFTCT--DCGKSFIQRISLQIHVNSHTGEKPFT----CTECGKCFTQKINLKIHNRIHTGEKPFTC--TECGKSFTEKKTLVKHNRTHT 715          

HSP 7 Score: 62.3882 bits (150), Expect = 6.968e-9
Identity = 52/167 (31.14%), Postives = 74/167 (44.31%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C  C + F  +  L++H + HT    + C +C      K K   H  +H  EK + C    C + F     L+NHK + H    KKHF   +  K    +  HL RHM +H GEK + C   +C +SF  + +L  H   H+G + F C  C      K  L  H R
Sbjct:  274 CTECGKSFTLKSSLQNHKKTHTGKKHFTCTECGNGFTDKGKHLRHMRIHIGEKTFTCT--ECGKTFTRKASLQNHK-KIH--TGKKHFTCTECGKGFTDKGKHL-RHMRIHLGEKPFTC--TECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGKLLRHMR 432          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000054823.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29736705:29767598:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 4.084e-20
Identity = 83/258 (32.17%), Postives = 122/258 (47.29%), Query Frame = 2
Query: 1073 HISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H +    G+G  D      H   H   + F C  C K +T +SSL++H K H   +          ++ + +  LL+HM ++  E   T    C  C + F  + +L+ H R+HT +N + C +C K     L L+ H  +H  EKP+VC    C R F   + L++H ++ H  + K   C    C   F +K+ L  H  +H GEK + C   +C RSF  ++TL  H   HTGEKPF C  C  S  Q  SL  H
Sbjct:  355 HFTCTECGKGFTDKGKHLRHMRIHLGEKPFTCTECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGK--LLRHMRVHTGEKPFT----CTECGKHFIDDIMLQKHKRIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVC--TECGRCFTEKRTLQHH-NKIHTGE-KPFIC--TECGKGFTQKTSLLNHNKIHTGEKPFTC--TECGRSFTEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNH 598          

HSP 2 Score: 87.8113 bits (216), Expect = 8.505e-17
Identity = 78/245 (31.84%), Postives = 116/245 (47.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            + IH+   P    F C  C +C+T + +L+ H K H    EK + C +C      + +LL H  I+  E   T    C  C R F  +  L++H ++HT +  + C  C K     + L+ H  +H  EKP+ C    C ++F   K L++H  + H  +  K F   D  K   QR S L+ H+  H GEK + C   +C + F  +  L +H   HTGEKPF C  C  S  +K +L  H R 
Sbjct:  487 IKIHTGEKP----FVCTECGRCFTEKRTLQHHNKIHTG--EKPFICTECGKGFTQKTSLLNHNKIHTGEKPFT----CTECGRSFTEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNHVTIHTGEKPFTCT--ECGKSFSERKTLRDH-SKIHTGE--KPFTCTDCGKSFIQRIS-LQIHVNSHTGEKPFTC--TECGKCFTQKINLKIHNRIHTGEKPFTCTECGKSFTEKKTLVKHNRT 713          

HSP 3 Score: 83.5741 bits (205), Expect = 1.773e-15
Identity = 73/242 (30.17%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            IH+I +P    F C  C K + +   L++H+K H    EK + C +C      ++ L  H  I+  E    +   C  C + F  +  L +H ++HT +  + C +C +    K  LR H+ +H  EKP+ C   +C ++F     L+NH       +P         C   F  +  L+ H  +H GEK + C   DC +SF  + +L +H+  HTGEKPF C  C     QK +L  H R
Sbjct:  461 IHTIENP----FTCTECGKGFPHMLILQNHIKIHTG--EKPFVCTECGRCFTEKRTLQHHNKIHTGE----KPFICTECGKGFTQKTSLLNHNKIHTGEKPFTCTECGRSFTEKKTLRNHSKIHTGEKPFTCS--DCGKSFAQIISLQNHVTIHTGEKPFT----CTECGKSFSERKTLRDHSKIHTGEKPFTC--TDCGKSFIQRISLQIHVNSHTGEKPFTCTECGKCFTQKINLKIHNR 684          

HSP 4 Score: 81.6481 bits (200), Expect = 7.456e-15
Identity = 73/255 (28.63%), Postives = 105/255 (41.18%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHC-----HWPD---------------------CNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            F C  C K +T +SSL++H K H              ++ + +   L+HM I+  E   T    C  C + F  +  L++H ++HT    + C +C K    K K   H  +H  EKP+ C    C ++F     L+NHK    K+       P   C   F  K  L RHM +H GEK + C     H+ D                     C + F     L  H+  HTGEKPF C  C     +K +L +H
Sbjct:  272 FTCTECGKSFTLKSSLQNHKKTHTGKKHFTCTECGNGFTDKGKH--LRHMRIHIGEKTFT----CTECGKTFTRKASLQNHKKIHTGKKHFTCTECGKGFTDKGKHLRHMRIHLGEKPFTC--TECGKSFTLKSSLQNHK----KIHSGNERFPCMECGKGFTDKGKLLRHMRVHTGEKPFTCTECGKHFIDDIMLQKHKRIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVCTECGRCFTEKRTLQHH 514          

HSP 5 Score: 78.1814 bits (191), Expect = 9.034e-14
Identity = 75/258 (29.07%), Postives = 111/258 (43.02%), Query Frame = 2
Query: 1073 HISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H +    G G  D      H   H   + F C  C K +T ++SL++H K H              ++ + +   L+HM I+  E   T    C  C + F  +  L++H ++H+ +  + C +C K    K KL  H  VH  EKP+ C    C + F     L+ HK    ++   ++      C   F     L+ H+ +H GEK + C   +C R F  + TL  H   HTGEKPF C  C     QK SL  H
Sbjct:  299 HFTCTECGNGFTDKGKHLRHMRIHIGEKTFTCTECGKTFTRKASLQNHKKIHTGKKHFTCTECGKGFTDKGKH--LRHMRIHLGEKPFT----CTECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGKLLRHMRVHTGEKPFTC--TECGKHFIDDIMLQKHK----RIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVC--TECGRCFTEKRTLQHHNKIHTGEKPFICTECGKGFTQKTSLLNH 542          

HSP 6 Score: 67.3958 bits (163), Expect = 1.643e-10
Identity = 66/216 (30.56%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1130 HSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHT 1777
            H+  H   + F C  C K +T ++SL +H K H    EK + C +C  S   +K L  H  I+  E   T    C  C + FA    L++H+ +HT +  + C +C K    +  LR H+ +H  EKP+ C   +C ++F     L+ H +     +P         C   F +K +LK H  +H GEK + C   +C +SF  ++TL  H   HT
Sbjct:  514 HNKIHTGEKPFICTECGKGFTQKTSLLNHNKIHTG--EKPFTCTECGRSFTEKKTLRNHSKIHTGEKPFT----CSDCGKSFAQIISLQNHVTIHTGEKPFTCTECGKSFSERKTLRDHSKIHTGEKPFTCT--DCGKSFIQRISLQIHVNSHTGEKPFT----CTECGKCFTQKINLKIHNRIHTGEKPFTC--TECGKSFTEKKTLVKHNRTHT 715          

HSP 7 Score: 62.3882 bits (150), Expect = 6.968e-9
Identity = 52/167 (31.14%), Postives = 74/167 (44.31%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C  C + F  +  L++H + HT    + C +C      K K   H  +H  EK + C    C + F     L+NHK + H    KKHF   +  K    +  HL RHM +H GEK + C   +C +SF  + +L  H   H+G + F C  C      K  L  H R
Sbjct:  274 CTECGKSFTLKSSLQNHKKTHTGKKHFTCTECGNGFTDKGKHLRHMRIHIGEKTFTCT--ECGKTFTRKASLQNHK-KIH--TGKKHFTCTECGKGFTDKGKHL-RHMRIHLGEKPFTC--TECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGKLLRHMR 432          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000054822.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29736705:29767598:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 4.084e-20
Identity = 83/258 (32.17%), Postives = 122/258 (47.29%), Query Frame = 2
Query: 1073 HISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H +    G+G  D      H   H   + F C  C K +T +SSL++H K H   +          ++ + +  LL+HM ++  E   T    C  C + F  + +L+ H R+HT +N + C +C K     L L+ H  +H  EKP+VC    C R F   + L++H ++ H  + K   C    C   F +K+ L  H  +H GEK + C   +C RSF  ++TL  H   HTGEKPF C  C  S  Q  SL  H
Sbjct:  355 HFTCTECGKGFTDKGKHLRHMRIHLGEKPFTCTECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGK--LLRHMRVHTGEKPFT----CTECGKHFIDDIMLQKHKRIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVC--TECGRCFTEKRTLQHH-NKIHTGE-KPFIC--TECGKGFTQKTSLLNHNKIHTGEKPFTC--TECGRSFTEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNH 598          

HSP 2 Score: 87.8113 bits (216), Expect = 8.505e-17
Identity = 78/245 (31.84%), Postives = 116/245 (47.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            + IH+   P    F C  C +C+T + +L+ H K H    EK + C +C      + +LL H  I+  E   T    C  C R F  +  L++H ++HT +  + C  C K     + L+ H  +H  EKP+ C    C ++F   K L++H  + H  +  K F   D  K   QR S L+ H+  H GEK + C   +C + F  +  L +H   HTGEKPF C  C  S  +K +L  H R 
Sbjct:  487 IKIHTGEKP----FVCTECGRCFTEKRTLQHHNKIHTG--EKPFICTECGKGFTQKTSLLNHNKIHTGEKPFT----CTECGRSFTEKKTLRNHSKIHTGEKPFTCSDCGKSFAQIISLQNHVTIHTGEKPFTCT--ECGKSFSERKTLRDH-SKIHTGE--KPFTCTDCGKSFIQRIS-LQIHVNSHTGEKPFTC--TECGKCFTQKINLKIHNRIHTGEKPFTCTECGKSFTEKKTLVKHNRT 713          

HSP 3 Score: 83.5741 bits (205), Expect = 1.773e-15
Identity = 73/242 (30.17%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            IH+I +P    F C  C K + +   L++H+K H    EK + C +C      ++ L  H  I+  E    +   C  C + F  +  L +H ++HT +  + C +C +    K  LR H+ +H  EKP+ C   +C ++F     L+NH       +P         C   F  +  L+ H  +H GEK + C   DC +SF  + +L +H+  HTGEKPF C  C     QK +L  H R
Sbjct:  461 IHTIENP----FTCTECGKGFPHMLILQNHIKIHTG--EKPFVCTECGRCFTEKRTLQHHNKIHTGE----KPFICTECGKGFTQKTSLLNHNKIHTGEKPFTCTECGRSFTEKKTLRNHSKIHTGEKPFTCS--DCGKSFAQIISLQNHVTIHTGEKPFT----CTECGKSFSERKTLRDHSKIHTGEKPFTC--TDCGKSFIQRISLQIHVNSHTGEKPFTCTECGKCFTQKINLKIHNR 684          

HSP 4 Score: 81.6481 bits (200), Expect = 7.456e-15
Identity = 73/255 (28.63%), Postives = 105/255 (41.18%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHC-----HWPD---------------------CNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            F C  C K +T +SSL++H K H              ++ + +   L+HM I+  E   T    C  C + F  +  L++H ++HT    + C +C K    K K   H  +H  EKP+ C    C ++F     L+NHK    K+       P   C   F  K  L RHM +H GEK + C     H+ D                     C + F     L  H+  HTGEKPF C  C     +K +L +H
Sbjct:  272 FTCTECGKSFTLKSSLQNHKKTHTGKKHFTCTECGNGFTDKGKH--LRHMRIHIGEKTFT----CTECGKTFTRKASLQNHKKIHTGKKHFTCTECGKGFTDKGKHLRHMRIHLGEKPFTC--TECGKSFTLKSSLQNHK----KIHSGNERFPCMECGKGFTDKGKLLRHMRVHTGEKPFTCTECGKHFIDDIMLQKHKRIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVCTECGRCFTEKRTLQHH 514          

HSP 5 Score: 78.1814 bits (191), Expect = 9.034e-14
Identity = 75/258 (29.07%), Postives = 111/258 (43.02%), Query Frame = 2
Query: 1073 HISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H +    G G  D      H   H   + F C  C K +T ++SL++H K H              ++ + +   L+HM I+  E   T    C  C + F  +  L++H ++H+ +  + C +C K    K KL  H  VH  EKP+ C    C + F     L+ HK    ++   ++      C   F     L+ H+ +H GEK + C   +C R F  + TL  H   HTGEKPF C  C     QK SL  H
Sbjct:  299 HFTCTECGNGFTDKGKHLRHMRIHIGEKTFTCTECGKTFTRKASLQNHKKIHTGKKHFTCTECGKGFTDKGKH--LRHMRIHLGEKPFT----CTECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGKLLRHMRVHTGEKPFTC--TECGKHFIDDIMLQKHK----RIHTIENPFTCTECGKGFPHMLILQNHIKIHTGEKPFVC--TECGRCFTEKRTLQHHNKIHTGEKPFICTECGKGFTQKTSLLNH 542          

HSP 6 Score: 67.3958 bits (163), Expect = 1.643e-10
Identity = 66/216 (30.56%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1130 HSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHT 1777
            H+  H   + F C  C K +T ++SL +H K H    EK + C +C  S   +K L  H  I+  E   T    C  C + FA    L++H+ +HT +  + C +C K    +  LR H+ +H  EKP+ C   +C ++F     L+ H +     +P         C   F +K +LK H  +H GEK + C   +C +SF  ++TL  H   HT
Sbjct:  514 HNKIHTGEKPFICTECGKGFTQKTSLLNHNKIHTG--EKPFTCTECGRSFTEKKTLRNHSKIHTGEKPFT----CSDCGKSFAQIISLQNHVTIHTGEKPFTCTECGKSFSERKTLRDHSKIHTGEKPFTCT--DCGKSFIQRISLQIHVNSHTGEKPFT----CTECGKCFTQKINLKIHNRIHTGEKPFTC--TECGKSFTEKKTLVKHNRTHT 715          

HSP 7 Score: 62.3882 bits (150), Expect = 6.968e-9
Identity = 52/167 (31.14%), Postives = 74/167 (44.31%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C  C + F  +  L++H + HT    + C +C      K K   H  +H  EK + C    C + F     L+NHK + H    KKHF   +  K    +  HL RHM +H GEK + C   +C +SF  + +L  H   H+G + F C  C      K  L  H R
Sbjct:  274 CTECGKSFTLKSSLQNHKKTHTGKKHFTCTECGNGFTDKGKHLRHMRIHIGEKTFTCT--ECGKTFTRKASLQNHK-KIH--TGKKHFTCTECGKGFTDKGKHL-RHMRIHLGEKPFTC--TECGKSFTLKSSLQNHKKIHSGNERFPCMECGKGFTDKGKLLRHMR 432          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000029880.1 (ZFP91 zinc finger protein [Source:NCBI gene;Acc:100488073])

HSP 1 Score: 96.2857 bits (238), Expect = 7.509e-20
Identity = 44/112 (39.29%), Postives = 69/112 (61.61%), Query Frame = 2
Query: 1520 CDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            C+++ C      P+YL++H    H L+ KK+ CP  +C  +F+ +  L RH   H  +++Y C +  C R+F++   L VH + HTGEKP +CE C ++CRQKASLN+H + 
Sbjct:  250 CEMEGCGTVLAHPRYLQHHIKYQHLLK-KKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYICEY--CARAFKSSHNLAVHRMIHTGEKPLQCEFCGFTCRQKASLNWHMKK 358          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp934 (zinc finger protein 934 [Source:MGI Symbol;Acc:MGI:1924367])

HSP 1 Score: 103.99 bits (258), Expect = 1.802e-22
Identity = 84/255 (32.94%), Postives = 121/255 (47.45%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQH--CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+G      L  H   H   Q F CN C+K +    S + HL+ H++I   +   +         K+  KH H+       T     +CD CD+ F+ +  L+ H+R+H+ +  Y+C QC K    K  L+ H  +H  EKPY C+   CD+AF     LK H+      +P K     + C   F +  HL+ H   H GEK Y C+   C+++F    TL  H   HTGEKP+KC  CD +  +K SL  H R
Sbjct:  139 GKGFAKPSHLKRHERYHTGEQPFTCNECDKVF----SFKHHLQTHISIRTGEKPFKCNLCD----KSFSKHNHLQSHRRTHTGEKPYKCDQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKCHLQKHIRIHTGEKPYKCN--QCDKAFSQYNTLKTHRRTHTGEKPYK----CNQCDKAFSQYGHLQTHRRTHTGEKPYKCN--QCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSEKCSLQRHIR 377          

HSP 2 Score: 99.3673 bits (246), Expect = 5.484e-21
Identity = 82/265 (30.94%), Postives = 129/265 (48.68%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD-------CERLLGLK 1894
            L  H  +H   + ++C+ C+K ++ + +L++H++ H      K      ++S +   +L KH+ I+  E       +C+ CD+ F+    LK H R HT +  Y+C QC K       L+ H   H  EKPY C+   CD+AF     LK H+      +P K     + C   F  K  L+RH+ +H GEK Y C+   C+++F    TL  H   HTGEKP+KC  CD +  Q ++L  H R  H  +       C++   +K
Sbjct:  204 LQSHRRTHTGEKPYKCDQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKC--HLQKHIRIHTGEKPY----KCNQCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSQYGHLQTHRRTHTGEKPYKCN--QCDKAFSQYNTLKTHRRTHTGEKPYK----CNQCDKAFSEKCSLQRHIRIHTGEKPYKCN--QCDKAFSQYSTLQTHRRTHTGEKPYKCNQCDKAFSQYSNLQTH-RRTHTGEKPYKCNQCDKAFSMK 453          

HSP 3 Score: 83.1889 bits (204), Expect = 9.612e-16
Identity = 69/226 (30.53%), Postives = 111/226 (49.12%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC 1798
            + IH+   P    ++CN C+K ++  ++L++H + H   ++     +     SQY      H+  +       +  +C+ CD+ F+    LK H R HT +  Y+C QC K    K  L+ H  +H  EKPY C+   CD+AF     L+ H+      +P K     + C   F + S+L+ H   H GEK Y C+   C+++F  +  L  H+  HTG+KPFKC
Sbjct:  264 IRIHTGEKP----YKCNQCDKAFSQYNTLKTHRRTHTG-EKPYKCNQCDKAFSQY-----GHLQTHRRTHTGEKPYKCNQCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSEKCSLQRHIRIHTGEKPYKCN--QCDKAFSQYSTLQTHRRTHTGEKPYK----CNQCDKAFSQYSNLQTHRRTHTGEKPYKCN--QCDKAFSMKCNLQNHVRIHTGQKPFKC 471          

HSP 4 Score: 64.3142 bits (155), Expect = 8.234e-10
Identity = 50/154 (32.47%), Postives = 75/154 (48.70%), Query Frame = 2
Query: 1391 LKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L+ H R  T    Y+C+QC K       L+ H   H  E+P+ C  + CD+ F    +L+ H       +P K     + C   F + +HL+ H   H GEK Y C    C+++F  +  L  H+  H+GEKP+KC+ CD +  +K  L  H R
Sbjct:  120 LQVHKRTQTGQKPYECKQCGKGFAKPSHLKRHERYHTGEQPFTC--NECDKVFSFKHHLQTHISIRTGEKPFK----CNLCDKSFSKHNHLQSHRRTHTGEKPYKC--DQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKCHLQKHIR 265          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp934 (zinc finger protein 934 [Source:MGI Symbol;Acc:MGI:1924367])

HSP 1 Score: 103.219 bits (256), Expect = 2.303e-22
Identity = 84/255 (32.94%), Postives = 121/255 (47.45%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQH--CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+G      L  H   H   Q F CN C+K +    S + HL+ H++I   +   +         K+  KH H+       T     +CD CD+ F+ +  L+ H+R+H+ +  Y+C QC K    K  L+ H  +H  EKPY C+   CD+AF     LK H+      +P K     + C   F +  HL+ H   H GEK Y C+   C+++F    TL  H   HTGEKP+KC  CD +  +K SL  H R
Sbjct:  107 GKGFAKPSHLKRHERYHTGEQPFTCNECDKVF----SFKHHLQTHISIRTGEKPFKCNLCD----KSFSKHNHLQSHRRTHTGEKPYKCDQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKCHLQKHIRIHTGEKPYKCN--QCDKAFSQYNTLKTHRRTHTGEKPYK----CNQCDKAFSQYGHLQTHRRTHTGEKPYKCN--QCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSEKCSLQRHIR 345          

HSP 2 Score: 98.9821 bits (245), Expect = 6.406e-21
Identity = 82/265 (30.94%), Postives = 129/265 (48.68%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD-------CERLLGLK 1894
            L  H  +H   + ++C+ C+K ++ + +L++H++ H      K      ++S +   +L KH+ I+  E       +C+ CD+ F+    LK H R HT +  Y+C QC K       L+ H   H  EKPY C+   CD+AF     LK H+      +P K     + C   F  K  L+RH+ +H GEK Y C+   C+++F    TL  H   HTGEKP+KC  CD +  Q ++L  H R  H  +       C++   +K
Sbjct:  172 LQSHRRTHTGEKPYKCDQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKC--HLQKHIRIHTGEKPY----KCNQCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSQYGHLQTHRRTHTGEKPYKCN--QCDKAFSQYNTLKTHRRTHTGEKPYK----CNQCDKAFSEKCSLQRHIRIHTGEKPYKCN--QCDKAFSQYSTLQTHRRTHTGEKPYKCNQCDKAFSQYSNLQTH-RRTHTGEKPYKCNQCDKAFSMK 421          

HSP 3 Score: 82.4185 bits (202), Expect = 1.306e-15
Identity = 69/226 (30.53%), Postives = 111/226 (49.12%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC 1798
            + IH+   P    ++CN C+K ++  ++L++H + H   ++     +     SQY      H+  +       +  +C+ CD+ F+    LK H R HT +  Y+C QC K    K  L+ H  +H  EKPY C+   CD+AF     L+ H+      +P K     + C   F + S+L+ H   H GEK Y C+   C+++F  +  L  H+  HTG+KPFKC
Sbjct:  232 IRIHTGEKP----YKCNQCDKAFSQYNTLKTHRRTHTG-EKPYKCNQCDKAFSQY-----GHLQTHRRTHTGEKPYKCNQCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSEKCSLQRHIRIHTGEKPYKCN--QCDKAFSQYSTLQTHRRTHTGEKPYK----CNQCDKAFSQYSNLQTHRRTHTGEKPYKCN--QCDKAFSMKCNLQNHVRIHTGQKPFKC 439          

HSP 4 Score: 63.5438 bits (153), Expect = 1.220e-9
Identity = 50/154 (32.47%), Postives = 75/154 (48.70%), Query Frame = 2
Query: 1391 LKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L+ H R  T    Y+C+QC K       L+ H   H  E+P+ C  + CD+ F    +L+ H       +P K     + C   F + +HL+ H   H GEK Y C    C+++F  +  L  H+  H+GEKP+KC+ CD +  +K  L  H R
Sbjct:   88 LQVHKRTQTGQKPYECKQCGKGFAKPSHLKRHERYHTGEQPFTC--NECDKVFSFKHHLQTHISIRTGEKPFK----CNLCDKSFSKHNHLQSHRRTHTGEKPYKC--DQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKCHLQKHIR 233          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Gm6871 (predicted gene 6871 [Source:MGI Symbol;Acc:MGI:3643456])

HSP 1 Score: 104.375 bits (259), Expect = 2.714e-22
Identity = 79/245 (32.24%), Postives = 113/245 (46.12%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            L  H  +H   + + C+ C K +  QS+L  H + H      +      +++  +   L K  H             CD C + FA +  L  H R HT +  Y+C QC K       LR H  VH  EKPY C+   CD+AF    +L+ H+      +P K     + C   F   SHL+ H  +H GEK Y C+   C+++F    +L +H   HTGEKP+KC  CD +  Q +SL YH R 
Sbjct:  253 LRTHERTHTGKKPYECDQCGKAFAYQSALVLHKRTHTGEKPYECDQCGKAFAHHFTVVLHKRTHTGEKPYE------CDQCGKAFAYQSALVLHKRTHTGEKPYECNQCGKTFAQINHLRTHKVVHTGEKPYKCN--QCDKAFSQQSHLRIHERTHTGEKPYK----CNQCGKSFVSHSHLQSHGRIHTGEKPYKCN--QCDKAFAQHNSLQIHKRTHTGEKPYKCNQCDKAFAQSSSLQYHKRT 483          

HSP 2 Score: 91.6633 bits (226), Expect = 2.892e-18
Identity = 76/250 (30.40%), Postives = 117/250 (46.80%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHC-----RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            + +H  +H   + + C+ C K +  QS+L  H + H          EK    +Q  K   +   INH   +   H      +C+ CD+ F+ +  L+ H R HT +  Y+C QC K   +   L+ H  +H  EKPY C+   CD+AF     L+ HK      +P K     + C   F + S L+ H   H GEK Y C    C ++F    T+ +H   HTGEKP++C+ C  +    ++L YH +N
Sbjct:  309 VVLHKRTHTGEKPYECDQCGKAFAYQSALVLHKRTHTG--------EKPYECNQCGKTFAQ---INHLRTHKVVHTGEKPYKCNQCDKAFSQQSHLRIHERTHTGEKPYKCNQCGKSFVSHSHLQSHGRIHTGEKPYKCN--QCDKAFAQHNSLQIHKRTHTGEKPYK----CNQCDKAFAQSSSLQYHKRTHTGEKPYEC--DQCGKAFTHPSTVVLHKRTHTGEKPYECDQCGKAFAHHSTLQYHKKN 539          

HSP 3 Score: 70.8626 bits (172), Expect = 9.937e-12
Identity = 62/202 (30.69%), Postives = 92/202 (45.54%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHI-NHAEINDTQH-CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGE 1693
            G+    ++ L  H + H   + ++CN C+K ++ QS LR H + H          EK    +Q  K+ + H H+ +H  I+  +   +C+ CD+ FA    L+ H R HT +  Y+C QC K       L+YH   H  EKPY C  D C +AF  P  +  HK      +P +     D C   F   S L+ H   H  E
Sbjct:  356 GKTFAQINHLRTHKVVHTGEKPYKCNQCDKAFSQQSHLRIHERTHTG--------EKPYKCNQCGKSFVSHSHLQSHGRIHTGEKPYKCNQCDKAFAQHNSLQIHKRTHTGEKPYKCNQCDKAFAQSSSLQYHKRTHTGEKPYEC--DQCGKAFTHPSTVVLHKRTHTGEKPYE----CDQCGKAFAHHSTLQYHKKNHTEE 543          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Gm5141 (predicted gene 5141 [Source:MGI Symbol;Acc:MGI:3779466])

HSP 1 Score: 103.605 bits (257), Expect = 5.147e-22
Identity = 82/244 (33.61%), Postives = 131/244 (53.69%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H  +H   + F+CN C+K ++ + SL+ H+  H    EK YKC +C  +  ++++LL H+ I+  E       +C+ CD+ F+ + +LK+H+R+H+ +  Y+C  C K       L+ H   H  EKPY C+   CD+AF   K L+ H+      +P K     + C   F  K  L+ H+  H GEK Y C+   C+++F  ++ L +H+  HTGEKP+KC  CD +   K +L  H R
Sbjct:  231 LQNHRRTHTGEKPFKCNECDKAFSEKGSLQKHISIHTG--EKPYKCNQCDKAFSHKQSLLIHIRIHTGEKPY----KCNQCDKAFSHKHILKNHIRIHSGEKPYKCNLCDKVFSRHFHLQNHIRTHTGEKPYRCN--QCDKAFSHHKTLQTHRKTHTGEKPFK----CNECDKAFSEKGSLQSHIRTHTGEKPYKCN--QCDKAFSHKQNLQIHIRIHTGEKPYKCNQCDKAFSYKQNLQIHIR 460          

HSP 2 Score: 101.293 bits (251), Expect = 2.725e-21
Identity = 84/245 (34.29%), Postives = 122/245 (49.80%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            L  H  +H   + F+CN C K +++  +L++H + H   ++     E     SQ+  NL  H   +  E       +C+ CD+ F+ +  L+ H+ +HT +  Y+C QC K    K  L  H  +H  EKPY C+   CD+AF     LKNH       +P K     + C  VF R  HL+ H+  H GEK Y C+   C+++F   +TL  H   HTGEKPFKC  CD +  +K SL  H R 
Sbjct:  175 LQRHIRTHTGEKPFKCNQCEKAFSHHCNLQTHRRTHTR-EKPFKCNECDKAFSQF-GNLQNHRRTHTGEKPF----KCNECDKAFSEKGSLQKHISIHTGEKPYKCNQCDKAFSHKQSLLIHIRIHTGEKPYKCN--QCDKAFSHKHILKNHIRIHSGEKPYK----CNLCDKVFSRHFHLQNHIRTHTGEKPYRCN--QCDKAFSHHKTLQTHRKTHTGEKPFKCNECDKAFSEKGSLQSHIRT 405          

HSP 3 Score: 100.138 bits (248), Expect = 5.891e-21
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHI--NHAEINDTQH-CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            + IH+   P    ++CN C+K ++++ SL  H++ H      K                  H HI  NH  I+  +   +C++CD++F+  F L++H+R HT +  Y+C QC K       L+ H   H  EKP+ C+   CD+AF     L++H       +P K     + C   F  K +L+ H+ +H GEK Y C+   C+++F  ++ L +H+  HTGEKP+KC  CD +   + +L  H R  H +D
Sbjct:  263 ISIHTGEKP----YKCNQCDKAFSHKQSLLIHIRIHTGEKPYKCNQCD---------KAFSHKHILKNHIRIHSGEKPYKCNLCDKVFSRHFHLQNHIRTHTGEKPYRCNQCDKAFSHHKTLQTHRKTHTGEKPFKCN--ECDKAFSEKGSLQSHIRTHTGEKPYK----CNQCDKAFSHKQNLQIHIRIHTGEKPYKCN--QCDKAFSYKQNLQIHIRIHTGEKPYKCNQCDKAFLHQGNLQTH-RRTHTRD 493          

HSP 4 Score: 93.5893 bits (231), Expect = 8.541e-19
Identity = 72/236 (30.51%), Postives = 110/236 (46.61%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD--YSCR 1822
            L  H  +H   + F+CN C+K ++ + SL+SH++ H                                        +C+ CD+ F+ +  L+ H+R+HT +  Y+C QC K    K  L+ H  +H  EKPY C+   CD+AF     L+ H+    + +P +     + C  VF R  HL+ H+  H  EK Y C+  +C + F    +L  H   HTGEKPFKC  CD  +SC+
Sbjct:  371 LQTHRKTHTGEKPFKCNECDKAFSEKGSLQSHIRTHTGEKPY----------------------------------KCNQCDKAFSHKQNLQIHIRIHTGEKPYKCNQCDKAFSYKQNLQIHIRIHTGEKPYKCN--QCDKAFLHQGNLQTHRRTHTRDKPFQ----CNLCDKVFSRHFHLQNHIRTHTREKPYKCN--ECGKGFSQHSSLQTHRRTHTGEKPFKCNQCDKAFSCK 564          

HSP 5 Score: 88.9669 bits (219), Expect = 2.112e-17
Identity = 58/168 (34.52%), Postives = 93/168 (55.36%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +C+ CD+ F+ ++ L+ H+R HT +  ++C QC K       L+ H   H  EKP+ C  + CD+AF     L+NH+      +P K     + C   F  K  L++H+++H GEK Y C+   C+++F  +++L +H+  HTGEKP+KC  CD +   K  L  H R
Sbjct:  161 KCNQCDKAFSLKYSLQRHIRTHTGEKPFKCNQCEKAFSHHCNLQTHRRTHTREKPFKC--NECDKAFSQFGNLQNHRRTHTGEKPFK----CNECDKAFSEKGSLQKHISIHTGEKPYKCN--QCDKAFSHKQSLLIHIRIHTGEKPYKCNQCDKAFSHKHILKNHIR 320          

HSP 6 Score: 63.1586 bits (152), Expect = 2.581e-9
Identity = 51/152 (33.55%), Postives = 72/152 (47.37%), Query Frame = 2
Query: 1391 LKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L+ H R  T    Y+ +QC K       L+ H  +H  EKPY C  + CD+AF     L+ H       +P K     + C+  F    +L+ H   H  EK + C+  +C+++F     L  H   HTGEKPFKC  CD +  +K SL  H
Sbjct:  119 LQVHKRAQTGQKQYEYKQCGKGFACPSLLKRHERIHTVEKPYKC--NQCDKAFSLKYSLQRHIRTHTGEKPFK----CNQCEKAFSHHCNLQTHRRTHTREKPFKCN--ECDKAFSQFGNLQNHRRTHTGEKPFKCNECDKAFSEKGSLQKH 262          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Gm5141 (predicted gene 5141 [Source:MGI Symbol;Acc:MGI:3779466])

HSP 1 Score: 103.605 bits (257), Expect = 5.405e-22
Identity = 82/244 (33.61%), Postives = 131/244 (53.69%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H  +H   + F+CN C+K ++ + SL+ H+  H    EK YKC +C  +  ++++LL H+ I+  E       +C+ CD+ F+ + +LK+H+R+H+ +  Y+C  C K       L+ H   H  EKPY C+   CD+AF   K L+ H+      +P K     + C   F  K  L+ H+  H GEK Y C+   C+++F  ++ L +H+  HTGEKP+KC  CD +   K +L  H R
Sbjct:  232 LQNHRRTHTGEKPFKCNECDKAFSEKGSLQKHISIHTG--EKPYKCNQCDKAFSHKQSLLIHIRIHTGEKPY----KCNQCDKAFSHKHILKNHIRIHSGEKPYKCNLCDKVFSRHFHLQNHIRTHTGEKPYRCN--QCDKAFSHHKTLQTHRKTHTGEKPFK----CNECDKAFSEKGSLQSHIRTHTGEKPYKCN--QCDKAFSHKQNLQIHIRIHTGEKPYKCNQCDKAFSYKQNLQIHIR 461          

HSP 2 Score: 101.293 bits (251), Expect = 2.911e-21
Identity = 84/245 (34.29%), Postives = 122/245 (49.80%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            L  H  +H   + F+CN C K +++  +L++H + H   ++     E     SQ+  NL  H   +  E       +C+ CD+ F+ +  L+ H+ +HT +  Y+C QC K    K  L  H  +H  EKPY C+   CD+AF     LKNH       +P K     + C  VF R  HL+ H+  H GEK Y C+   C+++F   +TL  H   HTGEKPFKC  CD +  +K SL  H R 
Sbjct:  176 LQRHIRTHTGEKPFKCNQCEKAFSHHCNLQTHRRTHTR-EKPFKCNECDKAFSQF-GNLQNHRRTHTGEKPF----KCNECDKAFSEKGSLQKHISIHTGEKPYKCNQCDKAFSHKQSLLIHIRIHTGEKPYKCN--QCDKAFSHKHILKNHIRIHSGEKPYK----CNLCDKVFSRHFHLQNHIRTHTGEKPYRCN--QCDKAFSHHKTLQTHRKTHTGEKPFKCNECDKAFSEKGSLQSHIRT 406          

HSP 3 Score: 100.138 bits (248), Expect = 6.459e-21
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHI--NHAEINDTQH-CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            + IH+   P    ++CN C+K ++++ SL  H++ H      K                  H HI  NH  I+  +   +C++CD++F+  F L++H+R HT +  Y+C QC K       L+ H   H  EKP+ C+   CD+AF     L++H       +P K     + C   F  K +L+ H+ +H GEK Y C+   C+++F  ++ L +H+  HTGEKP+KC  CD +   + +L  H R  H +D
Sbjct:  264 ISIHTGEKP----YKCNQCDKAFSHKQSLLIHIRIHTGEKPYKCNQCD---------KAFSHKHILKNHIRIHSGEKPYKCNLCDKVFSRHFHLQNHIRTHTGEKPYRCNQCDKAFSHHKTLQTHRKTHTGEKPFKCN--ECDKAFSEKGSLQSHIRTHTGEKPYK----CNQCDKAFSHKQNLQIHIRIHTGEKPYKCN--QCDKAFSYKQNLQIHIRIHTGEKPYKCNQCDKAFLHQGNLQTH-RRTHTRD 494          

HSP 4 Score: 93.5893 bits (231), Expect = 8.955e-19
Identity = 72/236 (30.51%), Postives = 110/236 (46.61%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD--YSCR 1822
            L  H  +H   + F+CN C+K ++ + SL+SH++ H                                        +C+ CD+ F+ +  L+ H+R+HT +  Y+C QC K    K  L+ H  +H  EKPY C+   CD+AF     L+ H+    + +P +     + C  VF R  HL+ H+  H  EK Y C+  +C + F    +L  H   HTGEKPFKC  CD  +SC+
Sbjct:  372 LQTHRKTHTGEKPFKCNECDKAFSEKGSLQSHIRTHTGEKPY----------------------------------KCNQCDKAFSHKQNLQIHIRIHTGEKPYKCNQCDKAFSYKQNLQIHIRIHTGEKPYKCN--QCDKAFLHQGNLQTHRRTHTRDKPFQ----CNLCDKVFSRHFHLQNHIRTHTREKPYKCN--ECGKGFSQHSSLQTHRRTHTGEKPFKCNQCDKAFSCK 565          

HSP 5 Score: 88.9669 bits (219), Expect = 2.232e-17
Identity = 58/168 (34.52%), Postives = 93/168 (55.36%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +C+ CD+ F+ ++ L+ H+R HT +  ++C QC K       L+ H   H  EKP+ C  + CD+AF     L+NH+      +P K     + C   F  K  L++H+++H GEK Y C+   C+++F  +++L +H+  HTGEKP+KC  CD +   K  L  H R
Sbjct:  162 KCNQCDKAFSLKYSLQRHIRTHTGEKPFKCNQCEKAFSHHCNLQTHRRTHTREKPFKC--NECDKAFSQFGNLQNHRRTHTGEKPFK----CNECDKAFSEKGSLQKHISIHTGEKPYKCN--QCDKAFSHKQSLLIHIRIHTGEKPYKCNQCDKAFSHKHILKNHIR 321          

HSP 6 Score: 62.7734 bits (151), Expect = 2.675e-9
Identity = 51/152 (33.55%), Postives = 72/152 (47.37%), Query Frame = 2
Query: 1391 LKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L+ H R  T    Y+ +QC K       L+ H  +H  EKPY C  + CD+AF     L+ H       +P K     + C+  F    +L+ H   H  EK + C+  +C+++F     L  H   HTGEKPFKC  CD +  +K SL  H
Sbjct:  120 LQVHKRAQTGQKQYEYKQCGKGFACPSLLKRHERIHTVEKPYKC--NQCDKAFSLKYSLQRHIRTHTGEKPFK----CNQCEKAFSHHCNLQTHRRTHTREKPFKCN--ECDKAFSQFGNLQNHRRTHTGEKPFKCNECDKAFSEKGSLQKH 263          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q0VGE8|ZN816_HUMAN (Zinc finger protein 816 OS=Homo sapiens OX=9606 GN=ZNF816 PE=2 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 2.137e-22
Identity = 82/246 (33.33%), Postives = 122/246 (49.59%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + ++CN C K ++ +SSL+ H   H      K +     Y  +   +L +H  I+  E +     +C +CD++F S+  L +H R+HT +  Y+C +C +    K  L+YH  +H  EKPY C  + C + F   + L  H    H+L   +     + C  VF R+SHL+RH  +H GEK Y C    C+++FR+   L  H   HTGEKP+KC  C     QK  L  H R
Sbjct:  354 SALVIHKAIHTGEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRR--SHLERHRKIHTGEGSY----KCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTC--NECGKVFSRRENLARH----HRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKC--KVCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQR 585          

HSP 2 Score: 91.6633 bits (226), Expect = 2.684e-17
Identity = 73/253 (28.85%), Postives = 115/253 (45.45%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+    +  L  H   H   + ++CN C K ++ +SSLR H + H      K      ++       + K +H            +C+ C + F+ +  L+ H  +HT +  Y+C++C      +  L  H  +H  E  Y C +  CD+ FR+  YL  H+      +P K     + C   F RKS L+ H  +H GEK Y C+  +C + F  +E L  H   H GEKP+KCE CD    +++ L  H R
Sbjct:  291 GKTFTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPY------KCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKCKV--CDKVFRSDSYLAEHQRVHTGEKPYK----CNKCGRSFSRKSSLQYHHTLHTGEKPYTCN--ECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRR 529          

HSP 3 Score: 91.2781 bits (225), Expect = 3.597e-17
Identity = 72/242 (29.75%), Postives = 117/242 (48.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H I+H   ++++C+ C K +  +  +  H + H      K      +++     +L+ H  ++  E    +  +C+ C + F+ +  L+ H R+HT +  Y+C +C K       L  H  +H  EKPY C  + C + F     L+ H    H L   +     + C  V+ R+SHL+RH  +H GE +Y C    C++ FR+   L  H   HTGEKP+KC  C  S  +K+SL YH
Sbjct:  244 LRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQ--MSSLVCHRRLHTGE----KPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPYKC--NECGKTFSQKSSLQCH----HILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKC--KVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYH 471          

HSP 4 Score: 80.8777 bits (198), Expect = 5.369e-14
Identity = 72/242 (29.75%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H   H     ++C  C+K + + S L  H + H      K      S+S   +K+ L++ H  H          C+ C ++F+    L  H R+H  +  Y+C++C K    +  L  H  +H  EKPY C +  CD+AFR+   L NH       +P K     + C  VF +K  L +H  +H GEK Y C+  +C + F  + +L  H   HT EKP+KC  C  +   +++L +H
Sbjct:  412 LERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFS---RKSSLQYHHTLHTGEKPYT---CNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLANHTRVHTGEKPYK----CNKCAKVFNQKGILAQHQRVHTGEKPYKCN--ECGKVFNQKASLAKHQRVHTAEKPYKCNECGKAFTGQSTLIHH 639          

HSP 5 Score: 75.0998 bits (183), Expect = 3.770e-12
Identity = 56/185 (30.27%), Postives = 81/185 (43.78%), Query Frame = 2
Query: 1292 NLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +LL+  HI H+   +    +CD+C ++F  +  +  H R HT + TY+C +C K       L  H  +H  EKPY C+                                   C   F  KS L+ H  +H GEK Y C+  +C ++F     L +H   HTGEKP+KC  C  +  QK+SL  H
Sbjct:  242 SLLRRHHITHSREREY---KCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSLVCHRRLHTGEKPYKCN----------------------------------ECGKTFSEKSSLRCHRRLHTGEKPYKCN--ECGKTFGRNSALVIHKAIHTGEKPYKCNECGKTFSQKSSLQCH 387          

HSP 6 Score: 61.2326 bits (147), Expect = 6.318e-8
Identity = 39/116 (33.62%), Postives = 57/116 (49.14%), Query Frame = 2
Query: 1505 EKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            EKP  C  + C +AF     L+ H    H    ++     D C  +F +K ++  H   H GEK Y C+  +C ++F    +L  H   HTGEKP+KC  C  +  +K+SL  H R
Sbjct:  226 EKP--CQSNECGKAFNYSSLLRRH----HITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCN--ECGKTFTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRR 333          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q6ZMW2|ZN782_HUMAN (Zinc finger protein 782 OS=Homo sapiens OX=9606 GN=ZNF782 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.427e-22
Identity = 83/250 (33.20%), Postives = 126/250 (50.40%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            L +H  +H   + F CN C K +++ S LR+H + H    E+ YKC++C  + + +  L KH   +  E    +  +C+ C + F  +  L+ H R+HT +  Y+C  C +    K  LR H   H  EKPY C+   C + FR    L+ H+      +P +     + C   F  KS L++H   H GEK Y+C+   C  +F  +  L VH   HTGEKP+KC+ C  +  QK+SL  H + AH  D
Sbjct:  465 LIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTG--ERPYKCDECGKAFKLKSGLRKHHRTHTGE----KPYKCNQCGKAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCE--ECGKTFRQKSNLRGHQRTHTGEKPYE----CNECGKAFSEKSVLRKHQRTHTGEKPYNCN--QCGEAFSQKSNLRVHQRTHTGEKPYKCDKCGRTFSQKSSLREH-QKAHPGD 699          

HSP 2 Score: 94.7449 bits (234), Expect = 2.995e-18
Identity = 79/254 (31.10%), Postives = 125/254 (49.21%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            G+   +   L  H  +H   + ++C+ C+K ++ +S LR H + H    EK ++C +C  S  Y+  L+ H   +  E    +   C+ C + F+    L++H R HT +  Y+C +C K  K K  LR H   H  EKPY C  + C +AF     L+ H    H++   +     + C   F +KS+L+ H   H GEK Y C   +C ++FR +  L  H   HTGEKP++C  C  +  +K+ L  H R 
Sbjct:  400 GKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTG--EKPFECHECGKSFNYKSILIVHQRTHTGE----KPFECNECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKC--NQCGKAFGQKSQLRGH----HRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQC--EECGKTFRQKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKHQRT 639          

HSP 3 Score: 92.0485 bits (227), Expect = 2.087e-17
Identity = 72/239 (30.13%), Postives = 108/239 (45.19%), Query Frame = 2
Query: 1139 SHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            SH   + + C  C K ++ +S LR H + H      K      ++S++    + +  H             C  C + F  + +L  H R HT +  ++C +C K       LR H   H  E+PY CD   C +AF+    L+ H       +P K     + C   F +KS L+ H  +H GEK Y C+   C  +F  +  L VH   HTGEKP++CE C  + RQK++L  H R 
Sbjct:  387 SHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTGEKPFE------CHECGKSFNYKSILIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTGERPYKCD--ECGKAFKLKSGLRKHHRTHTGEKPYK----CNQCGKAFGQKSQLRGHHRIHTGEKPYKCN--HCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFRQKSNLRGHQRT 611          

HSP 4 Score: 56.9954 bits (136), Expect = 1.264e-6
Identity = 50/186 (26.88%), Postives = 78/186 (41.94%), Query Frame = 2
Query: 1316 NHAEINDTQHCRCDIC------DRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            +H E NDT +C C I        + F+ +  +++H R+H     ++  +   +  T      H   H  +K    D   C   F        H+    + +P ++    + C       SHL      H GEK Y C  P+C ++F  +  L  H   HTGEKP+KC+ CD +   K+ L  H R 
Sbjct:  269 SHYEFNDTGNCFCRITHKTLTGGKSFSQKSHIREHHRVHIGVKPFEYGKSFNRNSTLPV---HQRTHATDK--YSDYHPCTETFSYQSTFSVHQKVHIRAKPYEY----NECGKSCSMNSHLIWPQKSHTGEKPYEC--PECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRT 443          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|P17035|ZNF28_HUMAN (Zinc finger protein 28 OS=Homo sapiens OX=9606 GN=ZNF28 PE=1 SV=5)

HSP 1 Score: 107.071 bits (266), Expect = 5.805e-22
Identity = 88/242 (36.36%), Postives = 130/242 (53.72%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  HSI H   + ++CN C K +  QS+L  H + H    EK YKCE+C    + + +L +H  I+  E    +  +C +CD+ F S+  L +H R+HT +  Y C +C K   TK  L  H  +H  EKPY C+   C++ F    +++ H+      +P K  C V  C   F+R SHL +H  +H GEK Y C+  +C ++FR   +L +H   HTGEKP+KC  C  +  Q +SL YH
Sbjct:  426 LAKHSIIHTGEKPYKCNECGKVFNQQSTLARHHRLH--TAEKPYKCEECDKVFRCKSHLERHRRIHTGE----KPYKCKVCDKAFRSDSCLTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLHTAEKPYKCE--ECEKVFSRKSHMERHRRIHTGEKPYK--CKV--CDKAFRRDSHLAQHQRVHTGEKPYKCN--ECGKTFRQTSSLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYH 653          

HSP 2 Score: 88.9669 bits (219), Expect = 2.111e-16
Identity = 87/308 (28.25%), Postives = 133/308 (43.18%), Query Frame = 2
Query: 1031 NPQSYPVNDMRSQFHISMMMNGQGNVDVDP--------LPIHSISHPHIQDFRCNYCNKCYTNQSSL------------------------RSHLKKHMNIDXXXXXXXXXXXXXQYQKN--LLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            + +S+  + +  +  I+ +   Q   DV          L  H  SH   + ++CN C K + + +SL                        +SHL+ H  I       +       +  N  L KH  I+  E    +  +C+ C ++F     L  H R+HT +  Y+C++C K    K  L  H  +H  EKPY C +  CD+AF    YL  H       +P K     + C  VF ++S L RH  +H  EK Y C   +C++ FR +  L  H   HTGEKP+KC++CD + R  + L  H R
Sbjct:  220 SGKSFNCSSLLKKHQITHLEEKQCKCDVYGKVFNQKRYLACHRRSHIDEKPYKCNECGKIFGHNTSLFLHKALHTADKPYECEECDKVFSRKSHLETHKIIYTGGKPYKCKVCDKAFTCNSYLAKHTIIHTGE----KPYKCNECGKVFNRLSTLARHRRLHTGEKPYECEECEKVFSRKSHLERHKRIHTGEKPYKCKV--CDKAFAYNSYLAKHSIIHTGEKPYK----CNECGKVFNQQSTLARHHRLHTAEKPYKC--EECDKVFRCKSHLERHRRIHTGEKPYKCKVCDKAFRSDSCLTEHQR 515          

HSP 3 Score: 79.337 bits (194), Expect = 1.816e-13
Identity = 76/242 (31.40%), Postives = 116/242 (47.93%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H   H   + ++C  C+K + + S L  H + H    EK Y C +C      + NL  H  ++ AE    +  +C+ C+++F+ +  ++ H R+HT +  Y+C+ C K  +    L  H  VH  EKPY C+   C + FR    L  H+      +P K     + C   F + S L  H  +H GEK Y C+  +C + F  Q  L  H   HTGEKP+KC  C  +  Q ++L YH
Sbjct:  482 LERHRRIHTGEKPYKCKVCDKAFRSDSCLTEHQRVHTG--EKPYMCNECGKVFSTKANLACHHKLHTAE----KPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKVCDKAFRRDSHLAQHQRVHTGEKPYKCN--ECGKTFRQTSSLIIHRRLHTGEKPYK----CNECGKTFSQMSSLVYHHRLHSGEKPYKCN--ECGKVFNQQAHLAQHQRVHTGEKPYKCNECGKTFSQMSNLVYH 709          

HSP 4 Score: 70.0922 bits (170), Expect = 1.513e-10
Identity = 69/223 (30.94%), Postives = 108/223 (48.43%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKP 1789
            L  H   H   + + CN C K ++ +++L  H K H    EK YKCE+C      + ++ +H  I+  E    +  +C +CD+ F  +  L  H R+HT +  Y+C +C K  +    L  H  +H  EKPY C+   C + F     L  H    H+L   +     + C  VF +++HL +H  +H GEK Y C+  +C ++F     L  H   H+GEKP
Sbjct:  510 LTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLH--TAEKPYKCEECEKVFSRKSHMERHRRIHTGE----KPYKCKVCDKAFRRDSHLAQHQRVHTGEKPYKCNECGKTFRQTSSLIIHRRLHTGEKPYKCN--ECGKTFSQMSSLVYH----HRLHSGEKPYKCNECGKVFNQQAHLAQHQRVHTGEKPYKCN--ECGKTFSQMSNLVYHHRLHSGEKP 718          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|O43345|ZN208_HUMAN (Zinc finger protein 208 OS=Homo sapiens OX=9606 GN=ZNF208 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.435e-20
Identity = 82/251 (32.67%), Postives = 125/251 (49.80%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+  + V  L  H   H   + ++C  C K ++  S L  H  K ++  EK YKCE+C  +  +  NL++H  I+  E       +C+ C + F++  +L  H  +HT +  Y+C++C K  K    L YH  +H  EKPY C+   C +AF     L  HK      +P K     + C   F + S L  H A+H GEK Y C   +C ++F     L  H + HTGEKP+KCE C  + +  ++L+YH
Sbjct:  643 GKTFIKVSTLTTHKAIHAGEKPYKCKECGKAFSKFSILTKH--KVIHTGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKPY----KCEECGKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCE--ECGKAFNRSAILIKHKRIHTDEKPYK----CEECGKTFSKVSTLTTHKAIHAGEKPYKC--KECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYH 879          

HSP 2 Score: 95.1301 bits (235), Expect = 4.571e-18
Identity = 81/251 (32.27%), Postives = 117/251 (46.61%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+    +     H  +H   + ++C  C K Y + S+L  H K H   +EK YK E+C         L KH  I+  E       +C+ C + F     L +H ++HT +  Y+C++C K       L  H   H  EKPY C+   C +AF  P  L  HK      +P K     + C   F   S+L  H  +H GEK Y C   +C +SF T   L  H + HTGEKP+KCE C  + +  ++L+YH
Sbjct:  923 GKAFSWLSVFSKHKKTHAGEKFYKCEACGKAYKSSSTLSYHKKIHT--EEKPYKYEECGKGFSTFSILTKHKVIHTGEKPY----KCEECGKAFNWSSNLMEHKKIHTGETPYKCEECDKAFSWPSSLTEHKATHAGEKPYKCE--ECGKAFSWPSRLTEHKATHAGEEPYK----CEECGKAFNWSSNLMEHKRIHTGEKPYKC--EECGKSFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYH 1159          

HSP 3 Score: 93.9745 bits (232), Expect = 9.787e-18
Identity = 76/251 (30.28%), Postives = 112/251 (44.62%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+       L  H + H   + ++C  C K Y   S+L  H K H  +++     E     +Q    L+KH  I+  E       +C+ C + F+    L  H  +H  +  Y+C++C K       L  H  +H  EKPY C    C +AF     L  HK      +P K     + C   F   S+L  H  +H GEK Y C   +C +SF T   L  H + HTGEKP+KCE C  + +  ++L+YH
Sbjct:  531 GKSFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIH-TVEKPYKCEECGKAFNQ-SAILIKHKRIHTGEKPY----KCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTTHKAIHAGEKPYKCK--ECGKAFSKFSILTKHKVIHTGEKPYK----CEECGKAFNWSSNLMEHKRIHTGEKPYKC--EECGKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYH 767          

HSP 4 Score: 89.7373 bits (221), Expect = 2.074e-16
Identity = 67/232 (28.88%), Postives = 107/232 (46.12%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD 1810
              L  H  +H   + ++C  C K ++  S L  H   H   +  K +    ++   +  NL++H  I+  E       +C+ C + F++  +L  H  +HT +  Y+C++C K  K    L YH  +H  EKPY C+   C + F     L  HK     +   +     + C   ++  S L+ H  +H GEK Y C   +C ++F T   L  H + HTGEKP+KCE C 
Sbjct: 1042 SSLTEHKATHAGEKPYKCEECGKAFSWPSRLTEHKATHAGEEPYKCEECGKAF--NWSSNLMEHKRIHTGEKPY----KCEECGKSFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCE--ECGKGFVMFSILAKHKV----IHTGEKLYKCEECGKAYKWPSTLRYHKKIHTGEKPYKC--EECGKAFSTFSILTKHKVIHTGEKPYKCEECG 1259          

HSP 5 Score: 86.2705 bits (212), Expect = 2.159e-15
Identity = 77/251 (30.68%), Postives = 113/251 (45.02%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+       L  H + H   + ++C  C K Y   S+L  H K H   ++     E     S +   L KH  I+  E       +C+ C + F     L +H ++HT +  Y+C++C K       L  H  +HN EKPY C+   CD+A         H  E    +P K     + C   F   S+L  H  +H GEK Y C   +C +SF T   L  H + HTGEKP+KCE C  + +  ++L+YH
Sbjct:  347 GKAFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTG-EKPYKCEECGKGFSMFS-ILTKHEVIHTGEKPY----KCEECGKAFNWSSNLMEHKKIHTGETPYKCEECGKGFSMFSILTKHKVIHNGEKPYKCE--ECDKA--------THAGE----KPYK----CEECGKAFNWSSNLMEHKRIHTGEKPYKC--EECGKSFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYH 571          

HSP 6 Score: 85.8853 bits (211), Expect = 2.952e-15
Identity = 70/251 (27.89%), Postives = 112/251 (44.62%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+       L  H + H   + ++C  C K Y   S+L  H K H  +++     E     ++    L+KH  I+     D +  +C+ C + F+    L  H  +H  +  Y+C++C K       L  H  +H  EKPY C+   C +A++ P  L  HK      +P K     + C   F   S L +H  +H GEK Y C   +C ++F      + H   H GEK +KCE C  + +  ++L+YH
Sbjct:  727 GKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIH-TVEKPYKCEECGKAFNR-SAILIKHKRIH----TDEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCE--ECGKAYKWPSTLSYHKKIHTGEKPYK----CEECGKGFSMFSILTKHEVIHTGEKPYKC--EECGKAFSWLSVFSKHKKTHAGEKFYKCEACGKAYKSSSTLSYH 963          

HSP 7 Score: 83.1889 bits (204), Expect = 1.881e-14
Identity = 56/166 (33.73%), Postives = 81/166 (48.80%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            RC  C + F+   +L  H  +HT + +Y+C++C K       L  H  +H  EKP  C+   C +AF     L  HK      +P K       C   F + S L  H A+H GEK Y C   +C ++F     L  H + HTGEKP+KCE C  + +  ++L+YH
Sbjct:  230 RCKECGKAFSKFSILTKHKVIHTGEKSYKCEECGKAFNQSAILTKHKIIHTGEKPNKCE--ECGKAFSKVSTLTTHKAIHAGEKPYK----CKECGKAFSKVSTLITHKAIHAGEKPYKC--KECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYH 387          

HSP 8 Score: 79.337 bits (194), Expect = 2.719e-13
Identity = 76/271 (28.04%), Postives = 119/271 (43.91%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHA-------EINDTQHC-----RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            G+G      L  H + H   + ++C  C K +   S+L  H K H   +      E     S +   L KH  I++        E +   H      +C+ C + F     L +H R+HT +  Y+C++C K   T   L  H  +H  EKPY C  + C +A++    L  HK      +P K     + C   F + + L +H  +H GEK Y C   +C ++F    TL  H   H GEKP+KC+ C  +  + ++L  H +  HA +
Sbjct:  403 GKGFSMFSILTKHEVIHTGEKPYKCEECGKAFNWSSNLMEHKKIHTG-ETPYKCEECGKGFSMFS-ILTKHKVIHNGEKPYKCEECDKATHAGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSILTKHKVIHTGEKPYKC--EECGKAYKWSSTLSYHKKIHTVEKPYK----CEECGKAFNQSAILIKHKRIHTGEKPYKC--EECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTTH-KAIHAGE 662          

HSP 9 Score: 79.337 bits (194), Expect = 3.035e-13
Identity = 63/200 (31.50%), Postives = 89/200 (44.50%), Query Frame = 2
Query: 1283 YQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQP------KKHFCPVDT------------------CKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD 1810
            +  NL++H  I+  E       +C+ C + F++  +L  H  +HT +  Y+C++C K  K    L YH  +H  EKPY C+   C +AF     L  HK      +P       K F  V T                  C   F + S L  H A+H GEK Y C   +C ++F     L  H + HTGEKP+KCE C 
Sbjct:  508 WSSNLMEHKRIHTGEKPY----KCEECGKSFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCE--ECGKAFNQSAILIKHKRIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTTHKAIHAGEKPYKC--KECGKAFSKFSILTKHKVIHTGEKPYKCEECG 699          

HSP 10 Score: 76.6406 bits (187), Expect = 1.618e-12
Identity = 73/251 (29.08%), Postives = 112/251 (44.62%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            G+G      L  H + H   + ++C  C K +   S+L  H K H    E  YKCE+C  +  +  +L +H   +  E       +C+ C + F+    L +H   H  +  Y+C++C K       L  H  +H  EKPY C+   C ++F T   L  HK      +P K     + C   ++  S L  H  +H  EK Y C   +C + F     L  H + HTGEK +KCE C  + +  ++L YH
Sbjct:  979 GKGFSTFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHKKIHTG--ETPYKCEECDKAFSWPSSLTEHKATHAGEKPY----KCEECGKAFSWPSRLTEHKATHAGEEPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCE--ECGKSFSTFSILTKHKVIHTGEKPYK----CEECGKAYKWSSTLSYHKKIHTVEKPYKC--EECGKGFVMFSILAKHKVIHTGEKLYKCEECGKAYKWPSTLRYH 1215          

HSP 11 Score: 75.0998 bits (183), Expect = 5.326e-12
Identity = 63/239 (26.36%), Postives = 89/239 (37.24%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD 1810
            G+G      L  H + H   + ++C  C K ++  S    H K H                                        +C+ C + + S   L  H ++HT +  Y+ ++C K   T   L  H  +H  EKPY C+   C +AF     L  HK       P K     + C   F   S L  H A H GEK Y C   +C ++F     L  H   H GE+P+KCE C 
Sbjct:  895 GKGFSMFSILTKHEVIHTGEKPYKCEECGKAFSWLSVFSKHKKTHAGEKFY----------------------------------KCEACGKAYKSSSTLSYHKKIHTEEKPYKYEECGKGFSTFSILTKHKVIHTGEKPYKCE--ECGKAFNWSSNLMEHKKIHTGETPYK----CEECDKAFSWPSSLTEHKATHAGEKPYKC--EECGKAFSWPSRLTEHKATHAGEEPYKCEECG 1091          

HSP 12 Score: 74.3294 bits (181), Expect = 8.266e-12
Identity = 72/244 (29.51%), Postives = 106/244 (43.44%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQK--NLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            IH++  P    ++C  C K + NQS++   L KH  I   +   +       + K   L  H  I+  E       +C  C + F     L  H  +H  +  Y+C++C K       L  H  +H  EKPY C+   C +AF     L  HK      +P K     + C   F   S L +H  +H GEK Y C   +C ++++   TL+ H   HT EKP+KCE C  +  + A L  H R
Sbjct:  574 IHTVEKP----YKCEECGKAF-NQSAI---LIKHKRIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPY----KCKECGKTFIKVSTLTTHKAIHAGEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCE--ECGKAFNWSSNLMEHKRIHTGEKPYK----CEECGKSFSTFSVLTKHKVIHTGEKPYKC--EECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKAFNRSAILIKHKR 797          

HSP 13 Score: 67.781 bits (164), Expect = 8.473e-10
Identity = 71/246 (28.86%), Postives = 105/246 (42.68%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLI----------------RHTGEKPFKCELCD 1810
            L  H I H   +  +C  C K ++  S+L +H  K ++  EK YKC++C  +      L+ H  I+  E       +C  C + F+   +L  H  +HT +  Y+C++C K  K    L YH  +H  EKPY C+   C + F     L  H+      +P K     + C   F   S+L  H  +H GE  Y C   +C + F     L  H +                 H GEKP+KCE C 
Sbjct:  272 LTKHKIIHTGEKPNKCEECGKAFSKVSTLTTH--KAIHAGEKPYKCKECGKAFSKVSTLITHKAIHAGEKPY----KCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCE--ECGKGFSMFSILTKHEVIHTGEKPYK----CEECGKAFNWSSNLMEHKKIHTGETPYKC--EECGKGFSMFSILTKHKVIHNGEKPYKCEECDKATHAGEKPYKCEECG 503          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q9BU19|ZN692_HUMAN (Zinc finger protein 692 OS=Homo sapiens OX=9606 GN=ZNF692 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.898e-20
Identity = 53/121 (43.80%), Postives = 69/121 (57.02%), Query Frame = 2
Query: 1520 CDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERL 1882
            CD   C R F   +YL +HK ++  +  K   CP   C   F  K HLK HM +H   ++Y C +  C RSFRT   L +H   HTGEKP +CE+C ++CRQKASLN+H R  HA+    L
Sbjct:  330 CDFPGCGRIFSNRQYLNHHK-KYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEF--CARSFRTSSNLVIHRRIHTGEKPLQCEICGFTCRQKASLNWHQRK-HAETVAAL 446          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A0X3NYL8 (Zinc finger protein 782 OS=Schistocephalus solidus OX=70667 GN=ZN782 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 8.734e-70
Identity = 155/352 (44.03%), Postives = 213/352 (60.51%), Query Frame = 2
Query: 1157 DFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMH-DGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLG-----LKPITN--DCKXXXXXXXXXXXXXXSDPMIDCDNQRHESAKFD-----------------TNSDENDCKLESKIESDINGIISNLDKDP-NIVDIFKKPAPV 2134
            D+ C+ C+  YTN+SSLRSH+KKH +   K+++C+ C YS+QY KNLLKH+   H E+ D +  RCD+C+  FA+EFLLK H + H   N+Y+C  C +  KTKL+L+YH D+HNP KPYVCD++ CDRAFRTPKYLKNH+DEFH +QPK++ CPVD C L+F RK+HLKRH+A H D EK YHCHWPDC R FR ++TL +H  +HTGE PF+C+LC ++C +KA L  H    H+KD           L P ++  D       P           ++       E    D                 +    +     S +++DINGI+ +LDKDP  + ++F   +P 
Sbjct:  220 DYECDLCSAVYTNRSSLRSHMKKHASQIIKRHQCQHCPYSTQYGKNLLKHIESTHFEVGDCKF-RCDLCNLNFANEFLLKTHEQTHNFINSYRCDDCGRSFKTKLRLKYHMDIHNPRKPYVCDVEGCDRAFRTPKYLKNHRDEFHHMQPKQYACPVDGCSLIFHRKTHLKRHIATHDDSEKKYHCHWPDCQRRFRNKDTLTLHYHKHTGENPFRCDLCSFTCHEKALLAEHYHQQHSKDGRGGQSGSGSVLSPGSSPYDPAHRPLPPPPILQTTAGGGILPVQAHHQECRATDKFLLSPSAATATSAVAISGGSTSRTAAASSLDADINGILDSLDKDPGGLPELFPTSSPT 570          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A5K3EV48 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 9.480e-68
Identity = 131/239 (54.81%), Postives = 178/239 (74.48%), Query Frame = 2
Query: 1154 QDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMH-DGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAK 1867
            +D+ C  C   YTN+SSLRSHLKKH     K+++C+ C YS+QY KNLLKH+   H E  ++++  CD+C+  F  EFLL++H + H   N Y+C +C +  KTKL+L+YH D+HNP KPY+CD++ CDRAFRTPKYLKNH+DEFH +QPK++ CPVD C LVF RK+HLKRH+A H D EK Y+C+WP+C R FRT+E+L++H  +HTGE PF C+LC ++CR+K+ L  H R  H+K
Sbjct:  212 EDYECELCGAIYTNRSSLRSHLKKHAGQIIKRHQCQHCPYSTQYGKNLLKHIESTHVEAGESKY-HCDLCNLSFTDEFLLRNHEQSHCALNNYRCDECGRTFKTKLRLKYHVDIHNPRKPYICDVEGCDRAFRTPKYLKNHRDEFHHMQPKQYLCPVDGCTLVFHRKTHLKRHVATHDDSEKKYYCNWPECQRRFRTKESLDLHYNKHTGENPFHCDLCSFTCREKSVLTEHYRQKHSK 449          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A4Z2DWX8 (Zinc finger protein OS=Schistosoma japonicum OX=6182 GN=EWB00_001404 PE=4 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 6.420e-67
Identity = 153/332 (46.08%), Postives = 209/332 (62.95%), Query Frame = 2
Query: 1154 QDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMH-DGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKPITNDCKXXXXXXXXXXXXXXSDPMID----------CDNQRHESAKFDTNSDENDCKLESKIESDINGIISNLDKDPNIVDIF 2116
            QD  C  C+  Y NQSSLRSH+KKH+N   K+++C+KC YS+QY KNL KH+   H  ++ +Q  RC+ C + F+SE LL+DH  + T  NTY C +C +  KTKL+L+YHADVHNP KPYVCDID CDRAFRTPKYLKNH+DEFH++ PK + CPV+ C  VF RK+HLKRH+A H D EK Y C WP+C+R F ++ETLN+H  +HTGEKPF C LC Y C  K++LN H +  HAKD       K I +      +    +       P  D              RH  A    + +    ++    +++I+GI+++LD++ ++ D+F
Sbjct:  241 QDCVCKVCHIAYANQSSLRSHMKKHINHSIKRHQCDKCPYSTQYGKNLFKHIESMHT-VDGSQELRCEGCCQCFSSEVLLRDHDCLLTQCNTYCCNECGRAFKTKLRLKYHADVHNPRKPYVCDIDGCDRAFRTPKYLKNHRDEFHRMHPKNYMCPVEQCDFVFHRKTHLKRHIATHDDAEKKYQCQWPNCHRQFCSEETLNLHHRKHTGEKPFSCALCLYKCYDKSNLNEHYQVHHAKDANIDCSFKNIHHQAPSSCSSQRPQETLVYKGPFTDRTLVTRTSTPVPTLRHRMADILGSCNS---QVPGPFDAEIDGILNSLDEESDLPDLF 568          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A158QGB5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS10364 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.236e-66
Identity = 134/245 (54.69%), Postives = 175/245 (71.43%), Query Frame = 2
Query: 1154 QDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMH-DGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLL 1885
            +++ C  C   YTN+SSLRSHLKKH     K+++C  C YS+QY KNL KH+  NH    D +  RCD C   F SE  L++H + H   N YQC++C +  KTKL+L+YHAD+HNP KPY+CD++ CDRAFRTPKYLKNH+DEFH +QPK++FCPV+ C LVF RK+HLKRH+A H D EK +HC WPDC+R FRT+E+L++H  +HTGE PF C+LC +SC +K  L  H R  H+K    L+
Sbjct:  197 EEYECEVCGAIYTNRSSLRSHLKKHSGQIIKRHQCTHCPYSTQYGKNLAKHIESNHMGAEDCKF-RCDSCSMSFPSESTLRNHEQTHGTMNNYQCEECGRMFKTKLRLKYHADIHNPRKPYICDVEGCDRAFRTPKYLKNHRDEFHHMQPKQYFCPVEGCTLVFHRKTHLKRHVANHDDSEKKFHCTWPDCHRRFRTKESLDMHYNKHTGENPFHCDLCPFSCPEKTVLTEHYRQKHSKSSSSLM 440          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A4V3SDL4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008160 PE=4 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 1.061e-65
Identity = 154/345 (44.64%), Postives = 211/345 (61.16%), Query Frame = 2
Query: 1154 QDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHD-GEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDC----------------ERL----LGLKP---ITNDCKXXXXXXXXXXXXXXSDPMIDCDNQRHESAKFDTNSDENDCKLESKIESDINGIISNLDKDPNIVDIF 2116
            Q+F C+ CN  Y+N+SSLRSH+KKH+N   K+++C++C YS+QY KNL KHM   H    + Q+  C  C R F +E  L+DH    +  ++Y+C +C +  KTKL+L+YHAD+HNP KPYVCD++ CDRAFRTPKYLKNH+DEFH++QPK + CPV+ C L+F RK+HLKRH+A HD  EK YHC WP+C R F ++ETLN+H  +HTGEKPF C LC +SC  K SLN H R  HAKD                 +RL     G+      TN  +   + PV       +D +  C  Q                     ++++INGI+ +LDK+ ++ D+F
Sbjct:  245 QEFVCDVCNAIYSNRSSLRSHMKKHINHVTKRHQCDQCPYSTQYGKNLFKHMESMHMTDKEGQY-HCGECSRKFPNEMSLRDHECTMSQCSSYRCPECGRVFKTKLRLKYHADIHNPRKPYVCDVEGCDRAFRTPKYLKNHRDEFHRMQPKNYLCPVEGCDLIFHRKTHLKRHIATHDESEKKYHCQWPNCQRRFCSEETLNLHYRKHTGEKPFNCALCPFSCYNKPSLNEHYRLQHAKDANVEGPYKTFSPQFSSPQRLSVSSFGMGAHVEGTNAIQGRTSTPVPVVRHRMADILESCGPQP-----------------PGPLDAEINGILDSLDKESDLPDLF 571          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000011224.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000150.1:481345:489652:-1 gene:ENSAMXG00000010930.2 transcript:ENSAMXT00000011224.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 1.256e-22
Identity = 94/268 (35.07%), Postives = 130/268 (48.51%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHI-------------------NHAEINDTQHC-----RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H   H  ++ + C+ C K YT QS LR H + H   +EK Y C  C  S + + NL +H  I                   N+ +I+   H      +C  C + FAS+  LK H R+HT +  Y C  C K    +  L+ H  +H  +KPY C   NC + F     LK H+      +P  + CP   C+  F   SHLK+H+ +H GEK YHC   DC +SF +Q  L +HL  HTGEKP++C  C  S   K++LN H R
Sbjct:  124 LKKHQRVHTGVKPYSCSDCGKSYTTQSYLRIHQRIHK--EEKPYHCSDCGQSFKRKGNLQQHQRIHTGEKPYHCSDCGKTFKTQNYLKIHQHHHTGKKPYKCSDCGKSFASQGTLKLHQRIHTGEKPYHCSDCGKSFTQQHDLKMHQRIHTGDKPYYCS--NCGKNFSQLSTLKIHQRIHTGEKP--YHCP--ECEKSFPHLSHLKQHLRIHTGEKPYHC--SDCGKSFNSQGALKLHLRIHTGEKPYQCSDCGKSFTLKSTLNIHQR 381          

HSP 2 Score: 90.1225 bits (222), Expect = 1.339e-17
Identity = 66/189 (34.92%), Postives = 90/189 (47.62%), Query Frame = 2
Query: 1286 QKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            Q NL +H  I+  E    +   C  C++ F ++  LK H R+HT +  Y C  C      +  L+ H  +H  EKPY C   +C  +F T  +LK H+     ++P         C+  F   S  K H  +H GEK YHC   DC +SF  + TL  H   HTGEKP+ C  C  S  QK +L  H R
Sbjct:  474 QGNLQRHQRIHTGE----KPYYCSDCEKSFTTQSYLKIHQRIHTGEKPYNCLDCGNSFSAQSDLKRHQRIHTGEKPYHCS--DCGNSFTTQSHLKLHQRIHTGVKPYH----CSECERFFTTHSEFKIHQRIHTGEKPYHC--SDCGKSFTQKGTLQQHQRIHTGEKPYHCSDCGKSFTQKGNLQQHQR 650          

HSP 3 Score: 86.6557 bits (213), Expect = 1.304e-16
Identity = 72/244 (29.51%), Postives = 111/244 (45.49%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H   H   + + C+ C   +T QS L+ H + H  +        +  +++  +  + + +H      +      C  C + F  +  L+ H R+HT +  Y C  C K    K  L+ H  +H  EKPY C    C ++F T   LK H+      +P  ++C +  CK  F  +S LK+H  +H GEK YHC   DC +SF  +  L  H   HTGEKP+ C  C+     ++ L  H R
Sbjct:  533 LKRHQRIHTGEKPYHCSDCGNSFTTQSHLKLHQRIHTGVKPYHCSECERFFTTHSEFKIHQRIHTGEKPYH------CSDCGKSFTQKGTLQQHQRIHTGEKPYHCSDCGKSFTQKGNLQQHQRIHTGEKPYYCS--TCKKSFITHDTLKIHQRIHTGEKP--NYCSM--CKKRFITQSDLKKHQRIHTGEKPYHC--SDCGKSFTQKGALQQHQRVHTGEKPYYCSDCEKCFTTQSDLKRHQR 762          

HSP 4 Score: 82.8037 bits (203), Expect = 2.133e-15
Identity = 71/240 (29.58%), Postives = 98/240 (40.83%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLN 1840
            L IH   H   + ++C+ C K + +Q +L+ H + H                                         C  C + F  +  LK H R+HT D  Y C  C K       L+ H  +H  EKPY C    C+++F    +LK H    H  +   H      C   F  +  LK H+ +H GEK Y C   DC +SF  + TLN+H   HTGEKPF+C  C     Q+ S N
Sbjct:  208 LKIHQHHHTGKKPYKCSDCGKSFASQGTLKLHQRIHTGEKPY----------------------------------HCSDCGKSFTQQHDLKMHQRIHTGDKPYYCSNCGKNFSQLSTLKIHQRIHTGEKPYHC--PECEKSFPHLSHLKQHL-RIHTGEKPYH---CSDCGKSFNSQGALKLHLRIHTGEKPYQC--SDCGKSFTLKSTLNIHQRLHTGEKPFQCLDCKKRFTQRKSEN 405          

HSP 5 Score: 80.8777 bits (198), Expect = 7.915e-15
Identity = 78/261 (29.89%), Postives = 111/261 (42.53%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCERLL 1885
            L IH   H   + + C  C   ++ QS L+ H + H             S+++Q    L + +H      +      C  C+R F +    K H R+HT +  Y C  C K    K  L+ H  +H  EKPY C   +C ++F     L+ H+      +P  ++C   TCK  F     LK H  +H GEK  +C    C + F TQ  L  H   HTGEKP+ C  C  S  QK +L  H R        +  DCE+  
Sbjct:  505 LKIHQRIHTGEKPYNCLDCGNSFSAQSDLKRHQRIHTGEKPYHCSDCGNSFTTQSHLKLHQRIHTGVKPYH------CSECERFFTTHSEFKIHQRIHTGEKPYHCSDCGKSFTQKGTLQQHQRIHTGEKPYHCS--DCGKSFTQKGNLQQHQRIHTGEKP--YYC--STCKKSFITHDTLKIHQRIHTGEKPNYCSM--CKKRFITQSDLKKHQRIHTGEKPYHCSDCGKSFTQKGALQQHQRVHTGEKPYYCSDCEKCF 751          

HSP 6 Score: 80.1073 bits (196), Expect = 1.342e-14
Identity = 60/167 (35.93%), Postives = 78/167 (46.71%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C  C + F  +  L+ H R+HT +  Y C  C K   T+  L+ H  +H  EKPY C   +C  +F     LK H+   H  +   H      C   F  +SHLK H  +H G K YHC   +C R F T     +H   HTGEKP+ C  C  S  QK +L  H R
Sbjct:  464 CSDCGKSFPRQGNLQRHQRIHTGEKPYYCSDCEKSFTTQSYLKIHQRIHTGEKPYNC--LDCGNSFSAQSDLKRHQ-RIHTGEKPYH---CSDCGNSFTTQSHLKLHQRIHTGVKPYHC--SECERFFTTHSEFKIHQRIHTGEKPYHCSDCGKSFTQKGTLQQHQR 622          

HSP 7 Score: 75.485 bits (184), Expect = 3.868e-13
Identity = 57/163 (34.97%), Postives = 81/163 (49.69%), Query Frame = 2
Query: 1364 DRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            ++   ++  LK H R+HT    Y C  C K   T+  LR H  +H  EKPY C   +C ++F+    L+ H+   H  +   H      C   F+ +++LK H   H G+K Y C   DC +SF +Q TL +H   HTGEKP+ C  C  S  Q+  L  H R
Sbjct:  115 NKSLTAQSKLKKHQRVHTGVKPYSCSDCGKSYTTQSYLRIHQRIHKEEKPYHC--SDCGQSFKRKGNLQQHQ-RIHTGEKPYH---CSDCGKTFKTQNYLKIHQHHHTGKKPYKC--SDCGKSFASQGTLKLHQRIHTGEKPYHCSDCGKSFTQQHDLKMHQR 269          

HSP 8 Score: 75.485 bits (184), Expect = 4.071e-13
Identity = 67/226 (29.65%), Postives = 100/226 (44.25%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC 1798
            L +H   H  ++ + C+ C + +T  S  + H + H             S++ +    L +H  I+  E    +   C  C + F  +  L+ H R+HT +  Y C  C K   T   L+ H  +H  EKP  C +  C + F T   LK H+   H  +   H      C   F +K  L++H  +H GEK Y+C   DC + F TQ  L  H   HTGEKP +C
Sbjct:  561 LKLHQRIHTGVKPYHCSECERFFTTHSEFKIHQRIHTGEKPYHCSDCGKSFTQK--GTLQQHQRIHTGE----KPYHCSDCGKSFTQKGNLQQHQRIHTGEKPYYCSTCKKSFITHDTLKIHQRIHTGEKPNYCSM--CKKRFITQSDLKKHQ-RIHTGEKPYH---CSDCGKSFTQKGALQQHQRVHTGEKPYYC--SDCEKCFTTQSDLKRHQRIHTGEKPHRC 772          

HSP 9 Score: 68.1662 bits (165), Expect = 6.518e-11
Identity = 82/294 (27.89%), Postives = 115/294 (39.12%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHK------DEFHKLQPKKHFCP-------------------VDTCKLVFQRKSHLKRH----------------MAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+       L +H   H   + + C+ C K +T Q  L+ H + H   D+  Y        SQ    L  H  I+  E    +   C  C++ F     LK HLR+HT +  Y C  C K   ++  L+ H  +H  EKPY C   +C ++F     L  H+        F  L  KK F                       TCK  F   + +++H                  +H GEK YHC   DC +SF  Q  L  H   HTGEKP+ C  C+ S   ++ L  H R
Sbjct:  227 GKSFASQGTLKLHQRIHTGEKPYHCSDCGKSFTQQHDLKMHQRIHTG-DKPYYCSNCGKNFSQLS-TLKIHQRIHTGE----KPYHCPECEKSFPHLSHLKQHLRIHTGEKPYHCSDCGKSFNSQGALKLHLRIHTGEKPYQCS--DCGKSFTLKSTLNIHQRLHTGEKPFQCLDCKKRFTQRKSENSIYNVKLLEERRKLFSTCKYCFLHLTDMEKHHHPVKSFTAQIDLSIDQRIHTGEKPYHC--SDCGKSFPRQGNLQRHQRIHTGEKPYYCSDCEKSFTTQSYLKIHQR 510          

HSP 10 Score: 56.6102 bits (135), Expect = 2.168e-7
Identity = 55/198 (27.78%), Postives = 90/198 (45.45%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHW 1714
              IH   H   + + C+ C K +T + +L+ H + H             S++ +   NL +H  I+  E    +   C  C + F +   LK H R+HT +    C  C K+  T+  L+ H  +H  EKPY C   +C ++F     L+ H+      +P  ++C    C+  F  +S LKRH  +H GEK + C +
Sbjct:  589 FKIHQRIHTGEKPYHCSDCGKSFTQKGTLQQHQRIHTGEKPYHCSDCGKSFTQK--GNLQQHQRIHTGE----KPYYCSTCKKSFITHDTLKIHQRIHTGEKPNYCSMCKKRFITQSDLKKHQRIHTGEKPYHCS--DCGKSFTQKGALQQHQRVHTGEKP--YYC--SDCEKCFTTQSDLKRHQRIHTGEKPHRCSY 774          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000033422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001296.1:17993:22342:1 gene:ENSAMXG00000039879.1 transcript:ENSAMXT00000033422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 2.514e-22
Identity = 81/246 (32.93%), Postives = 116/246 (47.15%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + +RC+ C K +T QS+L+ H + H  +          S++ Q    L + +H      +      C  C ++F ++  LK H R+HT +  Y C  C K    +  L+ H  +H  EKPY C   +C ++F     L NH+   H  +   H      C   F ++S L  H  +H GEK YHC   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++LN H R
Sbjct:  715 SALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYH------CSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGEKPYHCS--DCGKSFNQQSTLNNHQ-RIHTGEKPYH---CSDCGKSFNQQSTLNNHQRIHTGEKPYHC--SDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQR 946          

HSP 2 Score: 103.605 bits (257), Expect = 1.364e-21
Identity = 87/271 (32.10%), Postives = 125/271 (46.13%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCERLLGLKPITND 1909
              L IH   H   + + C+ C K +  QS+L+ H + H  +          S++ Q   NL KH  I+  E        C  C ++F ++  LK H R+HT +  Y+C  C K   T+  L+ H  +H   KPY C   +C ++F     LK H+   H  +   H      C  +F  +S LK H  +H GEK YHC   DC +SF  Q TL +H   HTGEKP+ C  C  S  Q+++LN H R        H  DC +    +   N+
Sbjct:  631 SALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGVKPYYCSDCGKSFNQQ--SNLKKHQRIHTGEKPY----YCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYHCS--DCGKSFNQQSTLKLHQ-RIHTGEKPYH---CSDCGKIFTTQSALKIHQRIHTGEKPYHC--SDCGKSFNQQSTLKIHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNN 887          

HSP 3 Score: 101.293 bits (251), Expect = 5.837e-21
Identity = 84/269 (31.23%), Postives = 120/269 (44.61%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCERLLGLKPITND 1909
            L IH   H  ++ + C+ C K +  QS+L+ H + H              +++Q    + + +H            RC  C + F ++  LK H R+HT    Y C  C K    +  L+ H  +H  EKPY C   +C + F T   LK H+   H  +   H      C   F ++S LK H  +H GEK YHC   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++LN H R        H  DC +    +   N+
Sbjct:  661 LKIHQRIHTGVKPYYCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGEKPY------RCSDCGKSFTTQSALKIHQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYHCS--DCGKIFTTQSALKIHQ-RIHTGEKPYH---CSDCGKSFNQQSTLKIHQRIHTGEKPYHC--SDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNN 915          

HSP 4 Score: 100.908 bits (250), Expect = 8.325e-21
Identity = 77/246 (31.30%), Postives = 113/246 (45.93%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H  ++ + C+ C K +T QS+L+ H + H  +           +++Q    + + +H             C  C ++F ++  LK H R+HT    Y C  C K   T+  L+ H  +H   KPY C   +C + F T   LK H+   H  +   H      C  +F  +S LK H  +H GEK YHC   DC + F TQ  L +H   HTGEKP+ C  C  S  Q+++L  H R
Sbjct:  435 SALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPY------YCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCS--DCGKIFTTQSALKIHQ-RIHTGEKPYH---CSDCGKIFTTQSALKIHQCIHTGEKPYHC--SDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQR 666          

HSP 5 Score: 98.2117 bits (243), Expect = 5.211e-20
Identity = 75/246 (30.49%), Postives = 116/246 (47.15%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + +RC+ C K +T QS+L+ H + H  +           +++Q    + + +H             C  C ++F ++  LK H R+HT +  Y C  C K   T+  L+ H  +H  EKPY C   +C ++F T   LK H+     ++P  ++C    C  +F  +S LK H  +H GEK Y+C   DC + F TQ  L +H   HTG KP+ C  C      +++L  H R
Sbjct:  183 SALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPY------YCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYRCS--DCGKSFTTQSALKIHQRIHTGVKP--YYC--SDCGKIFTTQSALKIHQRIHTGEKPYYC--SDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR 414          

HSP 6 Score: 97.8265 bits (242), Expect = 8.087e-20
Identity = 77/263 (29.28%), Postives = 119/263 (45.25%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCERLL 1885
              L IH   H  ++ + C+ C K +T QS+L+ H + H              +++Q    + + +H      +      C  C ++F ++  LK H R+HT +  Y C  C K    +  L+ H  +H   KPY C   +C ++F     LK H+      +P  ++C    C  +F  +S LK H  +H GEK Y C   DC +SF TQ  L +H   HTG KP+ C  C  S  Q+++L  H R        H  DC ++ 
Sbjct:  547 SALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQCIHTGEKPYH------CSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGVKPYYC--SDCGKSFNQQSNLKKHQRIHTGEKP--YYC--SDCGKIFTTQSALKIHQRIHTGEKPYRC--SDCGKSFTTQSALKIHQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYHCSDCGKIF 795          

HSP 7 Score: 96.6709 bits (239), Expect = 1.883e-19
Identity = 74/246 (30.08%), Postives = 109/246 (44.31%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + + C+ C K +T QS+L+ H + H  +                                      C  C ++F ++  LK H R+HT +  Y+C  C K   T+  L+ H  +H   KPY C   +C + F T   LK H+     ++P  ++C    C  +F  +S LK H  +H GEK YHC   DC + F TQ  L +H   HTGEKP++C  C  S   +++L  H R
Sbjct:  127 SALKIHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYY----------------------------------CSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCS--DCGKIFTTQSALKIHQRIHTGVKP--YYC--SDCGKIFTTQSALKIHQRIHTGEKPYHC--SDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQR 330          

HSP 8 Score: 96.2857 bits (238), Expect = 2.192e-19
Identity = 84/270 (31.11%), Postives = 118/270 (43.70%), Query Frame = 2
Query: 1043 YPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            Y  +D    F     +N    +     P H           C+ C K +  QS+L+ H + H             S++ Q   NL KH  I+  E        C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L NH+      +P  ++C    C   F ++S L  H  +H GEK Y+C   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++LNYH R
Sbjct: 1038 YYCSDCGKSFTKQSTLNNHQRIHTGEKPYH-----------CSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQ--SNLKKHQRIHTGEKPY----HCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCS--DCGKSFNQQSTLNNHQRIHTGEKP--YYC--SDCGKSFNQQSTLNNHQRIHTGEKPYYC--SDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNYHQR 1282          

HSP 9 Score: 93.5893 bits (231), Expect = 1.583e-18
Identity = 73/253 (28.85%), Postives = 116/253 (45.85%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            G+       L IH   H  ++ + C+ C K +T QS+L+ H + H  +           +++Q    + + +H      +      C  C ++F ++  LK H R+HT +  Y+C  C K   T+  L+ H  +H   KPY C   +C + F T   LK H+      +P  ++C    C  +F  +S LK H  +H G K Y+C   DC + F TQ  L +H   HTG KP+ C  C      +++L  H R
Sbjct:  204 GKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYH------CSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCS--DCGKIFTTQSALKIHQRIHTGEKP--YYC--SDCGKIFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR 442          

HSP 10 Score: 93.2041 bits (230), Expect = 1.797e-18
Identity = 74/246 (30.08%), Postives = 112/246 (45.53%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H  ++ + C+ C K +T QS+L+ H + H              +++Q    + + +H            RC  C + F ++  LK H R+HT    Y C  C K   T+  L+ H  +H  EKPY C   +C + F T   LK H+     ++P  ++C    C  +F  +S LK H  +H G K Y+C   DC + F TQ  L +H   HTG KP+ C  C      +++L  H R
Sbjct:  239 SALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPY------RCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYYCS--DCGKIFTTQSALKIHQRIHTGVKP--YYC--SDCGKIFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR 470          

HSP 11 Score: 92.8189 bits (229), Expect = 2.183e-18
Identity = 77/244 (31.56%), Postives = 111/244 (45.49%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L +H   H   + + C+ C K +T QS+L+ H + H             S++ Q    + + +H      +      C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L NH+   H  +   H      C   F ++S L  H  +H GEK YHC   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++LN H R
Sbjct:  773 LKLHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGEKPYH------CSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCS--DCGKSFNQQSTLNNHQ-RIHTGEKPYH---CSDCGKSFNQQSTLNNHQRIHTGEKPYHC--SDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQR 1002          

HSP 12 Score: 92.0485 bits (227), Expect = 4.328e-18
Identity = 78/246 (31.71%), Postives = 110/246 (44.72%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H   + + C+ C K +  QS+L+ H + H             S++ Q   N  + +H      +      C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L NH+   H  +   H      C   F ++S L  H  +H GEK YHC   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++LN H R
Sbjct:  799 SALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYH------CSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCS--DCGKSFNQQSTLNNHQ-RIHTGEKPYH---CSDCGKSFTKQSTLNNHQRIHTGEKPYHC--SDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQR 1030          

HSP 13 Score: 90.1225 bits (222), Expect = 1.486e-17
Identity = 71/244 (29.10%), Postives = 106/244 (43.44%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H   H  ++ + C+ C K +T QS+L+ H + H  +                                      C  C ++F ++  LK H R+HT +  Y C  C K    +  L+ H  +H  EKPY C   +C + F T   LK H+      +P  ++C    C  +F  +S LK H  +H G K Y+C   DC + F TQ  L +H   HTGEKP++C  C  S   +++L  H R
Sbjct:   17 LKKHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYY----------------------------------CSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHC--SDCGKIFTTQSALKIHQRIHTGEKP--YYC--SDCGKIFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQR 218          

HSP 14 Score: 90.1225 bits (222), Expect = 1.576e-17
Identity = 74/231 (32.03%), Postives = 107/231 (46.32%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            + C+ C K +  QS+L +H + H             S++ Q   N  + +H             C  C + F  +  L +H R+HT +  Y C  C K    +  L YH  +H  EKPY C   +C ++F     LK H+   H  +   H      C   F ++S+LK+H  +H GEK Y+C   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++L  H R
Sbjct: 1178 YYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPY------YCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNYHQRIHTGEKPYHCS--DCGKSFNQQSNLKKHQ-RIHTGEKPYH---CSDCGKSFNQQSNLKKHQRIHTGEKPYYC--SDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQR 1394          

HSP 15 Score: 88.9669 bits (219), Expect = 3.577e-17
Identity = 75/263 (28.52%), Postives = 116/263 (44.11%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCERLL 1885
              L IH   H   + + C+ C K +T QS+L+ H + H  +           +++Q    + + +H             C  C ++F ++  LK H R+HT    Y C  C K   T+  L+ H  +H   KPY C   +C + F T   LK H+     ++P  ++C    C  +F  +S LK H  +H G K Y+C   DC + F TQ  L +H   HTG KP+ C  C      +++L  H R        H  DC ++ 
Sbjct:  351 SALKIHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPY------YCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGVKP--YYC--SDCGKIFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIF 599          

HSP 16 Score: 88.9669 bits (219), Expect = 3.859e-17
Identity = 74/246 (30.08%), Postives = 111/246 (45.12%), Query Frame = 2
Query: 1115 DPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
              L IH   H  ++ + C+ C K +T QS+L+ H + H      +      S+++Q    + + +H             C  C ++F ++  LK H R+HT    Y C  C K   T+  L+ H  +H  EKPY C   +C + F T   LK H+      +P +       C   F  +S LK H  +H G K Y+C   DC + F TQ  L +H   HTGEKP+ C  C      +++L  H R
Sbjct:  155 SALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPY------YCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCS--DCGKIFTTQSALKIHQRIHTGEKPYR----CSDCGKSFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGEKPYYCSDCGKIFTTQSALKIHQR 386          

HSP 17 Score: 87.4261 bits (215), Expect = 1.072e-16
Identity = 76/244 (31.15%), Postives = 110/244 (45.08%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L IH   H   + + C+ C K +  QS+L +H + H             S++ Q   N  + +H      +      C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L NH+   H  +   H      C   F ++S L  H  +H GEK Y+C   DC +SF  Q TLN H   HTGEKP+ C  C  S  ++++LN H R
Sbjct:  829 LKIHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYH------CSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCS--DCGKSFTKQSTLNNHQ-RIHTGEKPYH---CSDCGKSFNQQSTLNNHQRIHTGEKPYYC--SDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFTKQSTLNNHQR 1058          

HSP 18 Score: 86.6557 bits (213), Expect = 1.954e-16
Identity = 75/244 (30.74%), Postives = 109/244 (44.67%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H   H   + + C+ C K +  QS+L+ H + H             S++ Q   N  + +H             C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L NH+      +P  ++C    C   F ++S L  H  +H GEK Y+C   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++L  H R
Sbjct: 1081 LKKHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPY------YCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCS--DCGKSFNQQSTLNNHQRIHTGEKP--YYC--SDCGKSFNQQSTLNNHQRIHTGEKPYYC--SDCGKSFNQQSTLNYHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQR 1310          

HSP 19 Score: 85.8853 bits (211), Expect = 3.031e-16
Identity = 72/231 (31.17%), Postives = 104/231 (45.02%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            + C+ C K +  QS+L +H + H             S++ Q   N  + +H             C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L N+    H  +   H      C   F ++S+LK+H  +H GEK YHC   DC +SF  Q  L  H   HTGEKP+ C  C  S  Q+++LN H R
Sbjct: 1150 YYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPY------YCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCS--DCGKSFNQQSTL-NYHQRIHTGEKPYH---CSDCGKSFNQQSNLKKHQRIHTGEKPYHC--SDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQR 1366          

HSP 20 Score: 85.1149 bits (209), Expect = 5.568e-16
Identity = 78/270 (28.89%), Postives = 115/270 (42.59%), Query Frame = 2
Query: 1043 YPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            Y  +D    F+    +N    +     P H           C+ C K +  QS+L +H + H             S++ Q   N  + +H      +      C  C + F  +  L +H R+HT +  Y C  C K    +  L  H  +H  EKPY C   +C ++F     L NH+      +P  ++C    C   F ++S L  H  +H GEK Y+C   DC +SF  Q TLN H   HTGEKP+ C  C  S  Q+++L  H R
Sbjct:  842 YHCSDCGKSFNQQSTLNNHQRIHTGEKPYH-----------CSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYH------CSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFTKQSTLNNHQRIHTGEKPYHCS--DCGKSFNQQSTLNNHQRIHTGEKP--YYC--SDCGKSFNQQSTLNNHQRIHTGEKPYYC--SDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQR 1086          

HSP 21 Score: 80.4925 bits (197), Expect = 1.525e-14
Identity = 69/226 (30.53%), Postives = 101/226 (44.69%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASL 1837
            + C+ C K +  QS+L +H + H             S++ Q   N  + +H             C  C + F  +  L  H R+HT +  Y C  C K    +  L+ H  +H  EKPY C   +C ++F     LK H+      +P  ++C    C   F ++S L  H  +H GEK YHC   DC +SF  Q  L  H   HTGEKP+ C  C  S  Q+++L
Sbjct: 1206 YYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPY------YCSDCGKSFNQQSTLNYHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCS--DCGKSFNQQSNLKKHQRIHTGEKP--YYC--SDCGKSFNQQSTLNNHQRIHTGEKPYHC--SDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSTL 1417          

HSP 22 Score: 58.5362 bits (140), Expect = 6.736e-8
Identity = 40/121 (33.06%), Postives = 59/121 (48.76%), Query Frame = 2
Query: 1541 RAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCERLL 1885
            ++F     LK H+     ++P  ++C    C  +F  +S LK H  +H G K Y+C   DC + F TQ  L +H   HTGEKP+ C  C  S  Q+++L  H R        H  DC ++ 
Sbjct:    9 KSFTKQSDLKKHQRIHTGVKP--YYC--SDCGKIFTTQSALKIHQRIHTGVKPYYC--SDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHCSDCGKIF 123          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000034301.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:22305366:22309668:1 gene:ENSAMXG00000029783.1 transcript:ENSAMXT00000034301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 4.749e-22
Identity = 89/263 (33.84%), Postives = 128/263 (48.67%), Query Frame = 2
Query: 1064 SQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            S FH+     G+       L IH   H   + + C  CNK ++ QSSL+ H K H    EK Y C++C    + + NL  H  I+  E    +  +C  CD+ F+    L+ H R+HT +  Y C  C K  K +  L  H   H  EKPYVC   +C ++FR    LK H+      +P  + C  + C + F + S L+ H  +H GEK + C  PDC+++F   + L  H   HTGEKPF C  C  S    ++L+ H R
Sbjct:   70 STFHLC----GKAFSQWRYLLIHQRIHTGEKPYSCTECNKSFSQQSSLKLHQKIHTG--EKPYTCDECGKCFRDKANLRAHQRIHTGE----KPYQCSECDKSFSQLGYLQQHERVHTGERPYVCGDCDKAFKNQCDLNAHKRTHTGEKPYVCG--DCGKSFRQGGSLKVHQRVHTGEKP--YVC--NDCGMAFTQGSALRSHQRLHTGEKPFPC--PDCDKTFSRNDQLQAHQRVHTGEKPFSCSECGKSFNNTSNLHQHKR 314          

HSP 2 Score: 88.1965 bits (217), Expect = 6.098e-18
Identity = 76/242 (31.40%), Postives = 113/242 (46.69%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L +H   H   + + C+ C KC+ ++++LR+H + H    EK Y+C +C  S      L +H  ++  E        C  CD+ F ++  L  H R HT +  Y C  C K  +    L+ H  VH  EKPYVC+  +C  AF     L++H+    +L   +   P   C   F R   L+ H  +H GEK + C   +C +SF     L+ H   HTGEKP+ C  C  + R    L  H
Sbjct:  113 LKLHQKIHTGEKPYTCDECGKCFRDKANLRAHQRIHTG--EKPYQCSECDKSFSQLGYLQQHERVHTGERPYV----CGDCDKAFKNQCDLNAHKRTHTGEKPYVCGDCGKSFRQGGSLKVHQRVHTGEKPYVCN--DCGMAFTQGSALRSHQ----RLHTGEKPFPCPDCDKTFSRNDQLQAHQRVHTGEKPFSC--SECGKSFNNTSNLHQHKRIHTGEKPYCCPECGRTFRLSTGLKNH 340          

HSP 3 Score: 88.1965 bits (217), Expect = 6.269e-18
Identity = 64/186 (34.41%), Postives = 90/186 (48.39%), Query Frame = 2
Query: 1358 ICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKP-ITNDC 1912
            +C + F+    L  H R+HT +  Y C +C K    +  L+ H  +H  EKPY CD   C + FR    L+ H+      +P +       C   F +  +L++H  +H GE+ Y C   DC+++F+ Q  LN H   HTGEKP+ C  C  S RQ  SL  H R  H        G KP + NDC
Sbjct:   74 LCGKAFSQWRYLLIHQRIHTGEKPYSCTECNKSFSQQSSLKLHQKIHTGEKPYTCD--ECGKCFRDKANLRAHQRIHTGEKPYQ----CSECDKSFSQLGYLQQHERVHTGERPYVC--GDCDKAFKNQCDLNAHKRTHTGEKPYVCGDCGKSFRQGGSLKVHQR-VHT-------GEKPYVCNDC 243          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000015177.2 (oocyte zinc finger protein XlCOF6-like [Source:NCBI gene;Acc:103026069])

HSP 1 Score: 102.449 bits (254), Expect = 5.905e-22
Identity = 79/262 (30.15%), Postives = 130/262 (49.62%), Query Frame = 2
Query: 1085 MMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            ++ G+  +++    +HS+SH   + F C+ C + Y  + SL  H K H  +          +++  +++ L KHM + H++    Q   C  C   F+    LK H+R+H++D  Y+C  C K  + K+ ++ H   H  EKPY+C   +C ++F  P +   HK      +P  + C   TC   F +K  L++H  +H GEK Y C   +C ++F        HL  HTGEKP++C +C       +SLN H +  HA D
Sbjct:  232 LVCGRSFLNLSSFKLHSVSHSDERAFSCDECGRKYKVKGSLVEHQKSHTGLQLFPCSDCGKTFT--HKRYLKKHM-LRHSKEKQFQ---CSYCQNKFSQLNSLKTHMRIHSDDKPYKCSHCGKGFRHKVHMQCHERTHTGEKPYLCA--DCGKSFSDPSHFNEHKRLHTGERP--YVC--TTCGKSFSKKITLRQHEKIHTGEKPYKC--TECEKTFARPCVFKNHLRIHTGEKPYQCPICKEKFTFLSSLNSH-KKKHAAD 478          

HSP 2 Score: 81.6481 bits (200), Expect = 2.374e-15
Identity = 53/186 (28.49%), Postives = 84/186 (45.16%), Query Frame = 2
Query: 1298 LKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            LK++ ++    N+ +   C++C R F S   LK H+ MHT +  ++C  C +        + H+  H+ E+ + C  D C R ++    L  H+     LQ      P   C   F  K +LK+HM  H  EK + C +  C   F    +L  H+  H+ +KP+KC  C    R K  +  H R 
Sbjct:  185 LKYLKLHEKRHNEVKDFLCEVCSRSFISLTELKKHMLMHTGEGKFKCLVCGRSFLNLSSFKLHSVSHSDERAFSC--DECGRKYKVKGSLVEHQKSHTGLQ----LFPCSDCGKTFTHKRYLKKHMLRHSKEKQFQCSY--CQNKFSQLNSLKTHMRIHSDDKPYKCSHCGKGFRHKVHMQCHERT 362          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: GZF1 (GDNF inducible zinc finger protein 1 [Source:HGNC Symbol;Acc:HGNC:15808])

HSP 1 Score: 103.219 bits (256), Expect = 8.934e-22
Identity = 72/255 (28.24%), Postives = 122/255 (47.84%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDI--------------------------DNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +RC+ C + + N+ +L+ H K+H++ D++ + C+ C  + + +K++ +H    H     T+   C IC +  +S   L  H R HT D  Y C +C  +      LR H  +H  EKP+ CD+                          +NC ++F + +YLK+H       +P K     D C   F +++ L +HM +H GE+ YHC   +C++ F     L  H   HTGEKP+ C +C  +   K+++  H
Sbjct:  322 YRCDICQQTFANRCNLKIH-KRHVHNDDRLFPCDVCKKAFKRKKDVTRHRRQVHE--GGTERYYCTICGKSLSSRTALTLHERTHTGDKPYSCNECEARFSQSSALRTHQRIHTGEKPFACDMCDAKFTQNHMLAYHKRCHTGEKPFMCENCGKSFASKEYLKHHARIHSGFKPYK----CDNCGRAFAQRNSLHQHMKIHTGERPYHC--KECDKQFTQLNALQRHQRIHTGEKPYMCSVCGRTFTDKSTVRRH 567          

HSP 2 Score: 90.8929 bits (224), Expect = 5.474e-18
Identity = 58/191 (30.37%), Postives = 89/191 (46.60%), Query Frame = 2
Query: 1280 QYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +Y+K+ LKH+ ++H    DT + RCDIC + FA+   LK H R                            VHN ++ + CD+  C +AF+  K +  H+ + H+   ++++C +  C      ++ L  H   H G+K Y C+  +C   F     L  H   HTGEKPF C++CD    Q   L YH R
Sbjct:  301 RYEKSYLKHVKVSHGIETDTTY-RCDICQQTFANRCNLKIHKR---------------------------HVHNDDRLFPCDV--CKKAFKRKKDVTRHRRQVHEGGTERYYCTI--CGKSLSSRTALTLHERTHTGDKPYSCN--ECEARFSQSSALRTHQRIHTGEKPFACDMCDAKFTQNHMLAYHKR 457          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008278.1 (pep scaffold:Pmarinus_7.0:GL477891:43090:46668:-1 gene:ENSPMAG00000007492.1 transcript:ENSPMAT00000008278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 7.124e-22
Identity = 48/113 (42.48%), Postives = 65/113 (57.52%), Query Frame = 2
Query: 1514 YVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            Y C    C++ +R  +YL NH    H    +K  C +  C   F    HLK+H  +H  E+N+ C    C  SF++++ L +HL  HTGEKP +CELC Y CRQKASLN+H R
Sbjct:   15 YHCTQLGCEKVYRVKEYLTNHVKAVH--GDRKLVCGMQGCGKRFVLPRHLKKHQLLHSDERNFVC--ETCGASFKSKKNLLIHLRIHTGEKPLQCELCGYRCRQKASLNWHMR 123          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 97.4413 bits (241), Expect = 1.867e-21
Identity = 61/178 (34.27%), Postives = 86/178 (48.31%), Query Frame = 2
Query: 1349 RCD--ICDRMFASEFLLKDHLRMHTNDNTYX--XXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            RC+   C + F++ + LK HLR HT +  Y    + C K  KT   L+ H   H  EKP+ C  + C R+F T    K H       +P  + CP   C   F   ++ K H+ +H GEK Y C  P C + F    +L  H + HT  KP+ C  C  + RQ ++L  H R+AH  D
Sbjct:  166 RCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERP--YLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSCSNCSKTYRQPSTLATHKRSAHGGD 341          

HSP 2 Score: 67.781 bits (164), Expect = 8.388e-12
Identity = 60/228 (26.32%), Postives = 89/228 (39.04%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNY--CNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVH-LIRHTGEKPFK 1795
            L +H  +H   + +RCN   C K ++    L+SHL+ H          E C    +   +L KH+  +  E      C  + C R F +  + K H+R HT                             E+PY+C    C R F +    KNH    H  + K + C V  C   F   S L +H  +H   K Y C   +C++++R   TL  H    H G+ P K
Sbjct:  152 LKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGE--KPFKCPFEGCGRSFTTSNIRKVHIRTHTG----------------------------ERPYLCPEPGCGRGFSSATNYKNHV-RIHTGE-KPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSC--SNCSKTYRQPSTLATHKRSAHGGDVPSK 345          

HSP 3 Score: 57.7658 bits (138), Expect = 1.145e-8
Identity = 30/86 (34.88%), Postives = 40/86 (46.51%), Query Frame = 2
Query: 1604 KKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC--ELCDYSCRQKASLNYHCRN 1855
            K   C  + C  ++    HLK H   H G++ Y C+ P C ++F T   L  HL  HTGEKP+ C  E C    +    L  H R 
Sbjct:  133 KAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRT 218          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 94.3597 bits (233), Expect = 1.743e-20
Identity = 60/176 (34.09%), Postives = 85/176 (48.30%), Query Frame = 2
Query: 1349 RCD--ICDRMFASEFLLKDHLRMHTNDNTYX--XXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHA 1864
            RC+   C + F++ + LK HLR HT +  Y    + C K  KT   L+ H   H  EKP+ C  + C R+F T    K H       +P  + CP   C   F   ++ K H+ +H GEK Y C  P C + F    +L  H + HT  KP+ C  C  + RQ ++L  H R+AH 
Sbjct:  135 RCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERP--YLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSCSNCSKTYRQPSTLATHKRSAHG 308          

HSP 2 Score: 65.855 bits (159), Expect = 2.777e-11
Identity = 59/233 (25.32%), Postives = 88/233 (37.77%), Query Frame = 2
Query: 1070 FHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNY--CNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVH 1762
            FH      G+       L +H  +H   + +RCN   C K ++    L+SHL+ H          E C    +   +L KH+  +  E      C  + C R F +  + K H+R HT                             E+PY+C    C R F +    KNH    H  + K + C V  C   F   S L +H  +H   K Y C   +C++++R   TL  H
Sbjct:  104 FHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGE--KPFKCPFEGCGRSFTTSNIRKVHIRTHTG----------------------------ERPYLCPEPGCGRGFSSATNYKNHV-RIHTGE-KPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSC--SNCSKTYRQPSTLATH 302          

HSP 3 Score: 57.3806 bits (137), Expect = 1.393e-8
Identity = 30/86 (34.88%), Postives = 40/86 (46.51%), Query Frame = 2
Query: 1604 KKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC--ELCDYSCRQKASLNYHCRN 1855
            K   C  + C  ++    HLK H   H G++ Y C+ P C ++F T   L  HL  HTGEKP+ C  E C    +    L  H R 
Sbjct:  102 KAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRT 187          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001428.1 (pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1 gene:ENSPMAG00000001294.1 transcript:ENSPMAT00000001428.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 3.506e-18
Identity = 72/242 (29.75%), Postives = 112/242 (46.28%), Query Frame = 2
Query: 1127 IHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDI--DNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            IH+   PHI    C  C K ++   +L+ H+  H      K       +  + Q  L  HM  +  E +     RC +C + F+  F+LK H+  HT +  ++C  C K       L+ HA +H  EK + C +      R+ +  ++++NH  E+      +H C V  C+  F R S LK HM  H GE+ + C    C ++F+    L  H+  HTGE+P KC LC+   +Q   L  H
Sbjct:   81 IHATEKPHI----CPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQ--LQDHMRNHTGEWSH----RCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEW------RHRCSV--CQKGFIRPSELKNHMMTHTGERPHKC--SVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSH 302          

HSP 2 Score: 80.1073 bits (196), Expect = 6.596e-16
Identity = 70/247 (28.34%), Postives = 104/247 (42.11%), Query Frame = 2
Query: 1106 VDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            V    L  H   H   + +RC+ C K +   S+L +H      I   +           + +      H+      D  H +C +C + F  E  L+DH+R HT + +++C  C K       L+ H   H  E+P+ C +  C + F     L+NH         K H C V  C   F R   LKRHM  H GE  + C    C + F     L  H++ HTGE+P KC +C  + +Q  +L  H
Sbjct:   42 VTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHA----TIHATEKPHICPVCGKGFSRPFALKCHVV-IHSGDCPH-KCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPV--CGKGFGRLSTLQNHATMH--TGEKVHKCLV--CGKGFSRSVQLKRHMRNHTGEWRHRC--SVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSH 274          

HSP 3 Score: 76.2554 bits (186), Expect = 1.265e-14
Identity = 55/178 (30.90%), Postives = 86/178 (48.31%), Query Frame = 2
Query: 1316 NHAEINDTQHC-RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            NHA ++  +   +C +C + F+    LK H+R HT +  ++C  C K      +L+ H   H  E+P+ C +  C +AF+    LK+H       +P K       C+  F++ + LK HM  H GE+ Y C    C + F    +L  H+  H+GEKP+KC  C    R   +L  H
Sbjct:  189 NHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSV--CGKAFKQYTALKSHMKTHTGERPHK----CSLCEKDFKQCTGLKSHMLTHTGERAYKC--SVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNH 358          

HSP 4 Score: 73.9442 bits (180), Expect = 7.516e-14
Identity = 69/232 (29.74%), Postives = 102/232 (43.97%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKP 1789
            G+G      L  H ++H   +  +C  C K +   S+L++H   H      K       +S   Q  L +HM  +  E       RC +C + F     LK+H+  HT +  ++C  C K  K    L+ H   H  E+P+ C +  C++ F+    LK+H         + + C V  C+  F   + LK HM  H GEK Y C    C + FR   TL  H+  HTGEKP
Sbjct:  150 GKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQ--LKRHMRNHTGEWRH----RCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSL--CEKDFKQCTGLKSH--MLTHTGERAYKCSV--CEKDFIHSTSLKSHMKTHSGEKPYKC--SACKKDFRHSTTLKNHMKTHTGEKP 367          

HSP 5 Score: 72.0182 bits (175), Expect = 3.130e-13
Identity = 61/195 (31.28%), Postives = 82/195 (42.05%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNH---------------KDEFHK-LQPKKHF----------CPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            +C +C+  F +   LK+H+ +H  +  Y+C  C K       L  HA +H  EKP++C +  C + F  P  LK H                 EF K +Q + H           C V  C   F R   LK HM  H GE+ + C  P C + F    TL  H   HTGEK  KC +C     +   L  H RN
Sbjct:   33 KCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPV--CGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSV--CGKGFSRSFVLKTHMMTHTGERPHKC--PVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRN 221          

HSP 6 Score: 71.2478 bits (173), Expect = 4.684e-13
Identity = 50/154 (32.47%), Postives = 71/154 (46.10%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD 1810
            +C +C + F     LK+H+  HT +  Y+C  C     T   L+ H  +HN EKPY C +  C + F     L  H       +P  H CPV  C   F R   LK H+ +H G+  + C    C + FR +  L  H+  HTGE   +C +C 
Sbjct:    5 KCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSV--CGKGFNRSSTLATHATIHATEKP--HICPV--CGKGFSRPFALKCHVVIHSGDCPHKC--ALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCG 150          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000727.1 (pep scaffold:Pmarinus_7.0:GL483797:4504:5526:-1 gene:ENSPMAG00000000662.1 transcript:ENSPMAT00000000727.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 1.202e-17
Identity = 58/163 (35.58%), Postives = 79/163 (48.47%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLN 1840
            C ICD++F     L+ HLR H+    Y C  C K    K  L  H   H  EKP+ C +  C++AF   KYL+ H+        K H C V  C   F++  +L+ H   H GEK Y C    CN++F     L  H   HTGE+P++C  C+ +  QK  L 
Sbjct:    7 CTICDKVFKRH--LRMHLRSHSGTKPYACGVCEKAFPRKEHLLVHQRTHTGEKPFKCLL--CEKAFTQKKYLQFHEGNHSGRTEKPHVCVV--CDKAFKKSEYLQIHRRTHTGEKPYKC--AQCNKAFVQMGDLQRHRRTHTGERPYRCTFCEKAFVQKGDLQ 161          

HSP 2 Score: 65.4698 bits (158), Expect = 6.877e-12
Identity = 62/222 (27.93%), Postives = 96/222 (43.24%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEK 1786
            L +H  SH   + + C  C K +  +  L  H + H      K    + +++   QK  L+    NH+   +  H  C +CD+ F     L+ H R HT +  Y+C QC K       L+ H   H  E+PY C    C++AF         K +      +K +     C   F +K  L+RH  +H GEK Y CH   C+++F  +  L +H   H  +K
Sbjct:   18 LRMHLRSHSGTKPYACGVCEKAFPRKEHLLVHQRTHTGEKPFKCLLCEKAFT---QKKYLQFHEGNHSGRTEKPHV-CVVCDKAFKKSEYLQIHRRTHTGEKPYKCAQCNKAFVQMGDLQRHRRTHTGERPYRCTF--CEKAF-------VQKGDLQMAFTQKKYLKKSECLQAFVQKGDLQRHQTIHTGEKPYSCH--VCSKAFTRKGYLLIHQWTHAPQK 224          

HSP 3 Score: 63.929 bits (154), Expect = 2.611e-11
Identity = 54/190 (28.42%), Postives = 84/190 (44.21%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHN--PEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHW-----------------------PDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            C +C++ F  +  L  H R HT +  ++C  C K    K  L++H   H+   EKP+VC +  CD+AF+  +YL+ H+      +P K       C   F +   L+RH   H GE+ Y C +                        +C ++F  +  L  H   HTGEKP+ C +C  +  +K  L  H
Sbjct:   33 CGVCEKAFPRKEHLLVHQRTHTGEKPFKCLLCEKAFTQKKYLQFHEGNHSGRTEKPHVCVV--CDKAFKKSEYLQIHRRTHTGEKPYK----CAQCNKAFVQMGDLQRHRRTHTGERPYRCTFCEKAFVQKGDLQMAFTQKKYLKKSECLQAFVQKGDLQRHQTIHTGEKPYSCHVCSKAFTRKGYLLIH 216          

HSP 4 Score: 56.9954 bits (136), Expect = 5.655e-9
Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1610 HFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            H C +  C  VF+R  HL+ H+  H G K Y C    C ++F  +E L VH   HTGEKPFKC LC+ +  QK  L +H
Sbjct:    5 HGCTI--CDKVFKR--HLRMHLRSHSGTKPYAC--GVCEKAFPRKEHLLVHQRTHTGEKPFKCLLCEKAFTQKKYLQFH 77          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 70.0922 bits (170), Expect = 2.017e-12
Identity = 39/121 (32.23%), Postives = 62/121 (51.24%), Query Frame = 2
Query: 1493 VHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHF-CPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +  PE+  +C  D C+++F + + L +H +  H  + K  + C    C   F ++  L RH+ +H   K Y C    C R F ++ETL  H   H+GEKP+KC +C+      +SL  H R
Sbjct:  699 IKQPEQ-VICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR 816          

HSP 2 Score: 68.9366 bits (167), Expect = 5.087e-12
Identity = 50/182 (27.47%), Postives = 74/182 (40.66%), Query Frame = 2
Query: 1346 CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAK----DCER 1879
            C+ D C++ F+S   L DHL                             +   +  Y C   +C R F   + L  H     K +P K      TCK  F  +  L +H   H GEK Y CH   CN+ F    +L +H+  HTGEKP +C++C     + ++L+ H +    K    DC +
Sbjct:  707 CQWDGCNKSFSSAQELNDHLEA-------------------------VHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYK----CKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKKYKCSDCSK 857          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 60.077 bits (144), Expect = 1.477e-9
Identity = 41/120 (34.17%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 1508 KPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC--ELCDYSCRQKASLNYHCRNAH 1861
            K Y CD D CD+AF  P  L  H+   H  Q  + F   D C   F +KSHL+RH+  H   K + C +  C +   T++ L  H + HT  K F C  E C+    +   L  H  + H
Sbjct:   47 KTYFCDYDGCDKAFTRPSILTEHQLSVH--QGLRAF-QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKHPQLRAHILSVH 159          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 58.9214 bits (141), Expect = 5.365e-9
Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 2
Query: 1604 KKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            KKH CP   C  +F + +HL+ H+  H G K + C +  C + F     L  H   HTGEKP+ C++CD    +K +L  H
Sbjct:  591 KKHECPY--CHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAH 667          

HSP 2 Score: 49.6766 bits (117), Expect = 4.471e-6
Identity = 30/81 (37.04%), Postives = 42/81 (51.85%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHK 1594
            CD C + F     L+ H R+HT +  Y C  C KK   K  L  H   H   KP+VC ++NC++ F     +K H++ FHK
Sbjct:  623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHK 703          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 55.8398 bits (133), Expect = 3.303e-8
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query: 1625 DTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGE 1783
            DTC   F R  H KRH+  H GEK +HC +P C +SF   + L  H+  HTG+
Sbjct:   20 DTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQ 72          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: RGM1 (Putative zinc finger DNA binding transcription factor; contains two N-terminal C2H2 zinc fingers and C-terminal proline rich domain; overproduction impairs cell growth and induces expression of genes involved in monosaccharide catabolism and aldehyde metabolism; regulates expression of of Y' telomeric elements and subtelomeric COS genes; relocalizes to the cytosol in response to hypoxia; RGM1 has a paralog, USV1, that arose from the whole genome duplication [Source:SGD;Acc:S000004794])

HSP 1 Score: 50.447 bits (119), Expect = 4.780e-7
Identity = 24/54 (44.44%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1649 RKSHLKRHMAMHDGEKNYHC-HWPDCNRSFRTQETLNVHLIRHTGEKPFKCELC 1807
            R    KR+      ++NY C  +PDCN SF   E L  H+ +HTGEKPF+C +C
Sbjct:    2 RGKQPKRNKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNIC 55          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO46628 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS8])

HSP 1 Score: 97.4413 bits (241), Expect = 4.338e-22
Identity = 70/232 (30.17%), Postives = 112/232 (48.28%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRC--NYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQH-CRCDICDRMFASEFLLKDHLRMHTNDNTYX--XXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCE 1801
            L  H   H   + F C    C + +T   +L++H++ H   +      E C  +      L   +H    E+ D  + C  + C ++FA+  +L  HL+ H+ +  +    + C K+     KL+ H   H  E+P+ CD + C  +F +   LK HK +    +P    C  + C   F R SHLK H+ +H GEK Y C    C ++F    +LN+HL +HTGEKP++CE
Sbjct:   15 LKRHERGHTGERPFACPEKGCGRRFTTAYNLKTHIRAHRRTNSIACNYEGCDKAFPTLHKL--RVHERKHELQDKPYKCEVEGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERP--FVCSWEGCHKSFTRSSHLKTHVLVHTGEKPYVCPADGCGKAFTAGSSLNIHLRKHTGEKPYRCE 242          

HSP 2 Score: 76.6406 bits (187), Expect = 4.145e-15
Identity = 61/222 (27.48%), Postives = 90/222 (40.54%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNY--CNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYX--XXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRH 1774
            L  H  +H       CNY  C+K +     LR H +KH   D+      +          +L   H+          C  + C++ F     LK H+R HT +  +    + C     +  KL+ H   H  E+P+VC  + C ++F    +LK H       +P  + CP D C   F   S L  H+  H GEK Y C    CN+++ T   L  H  RH
Sbjct:   45 LKTHIRAHRRTNSIACNYEGCDKAFPTLHKLRVHERKHELQDKPYKCEVEGCGKVFAAMGVLT-SHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKSFTRSSHLKTHVLVHTGEKP--YVCPADGCGKAFTAGSSLNIHLRKHTGEKPYRCEESSCNKAYTTAANLRAHQKRH 263          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 98.9821 bits (245), Expect = 1.371e-21
Identity = 70/232 (30.17%), Postives = 108/232 (46.55%), Query Frame = 2
Query: 1163 RCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHI-NHAEINDTQH-CRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +C+ C KC+T   +L++HL+ H  +   + +           K   +  H+  H  ++  Q   +CD C + F     LK HL +H+    Y+C +C K       L+ H  +H+ EKPY C  D+C + F     +K H       +P K     D C   F   +HLK H+ +H GEK Y C   DC + F     L  HL+ H+GEKP++C+ C     Q  ++  H R
Sbjct:   60 KCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCG--------KCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYEC--DDCGKCFTQSGAMKRHLRIHTGKKPYK----CDECGNCFSESAHLKAHLVIHSGEKPYKC--DDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLR 275          

HSP 2 Score: 94.7449 bits (234), Expect = 3.060e-20
Identity = 78/244 (31.97%), Postives = 113/244 (46.31%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H + H   + ++C+ C KC+T  + L++HL  H    +K YKC++C        +L  H+ I+  E        CD C + F     +K HLR+HT    Y+C +C         L+ H  +H+ EKPY C  D+C + F     LK H       +P +     D C   F +   +KRH+ +H G+K Y C   +C   F     L  HL+ HTGEKP KC+ C     Q   L  H R
Sbjct:  102 LKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSG--KKPYKCDECGKCFTLSGDLKTHLVIHSGEKPY----ECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKC--DDCGKCFTLSGDLKTHLVIHSGEKPYE----CDDCGKCFTQSGAMKRHLRIHTGKKPYKC--DECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLR 331          

HSP 3 Score: 88.9669 bits (219), Expect = 2.640e-18
Identity = 73/229 (31.88%), Postives = 108/229 (47.16%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELC 1807
            L  H + H   + ++C+ C KC+T    L++HL  H    EK Y+C+ C         + +H+ I+  +       +CD C   F+    LK HL +H+ +  Y+C  C K       L+ H  +H+ EKPY CD  +C + F     +K H       +P K     D C   F     LKRH+ +H GEK + C   DC + F     L  HL  HTGEKP++C+ C
Sbjct:  130 LKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSG--EKPYECDDCGKCFTQSGAMKRHLRIHTGKKPY----KCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECD--DCGKCFTQSGAMKRHLRIHTGKKPYK----CDECGNCFSESGKLKRHLVIHTGEKPHKC--DDCGKRFTQSGDLKTHLRIHTGEKPYECDDC 344          

HSP 4 Score: 86.2705 bits (212), Expect = 1.802e-17
Identity = 74/242 (30.58%), Postives = 111/242 (45.87%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H + H   + + C+ C KC+T   +++ HL+ H    +K YKC++C        +L  H+ I+  E       +CD C + F     LK HL +H+ +  Y+C  C K       ++ H  +H  +KPY CD   C   F     LK H       +P K     D C   F +   LK H+ +H GEK Y C   DC + F     +  H+  H+G+KP+KC+ C  S  + A L  H
Sbjct:  158 LKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTG--KKPYKCDECGNCFSESAHLKAHLVIHSGEKPY----KCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCD--ECGNCFSESGKLKRHLVIHTGEKPHK----CDDCGKRFTQSGDLKTHLRIHTGEKPYEC--DDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTH 385          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO35311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLW8])

HSP 1 Score: 93.5893 bits (231), Expect = 7.884e-21
Identity = 52/162 (32.10%), Postives = 80/162 (49.38%), Query Frame = 2
Query: 1322 AEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXX--RYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCE 1801
            +   DT  C  + CD+ F ++  L  H+R H+ +  ++C+              + H   H  EKP+ C  + CD+AF T   LK+H       +P K  CP +TC   F+    L++H+  H GE+ + C +  C RSF T     VH+  HTGE+P+ CE
Sbjct:   24 SHTGDTFRCEENGCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGEKPFKCSFEQCDKAFATGYGLKSHMRTHTGEKPYK--CPKETCAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERPYICE 183          

HSP 2 Score: 93.2041 bits (230), Expect = 1.207e-20
Identity = 60/161 (37.27%), Postives = 80/161 (49.69%), Query Frame = 2
Query: 1343 HCRCDICDRMFASEFLLKDHLRMHTNDN-TYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKC--ELCDYS 1816
            HC  D C + F++ + LK H R HT D    +   C K   T+  L  H   H+ EKP+ C++D C R + T  +LK H+      +P K  C  + C   F     LK HM  H GEK Y C    C ++F+T   L  H+  HTGE+PFKC  E C  S
Sbjct:    2 HCNIDGCGKQFSTAYRLKAHGRSHTGDTFRCEENGCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGEKPFK--CSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRS 160          

HSP 3 Score: 90.5077 bits (223), Expect = 9.125e-20
Identity = 78/270 (28.89%), Postives = 119/270 (44.07%), Query Frame = 2
Query: 1070 FHISMMMNGQGNVDVDPLPIHSISHPHIQDFRC--NYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYX--XXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAK 1867
            +H ++   G+       L  H  SH     FRC  N C+K +  QS L  H++ H      + + + C        +L  H   +  E      C  + CD+ FA+ + LK H+R HT +  Y+   + C K  KT   L+ H   H  E+P+ C  + C R+F T    K H       +P  + C    C   F   ++ K H  +H GE+ Y C    CN+ F    +L  H + HT  KP+ C  C+ + RQ ++L  H R AH +
Sbjct:    1 YHCNIDGCGKQFSTAYRLKAHGRSHT-GDTFRCEENGCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGE--KPFKCSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERP--YICEHPGCGRAFASATNYKNHSRIHTGERPYVCQVIGCNKRFTEYSSLYKHHVVHTHTKPYTCNACNKTYRQTSTLANHKRTAHGE 265          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO42127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2E0])

HSP 1 Score: 96.2857 bits (238), Expect = 1.207e-20
Identity = 82/242 (33.88%), Postives = 118/242 (48.76%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            L  H  +H   + ++C+ C K +T  + LR H++ H    EK Y C+ C      Q  L  H  I+  +    +  +CD C++ F +   L+ H+  HT    ++C  C K+  + +  + HA VH  EKPY C    C R F     LK H     + +P K       C+ +F R S LK H+  H GE+ + C   +C R F  +   N HL  HTGEKPFKC+ CD    +KASL YH
Sbjct:  194 LVKHKFTHSGDKPYKCDSCPKQFTRPARLRDHMRTHTG--EKPYVCDVCGKGFAIQTGLKSHQAIHTGD----KPFKCDECEKTFRTALELQAHMGRHTGVKPFKCDICDKEFISAITFKRHAIVHTGEKPYECQ--ECGRRFARSTDLKVHLPVHSEDKPYK----CGECEKMFTRFSTLKEHIRTHTGERPFKC--DECGREFNHRSHFNNHLRIHTGEKPFKCDTCDKDFSRKASLRYH 421          

HSP 2 Score: 91.6633 bits (226), Expect = 3.242e-19
Identity = 61/189 (32.28%), Postives = 97/189 (51.32%), Query Frame = 2
Query: 1283 YQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTN-DNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            Y ++   + H+      + QH +C++C ++F     L+ H+ +HT  +  Y+C+ C K       LR H   H+ E+P+VCD + C ++F  P  L+ H+    + +P  H C  + C   F+  + L RH   H GEK + C    C ++F   + L  H   HTGEKPFKC+ CD++C Q   L  H
Sbjct:   14 YIRSWSYYGHMREHASGEKQH-KCEVCGKVFNYASNLRQHMLIHTGSEKPYECEYCDKAFNNPSSLRSHVLSHSEERPFVCDQEGCGKSFNNPGSLRVHRRVHQEDKP--HICEHEGCDKAFKTAAELSRHAFRHTGEKPHKC--DQCEKAFIRYDDLKRHYRIHTGEKPFKCDQCDFACIQSFDLVKH 197          

HSP 3 Score: 86.2705 bits (212), Expect = 1.922e-17
Identity = 75/243 (30.86%), Postives = 111/243 (45.68%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAE---INDTQHC-----------------------RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCD 1810
            + C YC+K + N SSLRSH+  H          E C  S     +L  H  ++  +   I + + C                       +CD C++ F     LK H R+HT +  ++C QC         L  H   H+ +KPY C  D+C + F  P  L++H       +P  + C  D C   F  ++ LK H A+H G+K + C   +C ++FRT   L  H+ RHTG KPFKC++CD
Sbjct:   63 YECEYCDKAFNNPSSLRSHVLSHSEERPFVCDQEGCGKSFNNPGSLRVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAFRHTGEKPHKCDQCEKAFIRYDDLKRHYRIHTGEKPFKCDQCDFACIQSFDLVKHKFTHSGDKPYKC--DSCPKQFTRPARLRDHMRTHTGEKP--YVC--DVCGKGFAIQTGLKSHQAIHTGDKPFKC--DECEKTFRTALELQAHMGRHTGVKPFKCDICD 297          

HSP 4 Score: 75.0998 bits (183), Expect = 8.153e-14
Identity = 56/166 (33.73%), Postives = 77/166 (46.39%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            +CD CD      F L  H   H+ D  Y+C  C K+     +LR H   H  EKPYVCD+  C + F     LK+H+      +P K     D C+  F+    L+ HM  H G K + C    C++ F +  T   H I HTGEKP++C+ C     +   L  H
Sbjct:  180 KCDQCDFACIQSFDLVKHKFTHSGDKPYKCDSCPKQFTRPARLRDHMRTHTGEKPYVCDV--CGKGFAIQTGLKSHQAIHTGDKPFK----CDECEKTFRTALELQAHMGRHTGVKPFKCDI--CDKEFISAITFKRHAIVHTGEKPYECQECGRRFARSTDLKVH 337          

HSP 5 Score: 69.3218 bits (168), Expect = 5.051e-12
Identity = 53/166 (31.93%), Postives = 82/166 (49.40%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMH-TNDNTYXXXXXXXXXXXXXXXRYHADVH-NPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNY 1843
            CDIC + +   +    H+R H + +  ++C+ C K       LR H  +H   EKPY C+   CD+AF  P  L++H     + +P    C  + C   F     L+ H  +H  +K + C    C+++F+T   L+ H  RHTGEKP KC+ C     +KA + Y
Sbjct:    7 CDICHKSYIRSWSYYGHMREHASGEKQHKCEVCGKVFNYASNLRQHMLIHTGSEKPYECEY--CDKAFNNPSSLRSHVLSHSEERP--FVCDQEGCGKSFNNPGSLRVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAFRHTGEKPHKCDQC-----EKAFIRY 163          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO36354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW9])

HSP 1 Score: 94.3597 bits (233), Expect = 1.746e-20
Identity = 73/245 (29.80%), Postives = 109/245 (44.49%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            L IHS S P    ++C  C++ +T   + + H+  HMN            +       +L    +    I + +  RC +C + F     LK H+RMHT +  Y C+ C     T   L+ H  +H  EKPY C++  CDRAF     +  H       +P K       C   F R  HL+RH+ +H  +K Y C    C +SF     L  H+ +HTGE+P++C+ C     Q  +L  H R 
Sbjct:   79 LLIHSNSKP----YKCEECDREFTWFGNFQKHILSHMNNTSPSNASFSAMF------TMLAREQVKDLFIKEGEKYRCRLCSKDFTRLSGLKTHIRMHTGERPYVCEVCSFAFTTSRALKMHMRLHTGEKPYKCEV--CDRAFTRRDEMHTHMYIHKGEKPFK----CTQCPASFIRYGHLQRHLLIHSDDKPYKCKL--CPKSFTQYRNLQTHMYKHTGERPYRCKYCPKGFTQYGTLQAHERT 305          

HSP 2 Score: 58.9214 bits (141), Expect = 7.092e-9
Identity = 71/283 (25.09%), Postives = 113/283 (39.93%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSH-----LKKHMNIDXXXXXXXXXXXXXQYQK---------------------NLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNT----------------------------YXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            F+CN C+  +  +S L+ H       K              SYS +Y++                     +L +H+ I+    ++++  +C+ CDR F      + H+  H N+ +                            Y+C+ C K       L+ H  +H  E+PYVC++  C  AF T + LK H       +P K     + C   F R+  +  HM +H GEK + C    C  SF     L  HL+ H+ +KP+KC+LC  S  Q  +L  H
Sbjct:    4 FKCNECSASFIRRSELQHHSLIHDTGKQFKCSRDAEIKSFHSYSQEYERAHREDKPFRCTQCVMSFTRPSDLQRHLLIH----SNSKPYKCEECDREFTWFGNFQKHILSHMNNTSPSNASFSAMFTMLAREQVKDLFIKEGEKYRCRLCSKDFTRLSGLKTHIRMHTGERPYVCEV--CSFAFTTSRALKMHMRLHTGEKPYK----CEVCDRAFTRRDEMHTHMYIHKGEKPFKC--TQCPASFIRYGHLQRHLLIHSDDKPYKCKLCPKSFTQYRNLQTH 274          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000046369.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:101175064])

HSP 1 Score: 113.235 bits (282), Expect = 2.757e-25
Identity = 79/244 (32.38%), Postives = 118/244 (48.36%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            L  H   H   + F C  C K + ++ +L+ H++ H   +    +     +  ++Q NL  HM I+  E        CDIC +    +  LK H+ +H  +  + C  C K+   K  LR H  VH  EKPY CD+  C ++++   +L+ H     + +P       + C   F RK+HL  HMA+H GEK Y C +  C + F  +  LN H+  HTGEKPF C +C     Q+ SLN H R
Sbjct:  292 LRSHMRVHSEEKPFGCQSCGKSFKHEHNLKIHMRIHTGEEPFGCEVCGKRF--KHQHNLKTHMRIHTGEKPFV----CDICGKRARHQNNLKTHMIVHKGERPFGCDVCGKRFNRKTSLRAHMTVHTGEKPYGCDV--CGKSYKRKTHLRTHMTVHAEEKPFG----CEVCGKRFNRKTHLATHMAVHTGEKPYSCDF--CGKRFTRKTHLNSHITVHTGEKPFGCGVCGQEFTQQGSLNRHVR 521          

HSP 2 Score: 86.2705 bits (212), Expect = 1.079e-16
Identity = 62/229 (27.07%), Postives = 106/229 (46.29%), Query Frame = 2
Query: 1160 FRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            F C+ C K +  + SL+ H++++                 +        +H    +        CD C + F   F L+ H+R+H+ +  + CQ C K  K +  L+ H  +H  E+P+ C++  C + F+    LK H    H  + K   C  D C    + +++LK HM +H GE+ + C    C + F  + +L  H+  HTGEKP+ C++C  S ++K  L  H
Sbjct:  221 FSCSECGKQFLYKQSLKRHMRRNTEKSPAGCALNAKRPELRPSAEPQSRVHTGKKKFA------CDDCGKTFRDHFSLRSHMRVHSEEKPFGCQSCGKSFKHEHNLKIHMRIHTGEEPFGCEV--CGKRFKHQHNLKTHM-RIHTGE-KPFVC--DICGKRARHQNNLKTHMIVHKGERPFGCDV--CGKRFNRKTSLRAHMTVHTGEKPYGCDVCGKSYKRKTHLRTH 435          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000037027.1 (pep primary_assembly:ASM223467v1:2:8787304:8820031:1 gene:ENSORLG00000022699.1 transcript:ENSORLT00000037027.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 4.160e-24
Identity = 89/261 (34.10%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKPIT 1903
            L IH  +H   + F C  CN+ Y++ S+L++H++ H   ++     E     SQ   NL+ HM  +  E   +    C  CD+ F+    L+ H+R HT +  Y C++C K     L L+ H   H  EKP+ C    C R++R    L N K        +K F   + C   F RKSHLK HM  H GEK +HC   +C+  F     L  H+  HTGEKPF CE CD S    + L  H R        +  G KP T
Sbjct:  146 LKIHMRTHTGEKPFSCKECNRRYSDLSNLKTHMRTHTG-EKPFSCKECDIRFSQISSNLITHMKSHTGEKPFS----CKECDKSFSRNINLQIHMRTHTGEKPYSCKECDKSFSLNLNLKTHMRTHTGEKPFCCI--ECKRSYRD---LSNFKKHIRTHTGEKPF-SCNECDKSFSRKSHLKLHMRTHTGEKPFHC--KECDTHFSRMGNLKTHIRTHTGEKPFSCEECDSSFTDTSRLKKHMR--------KHTGEKPFT 385          

HSP 2 Score: 72.0182 bits (175), Expect = 2.043e-12
Identity = 77/270 (28.52%), Postives = 111/270 (41.11%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNL-LK-HMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRY-HADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN------AHAKDCE 1876
            G+   ++     H   H   + F C  CN       S  ++LK HM I   +           + +NL LK HM  +  E   +    C  C+R ++    LK H+R HT +  + C++C  +          H   H  EKP+ C    CD++F     L+ H       +P         C   F    +LK HM  H GEK + C   +C RS+R       H+  HTGEKPF C  CD S  +K+ L  H R        H K+C+
Sbjct:   81 GESFGNLSQCRFHMKLHKKGKHFVCKVCNI----SCSKIANLKTHMRIHTGEKPFSCKECDKSFSRNLNLKIHMRTHTGEKPFS----CKECNRRYSDLSNLKTHMRTHTGEKPFSCKECDIRFSQISSNLITHMKSHTGEKPFSCK--ECDKSFSRNINLQIHMRTHTGEKPY----SCKECDKSFSLNLNLKTHMRTHTGEKPFCC--IECKRSYRDLSNFKKHIRTHTGEKPFSCNECDKSFSRKSHLKLHMRTHTGEKPFHCKECD 334          

HSP 3 Score: 54.6842 bits (130), Expect = 5.852e-7
Identity = 55/193 (28.50%), Postives = 82/193 (42.49%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQ--KNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGE 1693
            L IH  +H   + + C  C+K +    SL  +LK HM     +           Y+   N  KH+  +  E   +    C+ CD+ F+ +  LK H+R HT +  + C++C         L+ H   H  EKP+ C+   CD +F     LK H     K   +K F     C   F    +LKRH+  H GE
Sbjct:  231 LQIHMRTHTGEKPYSCKECDKSF----SLNLNLKTHMRTHTGEKPFCCIECKRSYRDLSNFKKHIRTHTGEKPFS----CNECDKSFSRKSHLKLHMRTHTGEKPFHCKECDTHFSRMGNLKTHIRTHTGEKPFSCE--ECDSSFTDTSRLKKH---MRKHTGEKPF-TCKECDKSFSDTCNLKRHIRTHTGE 409          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000028476.1 (pep primary_assembly:ASM223467v1:17:10987274:10993813:-1 gene:ENSORLG00000007009.2 transcript:ENSORLT00000028476.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 4.815e-24
Identity = 79/245 (32.24%), Postives = 116/245 (47.35%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            L +H  +H   + F C  C K + +  SL++H + H    EK + CE C  S     +L  HM  +  E   +    C+IC + F     L+DH+R+HT +  + C+ C K       L++H   H  EKP+ C I  C +AF  P  L NH  +    +P       + C   F R S LK HM  H GE+ + C    C + F+   +L  H+  HTGE+PF C++C  S  Q  +L  H R 
Sbjct:   99 LTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTH--TGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFS----CEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKI--CGKAFFQPYILTNHMRKHTGERPF----SCEICGKSFIRNSSLKDHMKSHTGERPFTCKM--CGKGFKRNASLEAHVRTHTGERPFSCDMCGKSFTQSGNLTAHMRT 329          

HSP 2 Score: 80.8777 bits (198), Expect = 1.854e-15
Identity = 55/167 (32.93%), Postives = 79/167 (47.31%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C+IC + F     L  H+R HT +  + C+ C K  K    L+ H   H  EKP+ C+I  C ++      LK+H       +P       + C   F + S L+ HM +H GEK + C    C ++F    TL  H+  HTGEKPF C++C  +  Q   L  H R
Sbjct:   86 CEICGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEI--CGKSLMKNSSLKDHMRTHTGERPF----SCEICAKGFVKNSSLRDHMRIHTGEKPFSC--KTCGKAFTQNSTLQHHMRTHTGEKPFSCKICGKAFFQPYILTNHMR 244          

HSP 3 Score: 76.2554 bits (186), Expect = 5.837e-14
Identity = 66/237 (27.85%), Postives = 102/237 (43.04%), Query Frame = 2
Query: 1076 ISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEK 1786
             S  + G+  +    L  H  +H   + F C  C K +   SSLR H++ H    EK + C+ C  +      L  HM  +  E   +    C IC + F   ++L +H+R HT +  + C+ C K       L+ H   H  E+P+ C +  C + F+    L+ H       +P       D C   F +  +L  HM  H GE  Y C    C +SF    +L+ H++ HTG K
Sbjct:  140 FSCEICGKSLMKNSSLKDHMRTHTGERPFSCEICAKGFVKNSSLRDHMRIH--TGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFS----CKICGKAFFQPYILTNHMRKHTGERPFSCEICGKSFIRNSSLKDHMKSHTGERPFTCKM--CGKGFKRNASLEAHVRTHTGERPF----SCDMCGKSFTQSGNLTAHMRTHTGETPYSCQL--CGKSFGRSFSLSAHMMTHTGTK 362          

HSP 4 Score: 54.299 bits (129), Expect = 6.646e-7
Identity = 29/78 (37.18%), Postives = 39/78 (50.00%), Query Frame = 2
Query: 1622 VDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
             + C   F   S L  HM  H GE+ + C    C ++F+   +L  H   HTGEKPF CE+C  S  + +SL  H R 
Sbjct:   86 CEICGKDFTVSSRLTVHMRTHTGERPFLCKL--CGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRT 161          

HSP 5 Score: 51.2174 bits (121), Expect = 6.942e-6
Identity = 26/67 (38.81%), Postives = 33/67 (49.25%), Query Frame = 2
Query: 1655 SHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            S+    M  H  EKNY C    C + F     L VH+  HTGE+PF C+LC  + +   SL  H R 
Sbjct:   69 SNFSTQMKKHTEEKNYSCEI--CGKDFTVSSRLTVHMRTHTGERPFLCKLCGKTFKHSGSLKAHTRT 133          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000043182.1 (pep primary_assembly:ASM223467v1:2:9207508:9286651:-1 gene:ENSORLG00000027822.1 transcript:ENSORLT00000043182.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 2.793e-23
Identity = 80/256 (31.25%), Postives = 119/256 (46.48%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLG 1888
            L  H  +H   + F C  C+K ++  S+LR+H++ H        K     +S     +L +HM  +  E   +    C  C++ F+    LK H+R HT +  + C++C         L+ H   H  EKP+ C    CD++F     L++H       +P         C   F   SHLKRHM  H GEK + C+  +C++SF     L  H+  HTGEKPF C+ CD S  Q +SL  H R       E++LG
Sbjct:  242 LQTHMRTHTGEKPFTCKECDKSFSEISNLRTHMRTHTREKPFTCKECDKRFSQSDAYDLKRHMRTHTGEKPYS----CKECEKCFSQISSLKSHMRTHTGEKPFSCKECDASFSRVSNLKTHMRTHTGEKPFSCK--ECDKSFSHISSLRSHMRTHTGEKP----FTCKECDQSFSEISHLKRHMRTHTGEKPFSCN--ECDKSFSQVSHLKTHIRTHTGEKPFSCKECDSSFSQISSLKRHMRTHTG---EKVLG 482          

HSP 2 Score: 90.5077 bits (223), Expect = 4.231e-18
Identity = 77/256 (30.08%), Postives = 117/256 (45.70%), Query Frame = 2
Query: 1094 GQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXX--XXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            G G   +  + IH  +H   + F C  C+  ++  S L++H++ H    EK + C++C    +   +L  HM  +  E   T    C  CD+ F+    L+ H+R HT +  + C++            L+ H   H  EKPY C    C++ F     LK+H       +P         C   F R S+LK HM  H GEK + C   +C++SF    +L  H+  HTGEKPF C+ CD S  + + L  H R 
Sbjct:  177 GMGFDYLSQVRIHMTTHTGEKPFPCKECDTSFSRVSDLKTHMRTHTG--EKPFCCKECDTRFRQLSHLQTHMRTHTGEKPFT----CKECDKSFSEISNLRTHMRTHTREKPFTCKECDKRFSQSDAYDLKRHMRTHTGEKPYSC--KECEKCFSQISSLKSHMRTHTGEKPFS----CKECDASFSRVSNLKTHMRTHTGEKPFSCK--ECDKSFSHISSLRSHMRTHTGEKPFTCKECDQSFSEISHLKRHMRT 418          

HSP 3 Score: 77.0258 bits (188), Expect = 6.126e-14
Identity = 64/226 (28.32%), Postives = 91/226 (40.27%), Query Frame = 2
Query: 1109 DVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEK 1786
            D   L  H  +H   + + C  C KC++  SSL+SH++ H                                         C  CD  F+    LK H+R HT +  + C++C K       LR H   H  EKP+ C    CD++F    +LK H       +P       + C   F + SHLK H+  H GEK + C   +C+ SF    +L  H+  HTGEK
Sbjct:  296 DAYDLKRHMRTHTGEKPYSCKECEKCFSQISSLKSHMRTHTGEKPFS----------------------------------CKECDASFSRVSNLKTHMRTHTGEKPFSCKECDKSFSHISSLRSHMRTHTGEKPFTC--KECDQSFSEISHLKRHMRTHTGEKPFS----CNECDKSFSQVSHLKTHIRTHTGEKPFSCK--ECDSSFSQISSLKRHMRTHTGEK 479          

HSP 4 Score: 61.2326 bits (147), Expect = 5.589e-9
Identity = 49/170 (28.82%), Postives = 73/170 (42.94%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQET--LNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRN 1855
            C  C   F     ++ H+  HT +  + C++C         L+ H   H  EKP+ C    CD  FR   +L+ H       +P         C   F   S+L+ HM  H  EK + C   +C++ F   +   L  H+  HTGEKP+ C+ C+    Q +SL  H R 
Sbjct:  173 CKECGMGFDYLSQVRIHMTTHTGEKPFPCKECDTSFSRVSDLKTHMRTHTGEKPFCCK--ECDTRFRQLSHLQTHMRTHTGEKP----FTCKECDKSFSEISNLRTHMRTHTREKPFTCK--ECDKRFSQSDAYDLKRHMRTHTGEKPYSCKECEKCFSQISSLKSHMRT 334          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000030831.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:101175064])

HSP 1 Score: 99.3673 bits (246), Expect = 1.624e-22
Identity = 75/231 (32.47%), Postives = 105/231 (45.45%), Query Frame = 2
Query: 1154 QDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYH 1846
            + F C+ C K + +  SLRSH++ H                                  ++ +   C  C + F  E  LK H+R+HT +  + C+ C K+ K +  L+ H  +H  EKP+VCDI  C +  R    LK H       +P       D C   F RK+HL  HMA+H GEK Y C +  C + F  +  LN H+  HTGEKPF C +C     Q+ SLN H
Sbjct:   48 KKFACDDCGKTFRDHFSLRSHMRVH----------------------------------SEEKPFGCQSCGKSFKHEHNLKIHMRIHTGEEPFGCEVCGKRFKHQHNLKTHMRIHTGEKPFVCDI--CGKRARHQNNLKTHMIVHKGERPF----GCDVCGKRFNRKTHLATHMAVHTGEKPYSCDF--CGKRFTRKTHLNSHITVHTGEKPFGCGVCGQEFTQQGSLNRH 236          

HSP 2 Score: 55.0694 bits (131), Expect = 1.631e-7
Identity = 31/87 (35.63%), Postives = 47/87 (54.02%), Query Frame = 2
Query: 1592 KLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +L+P K F   D C   F+    L+ HM +H  EK + C    C +SF+ +  L +H+  HTGE+PF CE+C    + + +L  H R
Sbjct:   43 ELRPSKKF-ACDDCGKTFRDHFSLRSHMRVHSEEKPFGCQ--SCGKSFKHEHNLKIHMRIHTGEEPFGCEVCGKRFKHQHNLKTHMR 126          

HSP 3 Score: 50.447 bits (119), Expect = 4.794e-6
Identity = 47/152 (30.92%), Postives = 72/152 (47.37%), Query Frame = 2
Query: 1121 LPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNH 1576
            L IH   H   + F C  C K + +Q +L++H++ H    EK + C+ C   +++Q NL  HM ++  E        CD+C + F  +  L  H+ +HT +  Y C  C K+   K  L  H  VH  EKP+ C +  C + F     L  H
Sbjct:   93 LKIHMRIHTGEEPFGCEVCGKRFKHQHNLKTHMRIHTG--EKPFVCDICGKRARHQNNLKTHMIVHKGERPFG----CDVCGKRFNRKTHLATHMAVHTGEKPYSCDFCGKRFTRKTHLNSHITVHTGEKPFGCGV--CGQEFTQQGSLNRH 236          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000060422.1 (SMESG000060422.1)

HSP 1 Score: 2419.81 bits (6270), Expect = 0.000e+0
Identity = 1417/1419 (99.86%), Postives = 1417/1419 (99.86%), Query Frame = 2
Query:  131 MIDTKVNISDNNQDSPLSPNYDPQDCDQIKDGDVSDDIADKALYLISDNKNKSPASLSLSSTPCENQNYEHPIQYKGLNNSEDTSSSINCAEFAAISEHNEPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQANNSIMQERWKELDKYGLSNHILHTQQNGEPPNSANLYRMSAPINLSANHPIPEPGPPSNDFLINNPPMQDESYHMGMNAHVANNALNXXXXXXXXXXXXNKLSPTKNTHLHPMENDPHFHMVSQKPFKSDPLHCRLPHPNPNMHLNHSAINFDYSKQARHGVNPQSYPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDXXXXXXXXXXXXXQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKPITNDCKXXXXXXXXXXXXXXSDPMIDCDNQRHESAKFDTNSDENDCKLESKIESDINGIISNLDKDPNIVDIFKKPAPVDENDLLRKEVFMLVDDVLCNPPRYYGEVEEFSLEELCTIELSIKSKRGRKRKVLKELDALLAMSLSEVQTIXXXXXSLSYKEDAEDDIEQHSPILNTKSQYIPSLVQXXXXXXXXXXXXXXXXXXXXXRPLSGFSDIQDGRITPEILQRHRNSTPPDNSKRYSLTMNGTKKLPSNRITSFSSSNHTNGVSSFDANYILNNNNSCGPDQHSLSRSNSPISGHIKVDDAGSVEDMTDNIESAPNSINRITPEPANLSCQKRNILSPKREFLLHKSPDRKLLSNVDIKLEDESNIHGFQSLQKQFENPLSALSNLENLKMNKDLLDQVLEDLKVIQNDEDHRQKTFLSPNSAATVYSSNNSFRNISELNSTSESGSKINSKLSNVPHSLKISTNENHVQPKXXXXXXXXXXXXXXXXXXXXLNKDNTNINALNPGCSNMSVSSISDRGYKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNSDFYNSYQQNISNNRTSTGSNYNSYDGPVSGLTSELTNMSNICSSMYKNGLEDHLRSLTALGSKYMETSGYQGSNRSDSNSGPDANGMGPFXXXXXXXXXXXGDYLSIAXXXXXXXXXLNPFDPTNVRNGIGDYCNLAQSPTVAAAADLYSQMAASANYDKYSSLYGCRDSFYXXXXXXXXXXXXXDTAFPINSNHYVDRSYLSSNHPFYPQSVSDQYNSRYPPASAADYLSVGRQFXXXXXXXXNPFAVGSDPYRNSMLHNMSPFNRYPF 4387
            MIDTKVNISDNNQDSPLSPNYDPQDCDQIKDGDVSDDIADKALYLISDNKNKSPASLSLSSTPCENQNYEHPIQYKGLNNSEDTSSSINCAEFAAISEHNEPNDEFDYESEESEESESDSEFSTEDEDSSDENDPDQANNSIMQERWKELDKYGLSNHILHTQQNGEPPN ANLYRMSAPINLSANHPIPEPGPPSNDFLINNPPMQDESYHMGMNAHVANNALNMSMRHMSSMQSMNKLSPTKNTHLHPMENDPHFHMVSQKPFKSDPLHCRLPHPNPNMHLNHSAINFDYSKQARHGVNPQSYPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDEKKYKCEKCSYSSQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYQCQQCCKKLKTKLKLRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKPITNDCKPPGTRPVGRPPRNRSDPMIDCDNQRHESAKFDTNSDENDCKLESKIESDINGIISNLDKDPNIVDIFKKPAPVDENDLLRKEVFMLVDDVLCNPPRYYGEVEEFSLEELCTIELSIKSKRGRKRKVLKELDALLAMSLSE QTIDDDDDSLSYKEDAEDDIEQHSPILNTKSQYIPSLVQSTSNNNSNCMSNKNNNNNNNNRPLSGFSDIQDGRITPEILQRHRNSTPPDNSKRYSLTMNGTKKLPSNRITSFSSSNHTNGVSSFDANYILNNNNSCGPDQHSLSRSNSPISGHIKVDDAGSVEDMTDNIESAPNSINRITPEPANLSCQKRNILSPKREFLLHKSPDRKLLSNVDIKLEDESNIHGFQSLQKQFENPLSALSNLENLKMNKDLLDQVLEDLKVIQNDEDHRQKTFLSPNSAATVYSSNNSFRNISELNSTSESGSKINSKLSNVPHSLKISTNENHVQPKSLDSSLWSDSGYSSGHDSSGLNKDNTNINALNPGCSNMSVSSISDRGYKIPSPSSSAAAAFIEKTAAAAEMAALSASAALLNSDFYNSYQQNISNNRTSTGSNYNSYDGPVSGLTSELTNMSNICSSMYKNGLEDHLRSLTALGSKYMETSGYQGSNRSDSNSGPDANGMGPFSNFWSSASVSSGDYLSIASNGGSGGSSLNPFDPTNVRNGIGDYCNLAQSPTVAAAADLYSQMAASANYDKYSSLYGCRDSFYGNSGSSSRGLNNGDTAFPINSNHYVDRSYLSSNHPFYPQSVSDQYNSRYPPASAADYLSVGRQFSSGGPSSGNPFAVGSDPYRNSMLHNMSPFNRYPF
Sbjct:    1 MIDTKVNISDNNQDSPLSPNYDPQDCDQIKDGDVSDDIADKALYLISDNKNKSPASLSLSSTPCENQNYEHPIQYKGLNNSEDTSSSINCAEFAAISEHNEPNDEFDYESEESEESESDSEFSTEDEDSSDENDPDQANNSIMQERWKELDKYGLSNHILHTQQNGEPPNPANLYRMSAPINLSANHPIPEPGPPSNDFLINNPPMQDESYHMGMNAHVANNALNMSMRHMSSMQSMNKLSPTKNTHLHPMENDPHFHMVSQKPFKSDPLHCRLPHPNPNMHLNHSAINFDYSKQARHGVNPQSYPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCNKCYTNQSSLRSHLKKHMNIDEKKYKCEKCSYSSQYQKNLLKHMHINHAEINDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYQCQQCCKKLKTKLKLRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKPITNDCKPPGTRPVGRPPRNRSDPMIDCDNQRHESAKFDTNSDENDCKLESKIESDINGIISNLDKDPNIVDIFKKPAPVDENDLLRKEVFMLVDDVLCNPPRYYGEVEEFSLEELCTIELSIKSKRGRKRKVLKELDALLAMSLSEAQTIDDDDDSLSYKEDAEDDIEQHSPILNTKSQYIPSLVQSTSNNNSNCMSNKNNNNNNNNRPLSGFSDIQDGRITPEILQRHRNSTPPDNSKRYSLTMNGTKKLPSNRITSFSSSNHTNGVSSFDANYILNNNNSCGPDQHSLSRSNSPISGHIKVDDAGSVEDMTDNIESAPNSINRITPEPANLSCQKRNILSPKREFLLHKSPDRKLLSNVDIKLEDESNIHGFQSLQKQFENPLSALSNLENLKMNKDLLDQVLEDLKVIQNDEDHRQKTFLSPNSAATVYSSNNSFRNISELNSTSESGSKINSKLSNVPHSLKISTNENHVQPKSLDSSLWSDSGYSSGHDSSGLNKDNTNINALNPGCSNMSVSSISDRGYKIPSPSSSAAAAFIEKTAAAAEMAALSASAALLNSDFYNSYQQNISNNRTSTGSNYNSYDGPVSGLTSELTNMSNICSSMYKNGLEDHLRSLTALGSKYMETSGYQGSNRSDSNSGPDANGMGPFSNFWSSASVSSGDYLSIASNGGSGGSSLNPFDPTNVRNGIGDYCNLAQSPTVAAAADLYSQMAASANYDKYSSLYGCRDSFYGNSGSSSRGLNNGDTAFPINSNHYVDRSYLSSNHPFYPQSVSDQYNSRYPPASAADYLSVGRQFSSGGPSSGNPFAVGSDPYRNSMLHNMSPFNRYPF 1419          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000032379.1 (SMESG000032379.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.359e-14
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 2
Query: 1616 CPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            C  + C  V+ ++SHLK H  +H GEK Y C+WPDC   F   + L  H  +HTG++P+KC+ CD S  +   L  H R
Sbjct:  115 CDYEGCFKVYNKRSHLKAHFRVHTGEKPYSCNWPDCGWKFARSDELTRHYRKHTGQRPYKCQWCDKSFARSDHLLLHKR 193          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.628e-13
Identity = 49/168 (29.17%), Postives = 70/168 (41.67%), Query Frame = 2
Query: 1349 RCDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCR 1852
            +C +C R +A    LK H+R H+ +  ++C  C K       L  H  +H+ EKP+ C I                                  C   F + S +  HM  H GE+ Y CH   C+++F    TL  H   H+GEKP+KC +C     Q  +LN H R
Sbjct:  318 QCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHI----------------------------------CCRTFSQSSSVTTHMRTHSGERPYRCH--HCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRHMR 449          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000053472.1 (SMESG000053472.1)

HSP 1 Score: 69.707 bits (169), Expect = 9.475e-12
Identity = 48/173 (27.75%), Postives = 76/173 (43.93%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            C+ C +MFA E+    HL+                        Y   V    + + C    C R+F     L+ H    H+ + + H C V  C   F + S L +H+ +H GE+ Y C +  C+++F     L  H+ +H+GEKPFKC+ C  S    A+ + H R  H ++
Sbjct:  356 CEQCGKMFAYEYYKAKHLK------------------------YTRCVDQGNRKFPCS--QCSRSFEKRDRLRIHVLHVHE-KHRPHKCTV--CGKSFSQSSSLNKHLRVHSGERPYKCIY--CDKAFTASSILRTHIRQHSGEKPFKCKYCWKSFASHAAHDSHVRRTHGQN 497          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000053472.1 (SMESG000053472.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.002e-11
Identity = 48/173 (27.75%), Postives = 76/173 (43.93%), Query Frame = 2
Query: 1352 CDICDRMFASEFLLKDHLRMHTNDNTYXXXXXXXXXXXXXXXRYHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDTCKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTGEKPFKCELCDYSCRQKASLNYHCRNAHAKD 1870
            C+ C +MFA E+    HL+                        Y   V    + + C    C R+F     L+ H    H+ + + H C V  C   F + S L +H+ +H GE+ Y C +  C+++F     L  H+ +H+GEKPFKC+ C  S    A+ + H R  H ++
Sbjct:  351 CEQCGKMFAYEYYKAKHLK------------------------YTRCVDQGNRKFPCS--QCSRSFEKRDRLRIHVLHVHE-KHRPHKCTV--CGKSFSQSSSLNKHLRVHSGERPYKCIY--CDKAFTASSILRTHIRQHSGEKPFKCKYCWKSFASHAAHDSHVRRTHGQN 492          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF8164.451e-2333.33zinc finger protein 816 [Source:HGNC Symbol;Acc:HG... [more]
ZNF8164.451e-2333.33zinc finger protein 816 [Source:HGNC Symbol;Acc:HG... [more]
ZNF7827.137e-2333.20zinc finger protein 782 [Source:HGNC Symbol;Acc:HG... [more]
ZNF7827.137e-2333.20zinc finger protein 782 [Source:HGNC Symbol;Acc:HG... [more]
ZNF281.209e-2236.36zinc finger protein 28 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y55F3AM.143.362e-1424.70pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
Y55F3AM.143.362e-1424.70pep chromosome:WBcel235:IV:1058695:1067525:-1 gene... [more]
klu-15.302e-1234.71KLUmpfuss related [Source:UniProtKB/TrEMBL;Acc:O4... [more]
F47E1.33.340e-1127.65pep chromosome:WBcel235:X:9046213:9054885:1 gene:W... [more]
klf-34.299e-1137.04Kruppel-Like Factor (Zinc finger protein) [Source... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dwg2.337e-2033.77gene:FBgn0000520 transcript:FBtr0070487[more]
Kr-h19.416e-1836.60gene:FBgn0266450 transcript:FBtr0344437[more]
Kr-h19.911e-1836.60gene:FBgn0266450 transcript:FBtr0344438[more]
CG122991.460e-1730.87gene:FBgn0032295 transcript:FBtr0080113[more]
Phs1.680e-1635.93gene:FBgn0036522 transcript:FBtr0075570[more]
back to top
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR450780.21.264e-2431.03pep chromosome:GRCz11:4:63075252:63080760:-1 gene:... [more]
BX324212.24.297e-2433.74pep chromosome:GRCz11:4:38589553:38608436:-1 gene:... [more]
znf10266.303e-2432.55zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE... [more]
BX005085.52.690e-2331.62pep chromosome:GRCz11:3:7141360:7147226:-1 gene:EN... [more]
si:ch73-367f21.46.495e-2334.30si:ch73-367f21.4 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000024787.11.694e-2232.92gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
ENSXETT00000054824.14.084e-2032.17pep primary_assembly:Xenopus_tropicalis_v9.1:9:297... [more]
ENSXETT00000054823.14.084e-2032.17pep primary_assembly:Xenopus_tropicalis_v9.1:9:297... [more]
ENSXETT00000054822.14.084e-2032.17pep primary_assembly:Xenopus_tropicalis_v9.1:9:297... [more]
ENSXETT00000029880.17.509e-2039.29ZFP91 zinc finger protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp9341.802e-2232.94zinc finger protein 934 [Source:MGI Symbol;Acc:MGI... [more]
Zfp9342.303e-2232.94zinc finger protein 934 [Source:MGI Symbol;Acc:MGI... [more]
Gm68712.714e-2232.24predicted gene 6871 [Source:MGI Symbol;Acc:MGI:364... [more]
Gm51415.147e-2233.61predicted gene 5141 [Source:MGI Symbol;Acc:MGI:377... [more]
Gm51415.405e-2233.61predicted gene 5141 [Source:MGI Symbol;Acc:MGI:377... [more]
back to top
BLAST of Zinc finger protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VGE8|ZN816_HUMAN2.137e-2233.33Zinc finger protein 816 OS=Homo sapiens OX=9606 GN... [more]
sp|Q6ZMW2|ZN782_HUMAN3.427e-2233.20Zinc finger protein 782 OS=Homo sapiens OX=9606 GN... [more]
sp|P17035|ZNF28_HUMAN5.805e-2236.36Zinc finger protein 28 OS=Homo sapiens OX=9606 GN=... [more]
sp|O43345|ZN208_HUMAN1.435e-2032.67Zinc finger protein 208 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9BU19|ZN692_HUMAN1.898e-2043.80Zinc finger protein 692 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Zinc finger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NYL88.734e-7044.03Zinc finger protein 782 OS=Schistocephalus solidus... [more]
A0A5K3EV489.480e-6854.81Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4Z2DWX86.420e-6746.08Zinc finger protein OS=Schistosoma japonicum OX=61... [more]
A0A158QGB55.236e-6654.69Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A4V3SDL41.061e-6544.64Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011224.21.256e-2235.07pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033422.12.514e-2232.93pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034301.14.749e-2233.84pep primary_assembly:Astyanax_mexicanus-2.0:22:223... [more]
ENSAMXT00000015177.25.905e-2230.15oocyte zinc finger protein XlCOF6-like [Source:NCB... [more]
GZF18.934e-2228.24GDNF inducible zinc finger protein 1 [Source:HGNC ... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008278.17.124e-2242.48pep scaffold:Pmarinus_7.0:GL477891:43090:46668:-1 ... [more]
znf143b1.867e-2134.27zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
znf143b1.743e-2034.09zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
ENSPMAT00000001428.13.506e-1829.75pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1... [more]
ENSPMAT00000000727.11.202e-1735.58pep scaffold:Pmarinus_7.0:GL483797:4504:5526:-1 ge... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP12.017e-1232.23Zinc-regulated transcription factor; binds to zinc... [more]
PZF11.477e-934.17Transcription factor IIIA (TFIIIA); essential DNA ... [more]
AZF15.365e-937.04Zinc-finger transcription factor; involved in diau... [more]
MIG23.303e-845.28Zinc finger transcriptional repressor; cooperates ... [more]
RGM14.780e-744.44Putative zinc finger DNA binding transcription fac... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466284.338e-2230.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268791.371e-2130.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353117.884e-2132.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421271.207e-2033.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363541.746e-2029.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046369.12.757e-2532.38gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
ENSORLT00000037027.14.160e-2434.10pep primary_assembly:ASM223467v1:2:8787304:8820031... [more]
ENSORLT00000028476.14.815e-2432.24pep primary_assembly:ASM223467v1:17:10987274:10993... [more]
ENSORLT00000043182.12.793e-2331.25pep primary_assembly:ASM223467v1:2:9207508:9286651... [more]
ENSORLT00000030831.11.624e-2232.47gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
back to top
BLAST of Zinc finger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060422.10.000e+099.86SMESG000060422.1[more]
SMESG000032379.11.359e-1441.77SMESG000032379.1[more]
SMESG000000679.18.628e-1329.17SMESG000000679.1[more]
SMESG000053472.19.475e-1227.75SMESG000053472.1[more]
SMESG000053472.11.002e-1127.75SMESG000053472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027858 ID=SMED30027858|Name=Zinc finger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4784bp
AAAATTCAAACTGAATTTTTGATTATTTTCATCAATTCTGTTTTACATTA
GAAAAATTTGATTTTTTTTACTGAAAGTAATTTATCTTAAATTCTGTATT
AAACATTTATTAATAAATAATAATGTTAATATGATTGACACAAAAGTTAA
TATCAGTGATAATAATCAAGATTCGCCACTCTCCCCTAATTATGATCCTC
AAGATTGTGACCAAATCAAAGATGGTGATGTGTCAGATGATATTGCCGAC
AAAGCTCTTTATTTGATATCAGATAATAAAAATAAATCTCCTGCTTCGTT
ATCATTATCGTCGACACCTTGTGAAAATCAAAATTATGAACATCCAATTC
AGTATAAAGGTTTAAATAATTCGGAAGACACATCTAGCAGTATAAATTGT
GCAGAATTTGCTGCTATTAGTGAACACAATGAACCAAATGATGAATTTGA
TTACGAATCTGAAGAAAGTGAAGAGAGTGAATCTGATTCTGAATTTTCAA
CAGAAGACGAGGATTCCTCTGATGAAAACGATCCAGATCAAGCAAACAAC
TCAATAATGCAAGAACGTTGGAAAGAATTAGACAAATACGGTCTGTCTAA
TCATATTTTACATACGCAACAGAATGGTGAACCTCCAAATTCTGCAAATC
TTTACCGAATGAGTGCGCCAATAAATCTATCGGCTAATCATCCTATACCG
GAACCAGGACCACCTTCAAATGATTTTTTAATCAACAATCCACCAATGCA
AGATGAATCCTATCACATGGGAATGAATGCTCATGTTGCAAATAACGCAT
TAAATATGTCAATGCGTCACATGTCGTCAATGCAATCCATGAATAAATTA
TCTCCCACTAAAAACACACATTTGCATCCAATGGAAAATGACCCTCATTT
TCATATGGTGTCTCAAAAACCTTTCAAGTCTGATCCTTTACATTGTAGAT
TACCCCATCCGAATCCCAATATGCATCTCAATCACTCAGCCATTAATTTC
GACTACTCAAAACAAGCACGACACGGAGTCAATCCACAGTCTTATCCAGT
TAATGATATGCGATCCCAATTTCATATAAGTATGATGATGAATGGTCAAG
GAAATGTTGACGTAGACCCATTACCGATTCATTCGATATCACATCCTCAT
ATCCAGGATTTCCGATGTAATTACTGCAACAAATGTTACACCAATCAATC
GTCCTTACGAAGTCATTTGAAGAAACATATGAATATCGATGAAAAGAAAT
ACAAATGTGAGAAATGCTCATATTCGTCTCAGTACCAGAAAAATCTGTTG
AAGCATATGCACATAAATCATGCGGAAATCAATGATACCCAGCATTGCCG
GTGTGATATTTGTGATCGGATGTTTGCCAGTGAATTTCTCCTGAAAGACC
ATTTACGCATGCACACCAATGATAACACGTACCAATGTCAACAATGCTGT
AAAAAGCTCAAAACCAAATTGAAATTACGTTATCATGCCGATGTTCACAA
TCCAGAAAAACCATATGTCTGTGACATTGACAACTGTGATCGAGCGTTCC
GCACTCCGAAATATCTGAAGAATCACAAAGACGAATTTCATAAATTACAA
CCAAAAAAACATTTTTGTCCAGTTGACACATGTAAATTAGTATTTCAAAG
AAAAAGTCATTTGAAGCGTCACATGGCGATGCACGACGGAGAGAAAAACT
ATCACTGTCACTGGCCAGATTGCAATCGAAGTTTTAGAACTCAAGAAACA
TTGAATGTTCATTTGATTCGACACACGGGAGAAAAGCCATTCAAATGTGA
ATTGTGTGACTACAGCTGTCGTCAGAAAGCATCCTTGAATTATCATTGTC
GAAATGCTCACGCAAAAGATTGTGAAAGACTATTGGGATTGAAACCGATA
ACAAATGATTGTAAACCTCCCGGAACGAGACCTGTTGGTAGACCACCTAG
GAATCGATCGGATCCTATGATAGACTGTGACAATCAACGACACGAATCTG
CAAAATTTGATACAAATTCTGATGAAAATGACTGCAAACTTGAATCGAAA
ATTGAAAGCGATATTAATGGTATCATTAGTAACCTAGATAAAGATCCAAA
TATTGTTGATATATTTAAAAAGCCAGCTCCTGTTGATGAAAATGATTTAT
TAAGAAAAGAAGTGTTTATGCTTGTCGATGATGTTTTATGTAATCCTCCT
AGATATTATGGAGAAGTTGAAGAATTTTCGTTGGAAGAACTTTGTACAAT
AGAGTTATCAATCAAATCGAAAAGAGGAAGAAAACGAAAGGTTTTAAAAG
AGCTAGATGCATTATTAGCGATGAGTTTGAGTGAAGTGCAAACCATTGAT
GACGATGATGATTCTTTATCATATAAGGAAGACGCAGAAGATGATATAGA
ACAACATTCTCCTATTTTAAACACTAAATCTCAATATATTCCTTCATTAG
TACAATCTACTTCAAATAATAATTCTAATTGTATGTCAAATAAAAATAAT
AATAACAACAATAATAATAGACCACTATCCGGGTTTTCTGATATTCAAGA
TGGCAGAATCACTCCAGAAATTTTGCAGCGTCATAGGAATTCCACACCAC
CAGACAATTCTAAACGTTATTCATTAACCATGAACGGGACGAAAAAATTA
CCGTCCAACAGAATTACTTCTTTTTCATCATCAAATCACACTAATGGTGT
CTCAAGTTTTGATGCAAATTACATACTGAACAACAATAATTCTTGCGGTC
CAGATCAGCATTCACTCTCTCGTAGTAATAGTCCTATATCGGGACACATC
AAAGTTGACGATGCTGGAAGTGTTGAAGATATGACTGACAATATAGAATC
TGCACCAAATTCCATTAATCGAATTACCCCAGAACCAGCGAATCTCTCTT
GTCAGAAGCGTAACATTCTTTCACCAAAACGAGAGTTCCTTTTGCATAAA
TCTCCAGACCGTAAACTACTGTCTAATGTGGATATCAAGCTAGAAGATGA
ATCTAATATTCACGGATTTCAGAGTTTACAGAAACAATTTGAAAATCCAT
TATCCGCATTAAGCAATTTGGAAAATCTGAAAATGAATAAAGATTTATTG
GACCAGGTTTTGGAAGACCTAAAGGTTATTCAAAACGATGAAGATCATCG
ACAAAAAACATTTCTCAGTCCAAATTCTGCAGCTACTGTTTATTCATCGA
ATAACTCATTCAGGAATATCAGCGAACTCAATAGCACATCTGAGAGTGGA
TCTAAAATTAATTCAAAATTATCAAATGTTCCCCATTCATTGAAAATTTC
GACCAACGAAAACCATGTTCAACCAAAATCATTAGATTCCAGTCTTTGGT
CAGACAGTGGATACTCATCAGGTCATGATAGCAGTGGCCTGAATAAAGAT
AACACCAATATAAATGCACTCAATCCAGGATGTTCCAATATGTCTGTGTC
ATCAATTTCTGATAGAGGCTACAAGATTCCTAGTCCGTCCTCAAGTGCAG
CAGCAGCGTTTATTGAGAAAACTGCTGCAGCCGCAGAAATGGCTGCTCTT
TCAGCAAGCGCAGCTCTGTTGAATTCAGACTTCTACAATTCATACCAACA
AAACATCAGTAATAACCGAACCTCGACAGGATCTAATTACAACTCATATG
ATGGACCAGTTTCGGGTTTAACAAGCGAATTAACTAATATGAGCAACATT
TGTTCTAGTATGTACAAAAATGGACTTGAAGACCATTTAAGATCCTTAAC
AGCACTTGGATCCAAATACATGGAAACTAGTGGATATCAGGGCAGCAATC
GATCGGATAGTAATTCTGGACCGGATGCAAATGGCATGGGACCCTTTAGT
AATTTTTGGTCCAGTGCTTCGGTTTCATCTGGTGATTATCTATCAATAGC
TAGTAATGGTGGCTCGGGTGGTTCTTCTTTGAACCCTTTCGATCCAACCA
ATGTTCGAAACGGCATCGGAGATTATTGTAATCTTGCACAGAGTCCCACT
GTAGCCGCTGCCGCCGATTTGTATTCACAGATGGCTGCAAGTGCCAATTA
TGATAAGTATTCTAGTTTGTATGGTTGCAGAGATAGCTTCTATGGAAACT
CTGGCAGTTCGAGTAGAGGATTAAATAATGGAGATACAGCATTTCCTATC
AACTCAAATCACTATGTCGACAGGTCTTATCTCTCATCGAATCATCCTTT
TTATCCACAATCAGTTTCAGACCAGTATAACAGTCGGTATCCTCCTGCTT
CTGCCGCTGATTATTTGTCTGTTGGTAGACAATTCTCCTCTGGTGGACCC
TCATCGGGAAACCCATTTGCAGTCGGCAGTGACCCATATCGCAATTCAAT
GCTGCATAATATGTCTCCTTTCAATCGTTATCCGTTTTAAAAGGTTTCAG
CCCTCAATAACTCCGTTCGCAGATTTGTATACAAGACTATGCTAAATCAA
CAGATACTTTTGTATATTAGTGAATTTTTTTTACATTCCGGGCGCCACCA
AGTTAACTCCTCACAATGTGATCTCAAAATTATTCATATTAAAACAAGCA
TATATATATATACCAAAGTTGTCTAGTTTCATTTAGTTTGATTGTTTCAA
ATTTTATTTGCATTATCTGGTTTGTACAAATTTTTCAAAGCTTTTTCACT
TGATAACTAATCGTGACTCCAATTAATTGGGAGATCTTGGGTTTTATTAC
AAAAACCTCCATTTTCTCATGAAAAATCTCATTAGGACTTCCTTGAAATT
TGATCACGCTATATATATATATATTTATATATAC
back to top

protein sequence of SMED30027858-orf-1

>SMED30027858-orf-1 ID=SMED30027858-orf-1|Name=SMED30027858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1420bp
MIDTKVNISDNNQDSPLSPNYDPQDCDQIKDGDVSDDIADKALYLISDNK
NKSPASLSLSSTPCENQNYEHPIQYKGLNNSEDTSSSINCAEFAAISEHN
EPNDEFDYESEESEESESDSEFSTEDEDSSDENDPDQANNSIMQERWKEL
DKYGLSNHILHTQQNGEPPNSANLYRMSAPINLSANHPIPEPGPPSNDFL
INNPPMQDESYHMGMNAHVANNALNMSMRHMSSMQSMNKLSPTKNTHLHP
MENDPHFHMVSQKPFKSDPLHCRLPHPNPNMHLNHSAINFDYSKQARHGV
NPQSYPVNDMRSQFHISMMMNGQGNVDVDPLPIHSISHPHIQDFRCNYCN
KCYTNQSSLRSHLKKHMNIDEKKYKCEKCSYSSQYQKNLLKHMHINHAEI
NDTQHCRCDICDRMFASEFLLKDHLRMHTNDNTYQCQQCCKKLKTKLKLR
YHADVHNPEKPYVCDIDNCDRAFRTPKYLKNHKDEFHKLQPKKHFCPVDT
CKLVFQRKSHLKRHMAMHDGEKNYHCHWPDCNRSFRTQETLNVHLIRHTG
EKPFKCELCDYSCRQKASLNYHCRNAHAKDCERLLGLKPITNDCKPPGTR
PVGRPPRNRSDPMIDCDNQRHESAKFDTNSDENDCKLESKIESDINGIIS
NLDKDPNIVDIFKKPAPVDENDLLRKEVFMLVDDVLCNPPRYYGEVEEFS
LEELCTIELSIKSKRGRKRKVLKELDALLAMSLSEVQTIDDDDDSLSYKE
DAEDDIEQHSPILNTKSQYIPSLVQSTSNNNSNCMSNKNNNNNNNNRPLS
GFSDIQDGRITPEILQRHRNSTPPDNSKRYSLTMNGTKKLPSNRITSFSS
SNHTNGVSSFDANYILNNNNSCGPDQHSLSRSNSPISGHIKVDDAGSVED
MTDNIESAPNSINRITPEPANLSCQKRNILSPKREFLLHKSPDRKLLSNV
DIKLEDESNIHGFQSLQKQFENPLSALSNLENLKMNKDLLDQVLEDLKVI
QNDEDHRQKTFLSPNSAATVYSSNNSFRNISELNSTSESGSKINSKLSNV
PHSLKISTNENHVQPKSLDSSLWSDSGYSSGHDSSGLNKDNTNINALNPG
CSNMSVSSISDRGYKIPSPSSSAAAAFIEKTAAAAEMAALSASAALLNSD
FYNSYQQNISNNRTSTGSNYNSYDGPVSGLTSELTNMSNICSSMYKNGLE
DHLRSLTALGSKYMETSGYQGSNRSDSNSGPDANGMGPFSNFWSSASVSS
GDYLSIASNGGSGGSSLNPFDPTNVRNGIGDYCNLAQSPTVAAAADLYSQ
MAASANYDKYSSLYGCRDSFYGNSGSSSRGLNNGDTAFPINSNHYVDRSY
LSSNHPFYPQSVSDQYNSRYPPASAADYLSVGRQFSSGGPSSGNPFAVGS
DPYRNSMLHNMSPFNRYPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 980..1000
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 521..548
e-value: 3.3E-9
score: 38.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 341..398
e-value: 3.0E-9
score: 38.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 399..460
e-value: 3.0E-10
score: 41.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 492..520
e-value: 4.6E-7
score: 31.6
NoneNo IPR availablePFAMPF12874zf-metcoord: 408..426
e-value: 0.0051
score: 17.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 549..583
e-value: 1.5E-7
score: 32.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 461..488
e-value: 1.4E-6
score: 30.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 739..759
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 104..134
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 98..139
NoneNo IPR availablePANTHERPTHR24379:SF87ZINC FINGER Y-CHROMOSOMAL PROTEIN 2-RELATEDcoord: 331..580
NoneNo IPR availablePANTHERPTHR24379:SF87ZINC FINGER Y-CHROMOSOMAL PROTEIN 2-RELATEDcoord: 120..497
NoneNo IPR availablePANTHERPTHR24379FAMILY NOT NAMEDcoord: 331..580
coord: 120..497
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 494..518
e-value: 0.0092
score: 25.2
coord: 406..428
e-value: 0.013
score: 24.7
coord: 344..366
e-value: 0.0013
score: 28.0
coord: 374..397
e-value: 0.097
score: 21.8
coord: 524..548
e-value: 4.7E-4
score: 29.5
coord: 434..456
e-value: 1.2
score: 18.2
coord: 462..487
e-value: 0.041
score: 23.0
coord: 554..577
e-value: 0.013
score: 24.7
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 524..548
e-value: 4.5E-4
score: 20.5
coord: 344..366
e-value: 1.5E-4
score: 22.0
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 464..487
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 526..548
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 496..518
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 436..456
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 556..577
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 346..366
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 406..428
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 524..553
score: 14.253
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 344..371
score: 11.198
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 406..433
score: 10.907
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 494..523
score: 11.51
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 462..492
score: 9.785
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 554..582
score: 9.224
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 374..402
score: 8.683
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 434..461
score: 11.905
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 543..574
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 509..552
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 404..437
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 428..482
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 344..394