Aspartate dehydrogenase domain containing

Overview
NameAspartate dehydrogenase domain containing
Smed IDSMED30027855
Length (bp)1160
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aspartate dehydrogenase domain containing (SMED30027855) t-SNE clustered cells

Violin plots show distribution of expression levels for Aspartate dehydrogenase domain containing (SMED30027855) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aspartate dehydrogenase domain containing (SMED30027855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aspartate dehydrogenase domain containing (SMED30027855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027855h1SMcG0017106 Contig2007GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30027855h1SMcG0017106 SmedASXL_004784SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027855h1SMcG0017106 SmedASXL_064934SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30027855h1SMcG0017106 dd_Smed_v4_1769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027855h1SMcG0017106 dd_Smed_v4_1769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027855h1SMcG0017106 dd_Smed_v4_21674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027855h1SMcG0017106 dd_Smed_v6_33870_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027855h1SMcG0017106 dd_Smed_v6_21674_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Human
Match: ASPDH (aspartate dehydrogenase domain containing [Source:HGNC Symbol;Acc:HGNC:33856])

HSP 1 Score: 198.749 bits (504), Expect = 1.231e-60
Identity = 109/280 (38.93%), Postives = 168/280 (60.00%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYDAV-EKSP--NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMF--HAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLP-TIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            +G++G+G+LGQ L   +  + P    ++ FVWNR+  ++   VP  L L ++  + +R+ +LV+EV HP II E G  IL++++L+VGSP+  ++   + +++ ++    HA+++  GALWG EDIRRLD +  ++S+++TM  HP+ F+L G        +  S  P T++Y G V+ L   AP N NTMA AALAA SL FD V G L++++     HV+ +EL    G       V T+RENPA  G+VTGSAT  +F+ SL       S  G+H C
Sbjct:    9 VGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPL-----AAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC 283          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Human
Match: ASPDH (aspartate dehydrogenase domain containing [Source:HGNC Symbol;Acc:HGNC:33856])

HSP 1 Score: 98.9821 bits (245), Expect = 4.738e-24
Identity = 75/229 (32.75%), Postives = 105/229 (45.85%), Query Frame = 3
Query:  234 NDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLP-TIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            + +   K R+ +LV+EV HP II E G  IL++++L+                                                S+++TM  HP+ F+L G        +  S  P T++Y G V+ L   AP N NTMA AALAA SL FD V G L++++     HV+ +EL    G       V T+RENPA  G+VTGSAT  +F+ SL       S  G+H C
Sbjct:    3 DRVKGSKSRRPDLVVEVAHPKIIHESGAQILRHANLL------------------------------------------------SLRVTMATHPDGFRLEGPL-----AAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC 178          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Human
Match: ASPDH (aspartate dehydrogenase domain containing [Source:HGNC Symbol;Acc:HGNC:33856])

HSP 1 Score: 83.5741 bits (205), Expect = 6.500e-19
Identity = 56/138 (40.58%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  504 MEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            M  HP+ F+L G     +         T++Y G V+ L   AP N NTMA AALAA SL FD V G L++++     HV+ +EL    G       V T+RENPA  G+VTGSAT  +F+ SL       S  G+H C
Sbjct:    1 MATHPDGFRLEGPLAAAHSPGPC----TVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC 134          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Human
Match: ASPDH (aspartate dehydrogenase domain containing [Source:HGNC Symbol;Acc:HGNC:33856])

HSP 1 Score: 45.4394 bits (106), Expect = 2.986e-6
Identity = 19/40 (47.50%), Postives = 30/40 (75.00%), Query Frame = 3
Query:  252 KDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFAN 371
            K R+ +LV+EV HP II E G  IL++++L+VGSP+  ++
Sbjct:    9 KSRRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSD 48          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Celegans
Match: F17C8.9 (pep chromosome:WBcel235:III:4734356:4736065:1 gene:WBGene00185014.1 transcript:F17C8.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F17C8.9)

HSP 1 Score: 207.994 bits (528), Expect = 9.368e-65
Identity = 110/273 (40.29%), Postives = 164/273 (60.07%), Query Frame = 3
Query:   90 MSIGILGFGKLGQFLYDAVEKSPN-FQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHA--IYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDL-PTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            + +G +G+G LG+FL + +   P  F++  +WNR+  +     P    L  +     +  +LV+EV HP II +YGE IL++  L  GSPT FAN E  EK+   ++ H   + IP GALWG  DI+++ +   +K + +TM KHP SFKL     E+NE +K  +   T++Y G+V+ L  +APNNVNTMA  ALAA++L FDEVK  LIS+ +    HV+ + +E   G +V+T+R NPA  G+VTG  T+ SF  S+K++     G+  C
Sbjct:    4 LRVGFIGYGHLGKFLVEKLRLLPEEFEIVKIWNRSVGE-----PGVQGLETLTAENLKDIDLVVEVAHPKIIADYGELILEHCDLFAGSPTCFANQELLEKLTKLSLSHGKKLLIPAGALWGANDIQKMADVGSLKGLTVTMIKHPTSFKLGSPLFEINEKAKLEETNETVLYEGSVRGLCPLAPNNVNTMAGGALAASNLGFDEVKAKLISDPKMTDWHVVEVRVEGDDGFEVITRRNNPAKPGAVTGQLTYYSFLSSIKESRYKPIGVQLC 271          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Zebrafish
Match: aspdh (aspartate dehydrogenase domain containing [Source:NCBI gene;Acc:447919])

HSP 1 Score: 220.705 bits (561), Expect = 1.906e-69
Identity = 109/277 (39.35%), Postives = 178/277 (64.26%), Query Frame = 3
Query:   84 KMMSIGILGFGKLGQFLYDAVEKSP---NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHA--IYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLG-IYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            K + +GI+G+G LGQFL + ++        Q+AFVWNRN  KLKD +P DLIL+D+ D   R  ++++EVCHP I+KE+G   L ++H +VGSP+  ++ + ++ +  +A      +Y+P+GALWG +DI+++++S  ++++ I M KHP+ F+L G + ++  E   +     ++Y G+V EL  IAPNNVNTMA AA+AA+ L F  V G ++S++     H++ +++    G  V T R+NPA +G+VTG+AT+ SF+ SL    G    ++ C
Sbjct:    4 KALKVGIVGYGHLGQFLVEKIQSEGAEVGLQLAFVWNRNADKLKDSLPKDLILHDLSDFTQRDTDVIVEVCHPLIVKEFGVRFLSHAHFLVGSPSALSDGQLEQDLRTAAKQQGKTLYVPSGALWGGQDIQKMNDSGTLRALSIRMSKHPSCFRLTGGLLSDWTEGEGRR----VLYRGSVAELCPIAPNNVNTMAAAAIAASKLGFHGVTGEIVSDTALADYHIVEVDVTGPDGFSVKTVRQNPAKLGAVTGNATYNSFWSSLLVCKGHGGRVYLC 276          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Mouse
Match: Aspdh (aspartate dehydrogenase domain containing [Source:MGI Symbol;Acc:MGI:1915602])

HSP 1 Score: 196.823 bits (499), Expect = 4.900e-60
Identity = 108/279 (38.71%), Postives = 164/279 (58.78%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYD---AVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSA--MFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            +G++G+G+LGQ L     A       ++ FVWNR+  ++   VP  L L D+  +++R  +LV+EV HP II E G  IL++++L+VGSP+  A+   +++++ ++    H +++  GALWG EDI RLD +  ++S+++TM  HP+ F+L G     +    +    T++Y G V+ L  +AP N NTMA AALAA SL FD V G L+++      HV+ +EL    G       V T RENPA  G+VTGSAT  +F+HSL       S  G+H C
Sbjct:   13 VGVVGYGRLGQSLVSRLLAQGSELGLELVFVWNRDPGRMAGSVPPALQLQDLTALEERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALADQTTEQQLLEASKRWGHTVFVARGALWGSEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSSGPR----TVLYEGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELLGPPGPSGRSFAVHTHRENPAQPGAVTGSATVTAFWHSLLGCCQLTSRPGIHLC 287          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Mouse
Match: Aspdh (aspartate dehydrogenase domain containing [Source:MGI Symbol;Acc:MGI:1915602])

HSP 1 Score: 182.956 bits (463), Expect = 4.040e-55
Identity = 96/240 (40.00%), Postives = 146/240 (60.83%), Query Frame = 3
Query:  159 NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSA--MFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSL 857
              ++ FVWNR+  ++   VP  L L D+  +++R  +LV+EV HP II E G  IL++++L+VGSP+  A+   +++++ ++    H +++  GALWG EDI RLD +  ++S+++TM  HP+ F+L G     +    +    T++Y G V+ L  +AP N NTMA AALAA SL FD V G L+++      HV+ +EL    G       V T RENPA  G+VTGSAT  +F+HSL
Sbjct:   19 GLELVFVWNRDPGRMAGSVPPALQLQDLTALEERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALADQTTEQQLLEASKRWGHTVFVARGALWGSEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSSGPR----TVLYEGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELLGPPGPSGRSFAVHTHRENPAQPGAVTGSATVTAFWHSL 254          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Mouse
Match: Aspdh (aspartate dehydrogenase domain containing [Source:MGI Symbol;Acc:MGI:1915602])

HSP 1 Score: 98.2117 bits (243), Expect = 6.530e-24
Identity = 73/221 (33.03%), Postives = 101/221 (45.70%), Query Frame = 3
Query:  255 DRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            +R  +LV+EV HP II E G  IL++++L+                                                S+++TM  HP+ F+L G     +    +    T++Y G V+ L  +AP N NTMA AALAA SL FD V G L+++      HV+ +EL    G       V T RENPA  G+VTGSAT  +F+HSL       S  G+H C
Sbjct:    1 ERHPDLVVEVAHPKIIHESGAQILRHANLL------------------------------------------------SLRVTMATHPDGFRLEGPLAAAHSSGPR----TVLYEGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELLGPPGPSGRSFAVHTHRENPAQPGAVTGSATVTAFWHSLLGCCQLTSRPGIHLC 169          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Mouse
Match: Aspdh (aspartate dehydrogenase domain containing [Source:MGI Symbol;Acc:MGI:1915602])

HSP 1 Score: 80.8777 bits (198), Expect = 7.004e-18
Identity = 38/113 (33.63%), Postives = 68/113 (60.18%), Query Frame = 3
Query:  213 VPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSA--MFHAIYIPTGALWGLEDIRRLDESKEIKSMK-----ITMEKHPNSFK 530
            VP  L L D+  +++R  +LV+EV HP II E G  IL++++L+VGSP+  A+   +++++ ++    H +++  GALWG EDI RLD +  ++  +         + P +F+
Sbjct:    5 VPPALQLQDLTALEERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALADQTTEQQLLEASKRWGHTVFVARGALWGSEDISRLDAAGGLQPHRHARGGCGAARTPRAFR 117          
BLAST of Aspartate dehydrogenase domain containing vs. UniProt/SwissProt
Match: sp|Q66I59|ASPD_DANRE (Putative L-aspartate dehydrogenase OS=Danio rerio OX=7955 GN=aspdh PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.335e-68
Identity = 109/277 (39.35%), Postives = 177/277 (63.90%), Query Frame = 3
Query:   84 KMMSIGILGFGKLGQFLYDAVEKSP---NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHA--IYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLG-IYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            K + +GI+G+G LGQFL + ++        Q+AFVWNRN  KLKD +P DLIL+D+ D   R  ++++EVCHP I+KE+G   L ++H +VGSP+  ++ + ++ +  +A      +Y+P+GALWG +DI+++++S  ++++ I M KHP+ F+L G + ++  E   +     ++Y G+V EL  +APNNVNTMA AA+AA+ L F  V G ++S++     HV+ +++    G  V T R+NPA +G+VTG AT+ SF+ SL    G    ++ C
Sbjct:    4 KALKVGIVGYGHLGQFLVEKIQSEGAEVGLQLAFVWNRNADKLKDSLPKDLILHDLSDFTQRDTDVIVEVCHPLIVKEFGVRFLSHAHFLVGSPSALSDGQLEQDLRTAAKQQGKTLYVPSGALWGGQDIQKMNDSGTLRALSIRMSKHPSCFRLTGGLLSDWTEGEGRR----VLYRGSVAELCPLAPNNVNTMAAAAIAASKLGFHGVTGEIVSDTALADYHVVEVDVTGPDGFSVKTMRQNPAKLGAVTGKATYNSFWSSLLVCKGHGGRVYLC 276          
BLAST of Aspartate dehydrogenase domain containing vs. UniProt/SwissProt
Match: sp|Q5FW48|ASPD_XENTR (Putative L-aspartate dehydrogenase OS=Xenopus tropicalis OX=8364 GN=aspdh PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 6.506e-66
Identity = 114/282 (40.43%), Postives = 166/282 (58.87%), Query Frame = 3
Query:   84 KMMSIGILGFGKLGQFLYDAVEKSP---NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMF--HAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIEL------ETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            + M IG++G+G +G++L D + +     + ++AFVWNR + KL   V   L L D+ D +    +L++EV HP I +EYGE  L  +H +VGSPT  A+   + K+   A    + +Y+P GALWG EDI ++ E   +K+++ITM KHPNSFKL G   + N+ +  +   T++Y G V+ L  +APNNVNTMA A +AA++L FD V G L+S+      H + IE+      +T     V T R NPA   SVTGSATF SF+ SL    G    ++ C
Sbjct:    5 RRMRIGVVGYGHIGKYLVDKIVREGANHSMELAFVWNRRREKLSGAVDPRLQLQDLSDCQKWAADLIVEVAHPCITREYGEKFLSVAHFLVGSPTALADTVTEAKLRERARLSGNTLYVPCGALWGAEDIFKMAERGTLKALRITMTKHPNSFKLEGDLVQKNQEAMSNR--TVLYEGPVRGLCPLAPNNVNTMAAACMAAHTLGFDGVVGVLVSDPSVPDWHFVDIEVTGGTIEKTGQVFSVKTSRRNPAAPCSVTGSATFASFWSSLLACKGHGGRVYIC 284          
BLAST of Aspartate dehydrogenase domain containing vs. UniProt/SwissProt
Match: sp|A6ND91|ASPD_HUMAN (Putative L-aspartate dehydrogenase OS=Homo sapiens OX=9606 GN=ASPDH PE=1 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 5.913e-60
Identity = 109/280 (38.93%), Postives = 168/280 (60.00%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYDAV-EKSP--NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMF--HAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLP-TIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            +G++G+G+LGQ L   +  + P    ++ FVWNR+  ++   VP  L L ++  + +R+ +LV+EV HP II E G  IL++++L+VGSP+  ++   + +++ ++    HA+++  GALWG EDIRRLD +  ++S+++TM  HP+ F+L G        +  S  P T++Y G V+ L   AP N NTMA AALAA SL FD V G L++++     HV+ +EL    G       V T+RENPA  G+VTGSAT  +F+ SL       S  G+H C
Sbjct:    9 VGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPL-----AAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC 283          
BLAST of Aspartate dehydrogenase domain containing vs. UniProt/SwissProt
Match: sp|Q9DCQ2|ASPD_MOUSE (Putative L-aspartate dehydrogenase OS=Mus musculus OX=10090 GN=Aspdh PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 3.428e-59
Identity = 108/279 (38.71%), Postives = 164/279 (58.78%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYD---AVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSA--MFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG-----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAES--GLHFC 896
            +G++G+G+LGQ L     A       ++ FVWNR+  ++   VP  L L D+  +++R  +LV+EV HP II E G  IL++++L+VGSP+  A+   +++++ ++    H +++  GALWG EDI RLD +  ++S+++TM  HP+ F+L G     +    +    T++Y G V+ L  +AP N NTMA AALAA SL FD V G L+++      HV+ +EL    G       V T RENPA  G+VTGSAT  +F+HSL       S  G+H C
Sbjct:   13 VGVVGYGRLGQSLVSRLLAQGSELGLELVFVWNRDPGRMAGSVPPALQLQDLTALEERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALADQTTEQQLLEASKRWGHTVFVARGALWGSEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSSGPR----TVLYEGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELLGPPGPSGRSFAVHTHRENPAQPGAVTGSATVTAFWHSLLGCCQLTSRPGIHLC 287          
BLAST of Aspartate dehydrogenase domain containing vs. UniProt/SwissProt
Match: sp|Q5I0J9|ASPD_RAT (Putative L-aspartate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aspdh PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.191e-46
Identity = 86/230 (37.39%), Postives = 137/230 (59.57%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYD---AVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSA--MFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG 770
            +G++G+G+LGQ L     A       ++ FVWNR+  ++   VP  L L D+  +++R  +LV+EV HP II E G  IL++++L+VGSP+  A+   + +++ ++    H +++  GALWG EDI RLD +  ++S+++TM  HP+ F+L G     +    +    T++Y G V+ L  +AP N NTMA AALAA SL FD V G L+++      HV+ +EL    G
Sbjct:   13 VGVVGYGRLGQSLVSRLLAQGSELGLELVFVWNRDPGRMAGSVPPALQLEDLTTLEERHPDLVVEVAHPKIIHESGVQILRHANLLVGSPSALADQTTERQLLEASNHWGHTVFVARGALWGCEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSSGPR----TVLYEGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELTGPQG 238          
BLAST of Aspartate dehydrogenase domain containing vs. TrEMBL
Match: A0A0B7A0X2 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF91528 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.159e-77
Identity = 120/275 (43.64%), Postives = 175/275 (63.64%), Query Frame = 3
Query:   90 MSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIEL------ETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            M +GI+G+G LGQ+L   +E+  + QVAFVWNR+   L+  V ++LIL D+   K+   +L++EV HPDI ++YG   L ++  MVGSPT  A+A  ++++  +A  H +YIP+GA WG EDI+++ +   ++++K+TM+KHP  FKL G    LNE  K  D P  +Y+G+V+EL  +APNNVNTMA AALA ++L FD+V+GCL+S+      HV+ +EL               T R NPA  G+VTG+AT+ SF  SL  A     G+H C
Sbjct:    3 MKVGIVGYGHLGQYLVSEIEQRDDVQVAFVWNRSPESLEGKVQDNLILRDLSAFKECHADLIVEVAHPDISRKYGAMFLSHADYMVGSPTALADASLEKQLREAAKSHGLYIPSGAFWGGEDIKKMADRGNLQALKVTMKKHPTCFKLSGKLKTLNETVK--DEPVTLYHGSVRELCPLAPNNVNTMAAAALAGHNLGFDKVQGCLVSDPNLRDWHVVEVELWGPGDISADGAFHCKTVRRNPAPFGAVTGTATYASFLSSLLNAKNKGLGVHLC 275          
BLAST of Aspartate dehydrogenase domain containing vs. TrEMBL
Match: A0A1S3K2P3 (putative L-aspartate dehydrogenase isoform X2 OS=Lingula unguis OX=7574 GN=LOC106178148 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 6.415e-76
Identity = 114/273 (41.76%), Postives = 177/273 (64.84%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITI------ELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            +G++GFG LGQ+L DA++   + ++AFVWNR    +K  + N  IL D+     R  +L++EV HP I K+YG   L+ +  MVGSPT  A+ E + ++ N+A  H +YIP+GA WG EDI+++ +   ++ +K+TM+KHP SFKL G   +LN+  K      ++Y+G V++L  +APNNVNTMAVAA+AA +L FD+V+GCL+S+      H++ +      ++++    +V T R+NP+ +G+VTG+AT+ SF  SL  A G  +G H C
Sbjct:    8 VGVVGFGHLGQYLVDAIQARSDLELAFVWNRTIDVVKGKLDNSYILEDLSQFATRNADLIVEVAHPSISKQYGSKFLQCADYMVGSPTALADQEVETELRNAAKIHGLYIPSGAFWGGEDIKKMADRGSLQGLKVTMKKHPQSFKLHGKLRDLNDTVKTE--AAVLYDGPVRDLCPLAPNNVNTMAVAAIAAYNLGFDQVQGCLVSDPSLTDWHIVEVDVFGPGDMKSGTCFQVNTSRKNPSKLGAVTGTATYASFLSSLLGARGKGAGTHLC 278          
BLAST of Aspartate dehydrogenase domain containing vs. TrEMBL
Match: A0A0D2WHX7 (Aspartate dehydrogenase isoform 1 OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_000105 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 3.201e-75
Identity = 124/281 (44.13%), Postives = 180/281 (64.06%), Query Frame = 3
Query:   81 VKMMSIGILGFGKLGQFLYDAVEKSPN-FQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAM----FHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAG----LKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            V +  +GI+G+G LGQ+L DAV + P+  ++AFVWNR+  KLK  VP   IL ++ + + RK +L++EV HPDI   YG   LK +  MVGSPT+FA++  + ++   AM     H +YIP GALWG  DI+++ +   ++S+ ITM+KHP SF+LLG   ELN  +      +++Y+G V+ L  +APNNVNTMA AALA ++L FD+V+G LI++ R E  H++ IEL           V T R NPA  G+VTG+AT+ SF  S+ ++ G   G+H C
Sbjct:    5 VPVRRVGIVGYGSLGQYLADAVLQRPDQLELAFVWNRSIDKLKGKVPEAAILANLDEFESRKADLIVEVSHPDITHAYGARFLKAADYMVGSPTVFADSHLESQLRAIAMSADNTHGLYIPAGALWGGNDIQKMADRNTLQSLTITMKKHPLSFQLLGHLVELNNAALNVQGESLLYDGPVRALCPLAPNNVNTMAAAALAGHNLGFDKVRGVLIADPRLE-GHIVEIELTGPGAAPSPFSVKTSRYNPAAPGAVTGNATYASFLSSMLRSNGQGKGVHLC 284          
BLAST of Aspartate dehydrogenase domain containing vs. TrEMBL
Match: A0A1W0X407 (Putative L-aspartate dehydrogenase OS=Hypsibius dujardini OX=232323 GN=BV898_04007 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 5.740e-75
Identity = 127/279 (45.52%), Postives = 181/279 (64.87%), Query Frame = 3
Query:   96 IGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDI-VPNDLILNDIYDMK----DRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKI--INSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIE-----LETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            IG++GFG +GQ+LY+ +    N ++AFVWNR +S L+D  VP  LIL  + D +    +RKC+L+IEV HP I K YG   LK++  M+GSPT  A+ + +  +  + +   H +YIP GALWG EDIRRL ++  + S+ ITM KHP +F+L G  +ELN+ + +S   T++Y+G ++ L  +APNNVNTMA AA+AA++L FD+V+G LI++   E  H+I +E     L     L VVT+R NPA  G+VTGSAT+ SF  S+  A G   G H C
Sbjct:    6 IGLVGFGHVGQYLYEFITSRDNLEIAFVWNRTRSVLEDAAVPKHLILESLEDFESHTLNRKCDLIIEVAHPSITKTYGMRFLKHADYMIGSPTALADEDVETGLRELATEGAHGLYIPVGALWGAEDIRRLADAGTLHSLCITMTKHPAAFRLSGRLDELNQTAVESQTATVLYDGGIRALCGLAPNNVNTMAAAAVAAHNLGFDKVRGRLIADPAAEGWHIIRVEATGSKLTNGTQLSVVTERRNPAETGAVTGSATYASFASSVLSAHGKGPGFHIC 284          
BLAST of Aspartate dehydrogenase domain containing vs. TrEMBL
Match: K1Q8Z3 (Putative L-aspartate dehydrogenase OS=Crassostrea gigas OX=29159 GN=CGI_10014198 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.908e-74
Identity = 112/270 (41.48%), Postives = 181/270 (67.04%), Query Frame = 3
Query:   87 MMSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            M  +G++G+G LG+FL + +++ P+ ++AFVWNR+ + L+   P DL+L D+ D K+R  +L++EV HPDI +++G   L+ +  M+GSPT  ++ E +  +  +A  H +Y+P+GA WG EDI+++ +   ++++K+TM KHP+SFK+ G     N+  K  D   I+Y+G V+EL  +APNNVNTMA AA+AA++L FD+V G ++S+ +    H++ +E+    G  V T R NPA VG+VTG+AT+ SF  S+  A G  +G+H C
Sbjct:    1 MRRVGVVGYGHLGKFLVEKIQEHPDLELAFVWNRSPAALERF-PKDLVLQDLKDFKERNVDLIVEVAHPDITRQWGPIFLQEADYMIGSPTALSSQELETSLRTAATKHGLYVPSGAFWGAEDIKKMADRGTLQNLKVTMTKHPSSFKVNGDLKTKNDQVK--DTKVILYDGPVRELCPLAPNNVNTMAAAAIAAHNLGFDKVSGSIVSDPQVTDWHIVEVEVWGPNGFNVKTTRSNPAAVGAVTGTATYASFLSSMLGAKGKGAGVHLC 267          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Cavefish
Match: aspdh (aspartate dehydrogenase domain containing [Source:NCBI gene;Acc:103022704])

HSP 1 Score: 229.95 bits (585), Expect = 3.732e-73
Identity = 116/282 (41.13%), Postives = 185/282 (65.60%), Query Frame = 3
Query:   69 ITFTVKMMSIGILGFGKLGQFLYDAVEKSP---NFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHA--IYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLG-IYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            +T T   + +GI+G+G LGQFL D +++      F +AFVWNRN  KL D VP DLIL ++ +   +K +L++EVCHP I+KE+G   L +++L+VGSP+  ++++  +++  SA  H   +Y+P+GALWG +DI+RL++S  +K++ I M KHP+ F+L G + ++ +E   +     ++++G+V EL  IAPNNVNTMA AA+AA +L F+ V G ++S++     H++ +E+    G  V T R NPA +G+VTGSAT+ SF+ SL    G    ++ C
Sbjct:    1 MTHTSSPIRVGIVGYGHLGQFLVDHIQREGLGVGFGLAFVWNRNADKLSDSVPKDLILTNLSEFTHKKADLIVEVCHPQIVKEFGVHFLAHANLLVGSPSALSDSQLNQELRCSAQKHGNTLYVPSGALWGGQDIQRLNDSGSLKALSIRMSKHPSCFRLTGGLLSDWSEDEGRR----VLFHGSVAELCPIAPNNVNTMAAAAIAATTLGFNGVTGEIVSDTALADYHLVEVEVTGPDGFSVTTVRRNPAKIGAVTGSATYNSFWSSLLVCKGHGGRVYLC 278          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Sea Lamprey
Match: ASPDH (aspartate dehydrogenase domain containing [Source:HGNC Symbol;Acc:HGNC:33856])

HSP 1 Score: 179.489 bits (454), Expect = 6.199e-54
Identity = 99/277 (35.74%), Postives = 164/277 (59.21%), Query Frame = 3
Query:   78 TVKMMSIGILGFGKL-----GQFLYDAVEK---SPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHA--IYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPT---IIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETN--HVITIELE--THAGLKVVTKRENPAIVGSVTGSATFMSFYHSL 857
            T     +GI+G+G L     G++L   +++   +   ++AFVWNR+  +++  V  D  L D+    +R+ +L++EV HP+I +++GE  L+++  +VGSPT  A+A  + ++  ++  H   +Y+P GA WG +DI+++ +   +K++ +TM KHP SFKL G   + N  +          ++Y G V+ L  +APNNVNTMA AA+AA++L FD V G L+++S       H++ IE+         V T R NPA+ G+VTG+AT+ SF  SL
Sbjct:    7 TKSRRRVGIVGYGHLVYPSTGEYLVRELQREGGAHGLELAFVWNRSAERMQGNVEPDQQLRDLERFAERRADLIVEVSHPNISRDFGEMFLQHADYLVGSPTALADAATERRLREASATHGRTLYVPAGAFWGGDDIQKMADRGTLKALTVTMTKHPASFKLEGALRQANAQALAEGAGAGRRVLYEGPVRHLCPLAPNNVNTMAAAAMAAHNLGFDGVTGRLVADSVPSLPDWHIVEIEVRGVGDPPFSVTTTRRNPALPGAVTGNATYASFLSSL 283          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Nematostella
Match: EDO41188 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S563])

HSP 1 Score: 228.024 bits (580), Expect = 6.698e-73
Identity = 115/260 (44.23%), Postives = 180/260 (69.23%), Query Frame = 3
Query:   90 MSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSA--MFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLG-IYNELNEISKQS-DLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSL 857
            M IGI+GFG LG++LY+A+    + +VAFVWNR+K  ++  +   LIL D+    +RK +L++EV HP +IK+YG  +L  + LM+GSPT+ AN++ +E++   A    HA+Y+P+GALWG E+I+++ +   +K +KITM KHP+ FKL   + ++  E  +Q+ D+PTI+Y+G V+ L  +APNNVNTMA AA AA++L FD V+GCL++++ +   H++ +++    G  V T R NP+  G+VTG+ATF SF  S+
Sbjct:    1 MRIGIVGFGHLGKYLYEAISTRDDLEVAFVWNRSKESMEGKIEEQLILTDLSLCAERKADLIVEVAHPAVIKQYGLALLNAADLMIGSPTVLANSDVEERLRAKAEKGPHAVYVPSGALWGGENIKKMADRGTLKGLKITMRKHPSCFKLADPLESKAKEKYQQNPDMPTILYDGPVRGLCPLAPNNVNTMAAAATAAHNLGFDVVQGCLVADT-SLNAHIVEVDVTGLNGFTVKTVRTNPSAPGAVTGNATFASFLSSI 259          
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Medaka
Match: aspdh (aspartate dehydrogenase domain containing [Source:NCBI gene;Acc:101155692])

HSP 1 Score: 221.861 bits (564), Expect = 6.335e-70
Identity = 113/276 (40.94%), Postives = 181/276 (65.58%), Query Frame = 3
Query:   90 MSIGILGFGKLGQFLYDAVEK---SPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHA--IYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLG--IYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            + IG++GFG LGQ+L   + K   S    +AFVWNRN  +LK +VP + +L+++    DRK ++++EVCHP I+KEYG   L +SH MVGSP+  ++++  +K+  +A+ +   +Y+P+GALWG +DI+RL++S  +K++ I M KHP+ F+L G  +   + E  ++     +++ G+V EL  +APNNVNTMA AA+AA +L F+ V G ++S++  +  HV+ +E+    G  V T R+NPA  G+VTGSAT+ SF++SL    G    ++ C
Sbjct:    8 LRIGVVGFGFLGQYLVGRILKDGPSLGLNLAFVWNRNSDRLKGLVPAEFVLSNLSSFPDRKSDVIVEVCHPQIVKEYGCSFLSHSHFMVGSPSALSDSDLNQKLRRAALQYGKTLYVPSGALWGGQDIQRLNDSGALKALFIRMSKHPSCFRLTGDKLTTWMEEEGRR-----VLFRGSVAELCPLAPNNVNTMAAAAVAAGTLGFEGVLGEIVSDTTLKDYHVVEVEVTGPDGFSVRTVRKNPAKPGAVTGSATYDSFWNSLLICKGHGGRVYLC 278          
BLAST of Aspartate dehydrogenase domain containing vs. Planmine SMEST
Match: SMESG000061639.1 (SMESG000061639.1)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 270/270 (100.00%), Postives = 270/270 (100.00%), Query Frame = 3
Query:   87 MMSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            MMSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC
Sbjct:    1 MMSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 270          
BLAST of Aspartate dehydrogenase domain containing vs. Planmine SMEST
Match: SMESG000061639.1 (SMESG000061639.1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 269/269 (100.00%), Postives = 269/269 (100.00%), Query Frame = 3
Query:   90 MSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 896
            MSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC
Sbjct:    1 MSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILNDIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKEKIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLLGIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSFDEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATFMSFYHSLKKAAGAESGLHFC 269          
The following BLAST results are available for this feature:
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ASPDH1.231e-6038.93aspartate dehydrogenase domain containing [Source:... [more]
ASPDH4.738e-2432.75aspartate dehydrogenase domain containing [Source:... [more]
ASPDH6.500e-1940.58aspartate dehydrogenase domain containing [Source:... [more]
ASPDH2.986e-647.50aspartate dehydrogenase domain containing [Source:... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F17C8.99.368e-6540.29pep chromosome:WBcel235:III:4734356:4736065:1 gene... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aspdh1.906e-6939.35aspartate dehydrogenase domain containing [Source:... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Aspdh4.900e-6038.71aspartate dehydrogenase domain containing [Source:... [more]
Aspdh4.040e-5540.00aspartate dehydrogenase domain containing [Source:... [more]
Aspdh6.530e-2433.03aspartate dehydrogenase domain containing [Source:... [more]
Aspdh7.004e-1833.63aspartate dehydrogenase domain containing [Source:... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66I59|ASPD_DANRE1.335e-6839.35Putative L-aspartate dehydrogenase OS=Danio rerio ... [more]
sp|Q5FW48|ASPD_XENTR6.506e-6640.43Putative L-aspartate dehydrogenase OS=Xenopus trop... [more]
sp|A6ND91|ASPD_HUMAN5.913e-6038.93Putative L-aspartate dehydrogenase OS=Homo sapiens... [more]
sp|Q9DCQ2|ASPD_MOUSE3.428e-5938.71Putative L-aspartate dehydrogenase OS=Mus musculus... [more]
sp|Q5I0J9|ASPD_RAT1.191e-4637.39Putative L-aspartate dehydrogenase OS=Rattus norve... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7A0X21.159e-7743.64Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A1S3K2P36.415e-7641.76putative L-aspartate dehydrogenase isoform X2 OS=L... [more]
A0A0D2WHX73.201e-7544.13Aspartate dehydrogenase isoform 1 OS=Capsaspora ow... [more]
A0A1W0X4075.740e-7545.52Putative L-aspartate dehydrogenase OS=Hypsibius du... [more]
K1Q8Z31.908e-7441.48Putative L-aspartate dehydrogenase OS=Crassostrea ... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aspdh3.732e-7341.13aspartate dehydrogenase domain containing [Source:... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ASPDH6.199e-5435.74aspartate dehydrogenase domain containing [Source:... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO411886.698e-7344.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aspdh6.335e-7040.94aspartate dehydrogenase domain containing [Source:... [more]
back to top
BLAST of Aspartate dehydrogenase domain containing vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000061639.10.000e+0100.00SMESG000061639.1[more]
SMESG000061639.10.000e+0100.00SMESG000061639.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027855 ID=SMED30027855|Name=Aspartate dehydrogenase domain containing|organism=Schmidtea mediterranea sexual|type=transcript|length=1160bp
AACAAACATGAGGCTATTGTTTTGTTTCAATCACTATTCGGGTCATAGTT
CAAAAGGTATTAGTAAACATAACTTTTACTGTTAAAATGATGTCTATTGG
AATATTAGGATTCGGAAAACTTGGTCAATTTCTCTATGATGCGGTGGAAA
AATCTCCAAATTTTCAAGTGGCTTTTGTTTGGAATAGAAATAAATCAAAA
CTGAAAGATATTGTTCCAAATGATCTTATTTTAAATGATATTTATGATAT
GAAAGATCGGAAATGCAATTTAGTAATTGAAGTTTGCCATCCTGATATAA
TAAAAGAATATGGTGAATTCATTCTAAAGTATTCTCATTTGATGGTTGGT
TCTCCAACAATATTTGCCAATGCTGAATTCAAAGAAAAGATAATAAATTC
AGCAATGTTCCATGCAATTTATATTCCAACTGGTGCCCTATGGGGATTGG
AAGACATCAGACGATTAGATGAAAGCAAAGAAATTAAATCTATGAAAATA
ACAATGGAAAAACATCCGAATTCATTTAAATTACTGGGAATATACAATGA
GTTGAATGAAATATCCAAACAAAGTGACCTACCGACGATAATTTATAACG
GAACAGTGAAAGAACTGAGTGAAATCGCACCAAACAACGTCAACACAATG
GCGGTGGCGGCATTGGCAGCGAACAGTCTAAGTTTCGATGAAGTCAAGGG
TTGCTTGATTTCAAATTCAAGGAACGAGACCAATCACGTAATTACGATTG
AATTGGAAACTCACGCTGGATTAAAGGTGGTCACAAAACGAGAAAATCCT
GCAATTGTTGGTTCAGTCACTGGCTCAGCAACATTCATGTCGTTTTATCA
TAGTTTAAAGAAGGCGGCTGGTGCAGAATCGGGATTACATTTTTGCTGAA
AGTTATTAAATCAACATTTCAATTTCATGCCGCTTTAGTGTTAATAGGAC
TAGAAAATATGTTTATTCATCGTTCATGCATCACTGATATGTTTTATCAA
GTATATTATGTTGCCTCTAGACATTGGGAAATATTTTGATTATGTGATAA
TGGATGAATGGATTGTGTATGGTTCAATTTTATCATTGATTAAATTGATT
TCTTTTGAAATCTCAAAAATATTGTGTTTCGATGATAATTAAAACAAAAC
GAATAAAACA
back to top

protein sequence of SMED30027855-orf-1

>SMED30027855-orf-1 ID=SMED30027855-orf-1|Name=SMED30027855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MMSIGILGFGKLGQFLYDAVEKSPNFQVAFVWNRNKSKLKDIVPNDLILN
DIYDMKDRKCNLVIEVCHPDIIKEYGEFILKYSHLMVGSPTIFANAEFKE
KIINSAMFHAIYIPTGALWGLEDIRRLDESKEIKSMKITMEKHPNSFKLL
GIYNELNEISKQSDLPTIIYNGTVKELSEIAPNNVNTMAVAALAANSLSF
DEVKGCLISNSRNETNHVITIELETHAGLKVVTKRENPAIVGSVTGSATF
MSFYHSLKKAAGAESGLHFC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002811Asp_DH
IPR016040NAD(P)-bd_dom
IPR000846DapB_N
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:00088394-hydroxy-tetrahydrodipicolinate reductase
GO:0033735aspartate dehydrogenase activity
GO:0050661NADP binding
Vocabulary: biological process
TermDefinition
GO:0019363pyridine nucleotide biosynthetic process
GO:0006742NADP catabolic process
GO:0055114oxidation-reduction process
GO:0009089lysine biosynthetic process via diaminopimelate
GO:0009435NAD biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 6..116
e-value: 9.9E-39
score: 134.6
NoneNo IPR availableGENE3DG3DSA:3.30.360.10coord: 117..224
e-value: 9.9E-39
score: 134.6
NoneNo IPR availablePANTHERPTHR31873FAMILY NOT NAMEDcoord: 2..270
NoneNo IPR availablePANTHERPTHR31873:SF6L-ASPARTATE DEHYDROGENASE-RELATEDcoord: 2..270
NoneNo IPR availableSUPERFAMILYSSF55347Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domaincoord: 117..232
IPR000846Dihydrodipicolinate reductase, N-terminalPFAMPF01113DapB_Ncoord: 2..97
e-value: 9.8E-6
score: 25.7
IPR002811Aspartate dehydrogenasePFAMPF01958DUF108coord: 166..249
e-value: 3.7E-14
score: 52.8
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 1..147