Parathyroid hormone/parathyroid hormone-related peptide receptor

Overview
NameParathyroid hormone/parathyroid hormone-related peptide receptor
Smed IDSMED30027851
Length (bp)1524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Parathyroid hormone/parathyroid hormone-related peptide receptor (SMED30027851) t-SNE clustered cells

Violin plots show distribution of expression levels for Parathyroid hormone/parathyroid hormone-related peptide receptor (SMED30027851) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Parathyroid hormone/parathyroid hormone-related peptide receptor (SMED30027851) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Parathyroid hormone/parathyroid hormone-related peptide receptor (SMED30027851) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027851

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027851h1SMcG0006348 SmedASXL_013623SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027851h1SMcG0006348 dd_Smed_v6_20871_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30027851h1SMcG0006348 Contig15421newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027851h1SMcG0006348 Contig15421uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 142.895 bits (359), Expect = 2.308e-36
Identity = 123/389 (31.62%), Postives = 189/389 (48.59%), Query Frame = 2
Query:  257 NESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
             E+    +     C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   95 KEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 142.124 bits (357), Expect = 8.937e-36
Identity = 126/397 (31.74%), Postives = 193/397 (48.61%), Query Frame = 2
Query:  251 LMNESINDQQTINET------CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            L  ES  D++    +      C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   87 LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 142.124 bits (357), Expect = 8.937e-36
Identity = 126/397 (31.74%), Postives = 193/397 (48.61%), Query Frame = 2
Query:  251 LMNESINDQQTINET------CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            L  ES  D++    +      C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   87 LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 142.124 bits (357), Expect = 8.937e-36
Identity = 126/397 (31.74%), Postives = 193/397 (48.61%), Query Frame = 2
Query:  251 LMNESINDQQTINET------CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            L  ES  D++    +      C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   87 LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 142.124 bits (357), Expect = 8.937e-36
Identity = 126/397 (31.74%), Postives = 193/397 (48.61%), Query Frame = 2
Query:  251 LMNESINDQQTINET------CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            L  ES  D++    +      C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   87 LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 77.7962 bits (190), Expect = 5.044e-15
Identity = 95/377 (25.20%), Postives = 167/377 (44.30%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI------SWTNYSGCRPKTDKEKMHYKTIQAIGQ-------IGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL---YYLTL----------NSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXX--XXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV-FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFR 1339
            C  ++D + CWP T + S V   CP ++ G   +    K+C  TG+W  +K         WTN++ C  K D E    K  Q + +       +G  +S++SL+LA +IF  FRRL   RN +H+ L ++ L+  IL    Y+ L          NS E K+      I+C  +     Y        +F+E  YL+N + +  F      L Y+I    I        ++ V+++ +F    C  ++    + +FW++    +   + N+    N++R +YSK+           ++   +  +L+ + GV N++  IP       A T   I    V   Y        QGL+V+ ++CF ++EV+  ++ +  R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCP-HMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCF-KIDYEDA--KIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMP-IVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYY--LEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPF------APTRDNIMVFAVWT-YTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYAR 436          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 77.7962 bits (190), Expect = 5.044e-15
Identity = 95/377 (25.20%), Postives = 167/377 (44.30%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI------SWTNYSGCRPKTDKEKMHYKTIQAIGQ-------IGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL---YYLTL----------NSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXX--XXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV-FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFR 1339
            C  ++D + CWP T + S V   CP ++ G   +    K+C  TG+W  +K         WTN++ C  K D E    K  Q + +       +G  +S++SL+LA +IF  FRRL   RN +H+ L ++ L+  IL    Y+ L          NS E K+      I+C  +     Y        +F+E  YL+N + +  F      L Y+I    I        ++ V+++ +F    C  ++    + +FW++    +   + N+    N++R +YSK+           ++   +  +L+ + GV N++  IP       A T   I    V   Y        QGL+V+ ++CF ++EV+  ++ +  R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCP-HMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCF-KIDYEDA--KIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMP-IVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYY--LEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPF------APTRDNIMVFAVWT-YTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYAR 436          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 77.411 bits (189), Expect = 6.660e-15
Identity = 95/377 (25.20%), Postives = 167/377 (44.30%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI------SWTNYSGCRPKTDKEKMHYKTIQAIGQ-------IGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL---YYLTL----------NSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXX--XXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV-FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFR 1339
            C  ++D + CWP T + S V   CP ++ G   +    K+C  TG+W  +K         WTN++ C  K D E    K  Q + +       +G  +S++SL+LA +IF  FRRL   RN +H+ L ++ L+  IL    Y+ L          NS E K+      I+C  +     Y        +F+E  YL+N + +  F      L Y+I    I        ++ V+++ +F    C  ++    + +FW++    +   + N+    N++R +YSK+           ++   +  +L+ + GV N++  IP       A T   I    V   Y        QGL+V+ ++CF ++EV+  ++ +  R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCP-HMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCF-KIDYEDA--KIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMP-IVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYY--LEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPF------APTRDNIMVFAVWT-YTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYAR 436          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 77.411 bits (189), Expect = 6.660e-15
Identity = 95/377 (25.20%), Postives = 167/377 (44.30%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI------SWTNYSGCRPKTDKEKMHYKTIQAIGQ-------IGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL---YYLTL----------NSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXX--XXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV-FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFR 1339
            C  ++D + CWP T + S V   CP ++ G   +    K+C  TG+W  +K         WTN++ C  K D E    K  Q + +       +G  +S++SL+LA +IF  FRRL   RN +H+ L ++ L+  IL    Y+ L          NS E K+      I+C  +     Y        +F+E  YL+N + +  F      L Y+I    I        ++ V+++ +F    C  ++    + +FW++    +   + N+    N++R +YSK+           ++   +  +L+ + GV N++  IP       A T   I    V   Y        QGL+V+ ++CF ++EV+  ++ +  R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCP-HMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCF-KIDYEDA--KIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMP-IVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYY--LEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPF------APTRDNIMVFAVWT-YTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYAR 436          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 77.411 bits (189), Expect = 6.660e-15
Identity = 95/377 (25.20%), Postives = 167/377 (44.30%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI------SWTNYSGCRPKTDKEKMHYKTIQAIGQ-------IGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL---YYLTL----------NSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXX--XXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV-FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFR 1339
            C  ++D + CWP T + S V   CP ++ G   +    K+C  TG+W  +K         WTN++ C  K D E    K  Q + +       +G  +S++SL+LA +IF  FRRL   RN +H+ L ++ L+  IL    Y+ L          NS E K+      I+C  +     Y        +F+E  YL+N + +  F      L Y+I    I        ++ V+++ +F    C  ++    + +FW++    +   + N+    N++R +YSK+           ++   +  +L+ + GV N++  IP       A T   I    V   Y        QGL+V+ ++CF ++EV+  ++ +  R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCP-HMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCF-KIDYEDA--KIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMP-IVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYY--LEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPF------APTRDNIMVFAVWT-YTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYAR 436          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0343652)

HSP 1 Score: 92.0485 bits (227), Expect = 1.568e-19
Identity = 114/432 (26.39%), Postives = 195/432 (45.14%), Query Frame = 2
Query:  203 VIQDKRIKEEQIKCFHLMNESINDQQTINET-----CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGIS---WTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYY-NLIICRVIKTAQNYAIIANNTCVFVEA---------AYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKM---IAQPMHELTFRRRIAHSISVLVIVFGV--YNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRRFN--YTPNTFRMQSSYLHQRNPKRQL 1414
            VI  + + EE  +   LM   ++     N+      CP+++D   CWP T +G+++   CP++++GF    +A K CL  G W+ R  +S   W+NY+ C    D E + ++  Q I ++   GYA+S+++L+++  IFL F+ L C R ++HV LF S     + + L      ++SE    N + C  +    +Y ++ N   +F E           ++ + +    F V     W+  I   I+  +            DN  CW T D  Y    W+  V      L + +  +N++R I  K+    AQP   L  R+ +  +I +LV +FG+  + L + P D  T +   + +   L V+       + S QG +VS LFCF + +V   IR  L +      TP      +  +    P R+L
Sbjct:   84 VIDMRNVDEELAEKEELMATVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLENGSWY-RHPVSNQTWSNYTNC---VDYEDLEFR--QFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVIS---WFSPIPIAIVYGLARHFSSP-----DNKHCWIT-DSLY---LWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPA-PLAIRKAVRATI-ILVPLFGLQHFLLPYRP-DAGTQL---DHFYQMLSVV-------LVSLQGFVVSFLFCFANHDVTFAIRTLLNKLLPSLVTPPPAGSNTGQMATTTPSREL 484          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0073753)

HSP 1 Score: 92.0485 bits (227), Expect = 1.568e-19
Identity = 114/432 (26.39%), Postives = 195/432 (45.14%), Query Frame = 2
Query:  203 VIQDKRIKEEQIKCFHLMNESINDQQTINET-----CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGIS---WTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYY-NLIICRVIKTAQNYAIIANNTCVFVEA---------AYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKM---IAQPMHELTFRRRIAHSISVLVIVFGV--YNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRRFN--YTPNTFRMQSSYLHQRNPKRQL 1414
            VI  + + EE  +   LM   ++     N+      CP+++D   CWP T +G+++   CP++++GF    +A K CL  G W+ R  +S   W+NY+ C    D E + ++  Q I ++   GYA+S+++L+++  IFL F+ L C R ++HV LF S     + + L      ++SE    N + C  +    +Y ++ N   +F E           ++ + +    F V     W+  I   I+  +            DN  CW T D  Y    W+  V      L + +  +N++R I  K+    AQP   L  R+ +  +I +LV +FG+  + L + P D  T +   + +   L V+       + S QG +VS LFCF + +V   IR  L +      TP      +  +    P R+L
Sbjct:   84 VIDMRNVDEELAEKEELMATVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLENGSWY-RHPVSNQTWSNYTNC---VDYEDLEFR--QFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVIS---WFSPIPIAIVYGLARHFSSP-----DNKHCWIT-DSLY---LWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPA-PLAIRKAVRATI-ILVPLFGLQHFLLPYRP-DAGTQL---DHFYQMLSVV-------LVSLQGFVVSFLFCFANHDVTFAIRTLLNKLLPSLVTPPPAGSNTGQMATTTPSREL 484          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0070436)

HSP 1 Score: 89.3521 bits (220), Expect = 2.011e-18
Identity = 85/375 (22.67%), Postives = 163/375 (43.47%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGIS------WTNYSGC-RPKTDK--EKMHYKTIQA----------IGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL-YYLTLNSYEKKSERYYNLIICRVIKTAQ----------NYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLF---CWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV--FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHS 1315
            C  +WD + CWP T +G L    CP    G      A ++C   G+W  R   +      WT+Y  C +P+  +  ++M  K   A          +  +G  +S+ +L+++  IF  FR L   R K+H +LFV+ +L+ I+   L L+ + + ++         VI+              YA  A    +F+E  YLHN++    F  S    ++  +   +   + T+      +  D       W+ +  PY   +W+++   + + L N    +N++R +  K+      ++   R+   +  VL+ + G+ NL+    P+   T+ A  +           Y  H ++S QG  +++++CF++ EV +
Sbjct:  147 CNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPY---YWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS-----------YGTHFLTSFQGFFIALIYCFLNGEVRA 507          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0340084)

HSP 1 Score: 88.9669 bits (219), Expect = 2.667e-18
Identity = 85/375 (22.67%), Postives = 163/375 (43.47%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGIS------WTNYSGC-RPKTDK--EKMHYKTIQA----------IGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL-YYLTLNSYEKKSERYYNLIICRVIKTAQ----------NYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLF---CWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV--FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHS 1315
            C  +WD + CWP T +G L    CP    G      A ++C   G+W  R   +      WT+Y  C +P+  +  ++M  K   A          +  +G  +S+ +L+++  IF  FR L   R K+H +LFV+ +L+ I+   L L+ + + ++         VI+              YA  A    +F+E  YLHN++    F  S    ++  +   +   + T+      +  D       W+ +  PY   +W+++   + + L N    +N++R +  K+      ++   R+   +  VL+ + G+ NL+    P+   T+ A  +           Y  H ++S QG  +++++CF++ EV +
Sbjct:  147 CNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPY---YWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS-----------YGTHFLTSFQGFFIALIYCFLNGEVRA 507          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0340085)

HSP 1 Score: 88.9669 bits (219), Expect = 2.667e-18
Identity = 85/375 (22.67%), Postives = 163/375 (43.47%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGIS------WTNYSGC-RPKTDK--EKMHYKTIQA----------IGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAIL-YYLTLNSYEKKSERYYNLIICRVIKTAQ----------NYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLF---CWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLV--FIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHS 1315
            C  +WD + CWP T +G L    CP    G      A ++C   G+W  R   +      WT+Y  C +P+  +  ++M  K   A          +  +G  +S+ +L+++  IF  FR L   R K+H +LFV+ +L+ I+   L L+ + + ++         VI+              YA  A    +F+E  YLHN++    F  S    ++  +   +   + T+      +  D       W+ +  PY   +W+++   + + L N    +N++R +  K+      ++   R+   +  VL+ + G+ NL+    P+   T+ A  +           Y  H ++S QG  +++++CF++ EV +
Sbjct:  147 CNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPY---YWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS-----------YGTHFLTSFQGFFIALIYCFLNGEVRA 507          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Zebrafish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 157.147 bits (396), Expect = 1.124e-41
Identity = 123/390 (31.54%), Postives = 195/390 (50.00%), Query Frame = 2
Query:  260 ESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGC----RPKTDKEKMH-YKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEK--------------KSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR-WL 1333
            ++I++    +E C   WD + CWP  S G++   PCP+Y+  F  +G A +QC S G W   +  +W NYS C     P  +K K   ++ +  +  +GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRAI  ++          L  Y+                  +Y+    C++      Y +  N   + VE  YLH+++F   F+ S + LW + +  W +PA+    W +VR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFGV+ +VF        V   + +      +++YCE   +S QG  VSI++CF + EV +EIR+ WL
Sbjct:   19 QNISEHNPADEVCSPGWDGLVCWPQGSPGTVTKVPCPSYVYDFNHNGFAYRQCSSNGSWVSVENRTWVNYSDCLRFLAPGIEKGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDRVVYANGVLQEYDTMLMDNISTVSISPLDKTQYFG---CKITVLFFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKY-LWGFTLIGWGVPALFVSTWAVVRATLADARCWELSAGNIK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVF--------VGMPHTFTGLGWELRMYCELFFNSFQGFFVSIIYCFCNGEVQAEIRKTWL 393          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Zebrafish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 156.762 bits (395), Expect = 4.641e-41
Identity = 123/390 (31.54%), Postives = 195/390 (50.00%), Query Frame = 2
Query:  260 ESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGC----RPKTDKEKMH-YKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEK--------------KSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR-WL 1333
            ++I++    +E C   WD + CWP  S G++   PCP+Y+  F  +G A +QC S G W   +  +W NYS C     P  +K K   ++ +  +  +GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRAI  ++          L  Y+                  +Y+    C++      Y +  N   + VE  YLH+++F   F+ S + LW + +  W +PA+    W +VR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFGV+ +VF        V   + +      +++YCE   +S QG  VSI++CF + EV +EIR+ WL
Sbjct:   47 QNISEHNPADEVCSPGWDGLVCWPQGSPGTVTKVPCPSYVYDFNHNGFAYRQCSSNGSWVSVENRTWVNYSDCLRFLAPGIEKGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDRVVYANGVLQEYDTMLMDNISTVSISPLDKTQYFG---CKITVLFFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKY-LWGFTLIGWGVPALFVSTWAVVRATLADARCWELSAGNIK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVF--------VGMPHTFTGLGWELRMYCELFFNSFQGFFVSIIYCFCNGEVQAEIRKTWL 421          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 134.42 bits (337), Expect = 1.266e-33
Identity = 129/419 (30.79%), Postives = 198/419 (47.26%), Query Frame = 2
Query:  209 QDKRIKEEQI--------KCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFV--RKGISWTNYSGCRP-----KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYY-----LTLNSYEKKSERY----------------YNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVF--IPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRR 1342
             D   KEEQI        KC   +    +  +T   +C   WD I CWP    G +V   CP YI  F   G A ++C   G W +      +W NYS C         ++E+  +  +  I  +GY++S+ SL++A  I   FRRL+C RN +H+ LF+SF+LRAI  +     L   S  ++ ER                    I C+V  T   Y +  N   + VE  YLH+++F  TF      LW + +  W +PA+   IW  VR    +  CWD      K   W++Q+  +T  + N LLFLN++R + +K+          R   R++  S  VL+ +FGV+ +VF  +P   V+ V         L  ++++ E L +S QG  V+I++CF + EV +EI++   RR
Sbjct:    4 DDVLTKEEQIYLLFNAKRKCERAIK---SKHKTSEGSCLPEWDGILCWPEGVPGKMVSTSCPEYIYDFNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLADTECWDLSAGNLK---WIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGV---------LWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIKKAWNRR 406          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 134.42 bits (337), Expect = 1.467e-33
Identity = 128/417 (30.70%), Postives = 198/417 (47.48%), Query Frame = 2
Query:  209 QDKRIKEEQI--------KCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFV--RKGISWTNYSGCRP-----KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYY-----LTLNSYEKKSERY----------------YNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRR 1342
             D   KEEQI        KC   +    +  +T   +C   WD I CWP    G +V   CP YI  F   G A ++C   G W +      +W NYS C         ++E+  +  +  I  +GY++S+ SL++A  I   FRRL+C RN +H+ LF+SF+LRAI  +     L   S  ++ ER                    I C+V  T   Y +  N   + VE  YLH+++F  TF      LW + +  W +PA+   IW  VR    +  CWD      K   W++Q+  +T  + N LLFLN++R + +K+          R   R++  S  VL+ +FGV+ +VF+ +   T V+        L  ++++ E L +S QG  V+I++CF + EV +EI++   RR
Sbjct:   29 DDVLTKEEQIYLLFNAKRKCERAIK---SKHKTSEGSCLPEWDGILCWPEGVPGKMVSTSCPEYIYDFNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLADTECWDLSAGNLK---WIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMP-YTEVS------GVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIKKAWNRR 431          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Zebrafish
Match: pth3r (parathyroid hormone 3 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-12])

HSP 1 Score: 132.88 bits (333), Expect = 5.264e-33
Identity = 114/370 (30.81%), Postives = 187/370 (50.54%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI--SWTNYSGCRP-----KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAI--------LYYLTLNS-YEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVF--IPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRR 1342
            C   WD I CWPT     +V   CP YI  F   G A + C ++G W     I  +W NY+ C        +D+E++ ++ +  +  IGY++S+ +L++A +I   F+RL+C RN +H+ LF SF+ RAI        LY +T +   E  +     ++ C+   T   Y +  N+  + VE  YLH+++F   F    + LW   I  W +PA+   IWV  R+   +  CWD      K   W+ QV  +   + N  LFLN++R + SK+      +L  R   R++  S  VL+ +FGV+ ++F  +P   VT +         L  ++++ E L +S QG  V+ ++CF + EV +E+++   RR
Sbjct:   61 CAPEWDGIICWPTGKPNQMVAVLCPEYIYDFNHRGYAYRHCDASGNWEQVSIINRTWANYTECTTYLHTNHSDQEEV-FERLYLMYTIGYSISLAALLVAVSILCYFKRLHCTRNYIHIHLFTSFICRAISIFVKDAVLYAVTNDGELEDGAVEQRPMVGCKAAVTLFLYLLATNHYWILVEGLYLHSLIFM-AFLSDKNCLWALTIIGWGIPAVFVSIWVSARVSLADTQCWDISAGNLK---WIYQVPILAAIVVNFFLFLNIIRVLASKLWETNTGKLDPRQQYRKLLKSTMVLMPLFGVHYMLFMALPYTDVTGL---------LWQIQMHYEMLFNSSQGFFVAFIYCFCNGEVQAEVKKAWLRR 416          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Xenopus
Match: sstr5 (somatostatin receptor 5 [Source:Xenbase;Acc:XB-GENE-949452])

HSP 1 Score: 140.584 bits (353), Expect = 9.931e-36
Identity = 123/417 (29.50%), Postives = 209/417 (50.12%), Query Frame = 2
Query:  224 KEEQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDG-FKVD-GVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAI-------LYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNL--VFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSE-IRRWLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTV 1438
            ++ + +C H M++   +       C  ++D   CWP     + V  PCP ++    KV  G+  K C   G+W  R      N    +   DK    Y   + +  +GY+VS+ +L+LA AI + F +L+C RN +H++LF SF+LRA+       +     N  EK  + +  LI CRV      Y IIAN   + VE  YL+N+L    F+   +    Y+   W  PA+  I WV VR  ++N  CW T+++     +W+I+   +   + N ++F+ +++ + SKM A  M    ++ R+A S   L+ + G++ +   F+P + V           TL ++KL+ +  ISS QG+LV++L+CF+++EV SE +++W  +R+    +   ++  Y H      Q P    STV
Sbjct:   47 RKYETECRHNMSQ---EPPAAGLVCNRTFDRYCCWPDALPNTTVSVPCPWFLPWHLKVQHGLVYKHCEPDGQWAERDAQECENDD--KQIEDKYFKIYDNFKIMYTVGYSVSLGTLILAFAILVGFSKLHCMRNYIHINLFASFILRAVSVLVLDTMLKTRYNENEKFEDTHLWLIGCRVAAVLMQYGIIANYYWLMVEGIYLYNLLVLAVFSERSY-FALYLCIGWGAPALFIIPWVAVRYTYENTLCWSTNNN--MGFWWIIRSSVLLAIVINFVIFVRIIQILVSKMRAHQMRYTDYKFRLAKSTLTLIPLLGIHEVAFAFLPEETVHG---------TLRLVKLFFDLFISSFQGMLVAVLYCFVNKEVQSELLKKW--KRWKLGKD---IKGEYKHTYT---QTPRVGASTV 438          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Xenopus
Match: sstr5 (somatostatin receptor 5 [Source:Xenbase;Acc:XB-GENE-949452])

HSP 1 Score: 135.961 bits (341), Expect = 3.467e-34
Identity = 123/418 (29.43%), Postives = 209/418 (50.00%), Query Frame = 2
Query:  224 KEEQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYID-GFKVD-GVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAI-------LYYLTLNSYEKKSERYYNLII-CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNL--VFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSE-IRRWLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTV 1438
            ++ + +C H M++   +       C  ++D   CWP     + V  PCP ++    KV  G+  K C   G+W  R      N    +   DK    Y   + +  +GY+VS+ +L+LA AI + F +L+C RN +H++LF SF+LRA+       +     N  EK  + +  L I CRV      Y IIAN   + VE  YL+N+L    F+   +    Y+   W  PA+  I WV VR  ++N  CW T+++     +W+I+   +   + N ++F+ +++ + SKM A  M    ++ R+A S   L+ + G++ +   F+P + V           TL ++KL+ +  ISS QG+LV++L+CF+++EV SE +++W  +R+    +   ++  Y H      Q P    STV
Sbjct:   31 RKYETECRHNMSQ---EPPAAGLVCNRTFDRYCCWPDALPNTTVSVPCPWFLPWHLKVQHGLVYKHCEPDGQWAERDAQECENDD--KQIEDKYFKIYDNFKIMYTVGYSVSLGTLILAFAILVGFSKLHCMRNYIHINLFASFILRAVSVLVLDTMLKTRYNENEKFEDTHLWLSIGCRVAAVLMQYGIIANYYWLMVEGIYLYNLLVLAVFSERSY-FALYLCIGWGAPALFIIPWVAVRYTYENTLCWSTNNN--MGFWWIIRSSVLLAIVINFVIFVRIIQILVSKMRAHQMRYTDYKFRLAKSTLTLIPLLGIHEVAFAFLPEETVHG---------TLRLVKLFFDLFISSFQGMLVAVLYCFVNKEVQSELLKKW--KRWKLGKD---IKGEYKHTYT---QTPRVGASTV 423          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 134.035 bits (336), Expect = 4.425e-34
Identity = 101/342 (29.53%), Postives = 173/342 (50.58%), Query Frame = 2
Query:  323 CWPTTSSGSLVFAPCPNYIDGFKVDGVAS--KQCLSTGKWFVRKGISWTNYSGCRPKTDKEK---MHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIR-RW 1330
            CWP + +G LV  PCP+  +G + +   S  ++C   G W      SW NYS C P  D ++   +HYK    I  +G+ +S+++LV+A  +FLC R + C RN +H +L  +F+LR I+++L      +  E   N + CR I T  NY ++ N   +FVE  YLH  +   T++    R W ++   W +P+ I + W + ++ ++N  CW    +P K   ++ Q   I + L N +   N++R + +K+ A    E    R+   +  VL+ + G+  ++F        V+         +++ +Y    + S QG  VS+ +CF++ EV S  R RW
Sbjct:   42 CWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTW-----ASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHES--NEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIV-MTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCW-IGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVS---------QIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRW 365          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 134.035 bits (336), Expect = 5.321e-34
Identity = 101/342 (29.53%), Postives = 173/342 (50.58%), Query Frame = 2
Query:  323 CWPTTSSGSLVFAPCPNYIDGFKVDGVAS--KQCLSTGKWFVRKGISWTNYSGCRPKTDKEK---MHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIR-RW 1330
            CWP + +G LV  PCP+  +G + +   S  ++C   G W      SW NYS C P  D ++   +HYK    I  +G+ +S+++LV+A  +FLC R + C RN +H +L  +F+LR I+++L      +  E   N + CR I T  NY ++ N   +FVE  YLH  +   T++    R W ++   W +P+ I + W + ++ ++N  CW    +P K   ++ Q   I + L N +   N++R + +K+ A    E    R+   +  VL+ + G+  ++F        V+         +++ +Y    + S QG  VS+ +CF++ EV S  R RW
Sbjct:   53 CWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTW-----ASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHES--NEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIV-MTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCW-IGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVS---------QIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRW 376          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 134.035 bits (336), Expect = 5.613e-34
Identity = 101/342 (29.53%), Postives = 173/342 (50.58%), Query Frame = 2
Query:  323 CWPTTSSGSLVFAPCPNYIDGFKVDGVAS--KQCLSTGKWFVRKGISWTNYSGCRPKTDKEK---MHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIR-RW 1330
            CWP + +G LV  PCP+  +G + +   S  ++C   G W      SW NYS C P  D ++   +HYK    I  +G+ +S+++LV+A  +FLC R + C RN +H +L  +F+LR I+++L      +  E   N + CR I T  NY ++ N   +FVE  YLH  +   T++    R W ++   W +P+ I + W + ++ ++N  CW    +P K   ++ Q   I + L N +   N++R + +K+ A    E    R+   +  VL+ + G+  ++F        V+         +++ +Y    + S QG  VS+ +CF++ EV S  R RW
Sbjct:   42 CWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTW-----ASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHES--NEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVM-TYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCW-IGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVS---------QIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRW 365          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 147.132 bits (370), Expect = 1.004e-37
Identity = 133/413 (32.20%), Postives = 199/413 (48.18%), Query Frame = 2
Query:  197 PRVIQDKRIKEEQIKCFHLMNESINDQQTI----NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--------AILYY-LTLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P     K  KE+    F+  ++   D  T        C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W V  G   +W NYS C      E    +    +G I   GY++S+ SL +A  I   FRRL+C RN +H+ +F+SF+LR        A+LY   TL+  E+ +E   ++I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + I  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VLV +FGV+  VF+ +   T V+       TL  ++++ E L +S QG  V+I++CF + EV +EIR+
Sbjct:   71 PASTSGKPRKEKAPGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK---WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPY-TEVS------GTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 147.132 bits (370), Expect = 1.004e-37
Identity = 133/413 (32.20%), Postives = 199/413 (48.18%), Query Frame = 2
Query:  197 PRVIQDKRIKEEQIKCFHLMNESINDQQTI----NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--------AILYY-LTLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P     K  KE+    F+  ++   D  T        C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W V  G   +W NYS C      E    +    +G I   GY++S+ SL +A  I   FRRL+C RN +H+ +F+SF+LR        A+LY   TL+  E+ +E   ++I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + I  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VLV +FGV+  VF+ +   T V+       TL  ++++ E L +S QG  V+I++CF + EV +EIR+
Sbjct:   71 PASTSGKPRKEKAPGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK---WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPY-TEVS------GTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 147.132 bits (370), Expect = 1.004e-37
Identity = 133/413 (32.20%), Postives = 199/413 (48.18%), Query Frame = 2
Query:  197 PRVIQDKRIKEEQIKCFHLMNESINDQQTI----NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--------AILYY-LTLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P     K  KE+    F+  ++   D  T        C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W V  G   +W NYS C      E    +    +G I   GY++S+ SL +A  I   FRRL+C RN +H+ +F+SF+LR        A+LY   TL+  E+ +E   ++I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + I  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VLV +FGV+  VF+ +   T V+       TL  ++++ E L +S QG  V+I++CF + EV +EIR+
Sbjct:   71 PASTSGKPRKEKAPGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK---WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPY-TEVS------GTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Mouse
Match: Adcyap1r1 (adenylate cyclase activating polypeptide 1 receptor 1 [Source:MGI Symbol;Acc:MGI:108449])

HSP 1 Score: 141.354 bits (355), Expect = 2.021e-36
Identity = 122/436 (27.98%), Postives = 210/436 (48.17%), Query Frame = 2
Query:  209 QDKRIKEEQIKCFHLMNESINDQQTINET---CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVD---GVASKQCLSTG------KWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLT---LNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPM--HELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR----WLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTVNGGIQ 1453
             D   K+EQ  C   +  + ND   +NE+   CP  WD I CW     G +V   CP     F  D   GV  + C   G       +F   G     +    P++  +  +Y +++A+  +GY+ S+++L  A  I   FR+L+C RN +H++LFVSF+LRAI  ++    L + +  S  + + + C+ +    +Y +++N   +F+E  YL  +L   TF       ++Y I  W  P +   +W ++R+ FD+  CWD +D      +WVI+   +   + N +LF+ ++  +  K+ +  M  +E +   R+A S  +L+ +FG++  VF         A +   ++  E  +L  E  + S QG +V++L+CF++ EV +EI+R    W   R+      F M   + H        P  + S VNGG Q
Sbjct:   23 SDCIFKKEQAMCLERIQRA-NDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEVFRIFNPDQDMGVVGRNCTEDGWSEPFPHYFDACG-----FDDYEPESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLV-ETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDS--TALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVF---------AFSPENVSKRE--RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRY------FTMDFKHRH--------PSLASSGVNGGTQ 424          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Mouse
Match: Adcyap1r1 (adenylate cyclase activating polypeptide 1 receptor 1 [Source:MGI Symbol;Acc:MGI:108449])

HSP 1 Score: 133.265 bits (334), Expect = 1.941e-33
Identity = 122/457 (26.70%), Postives = 210/457 (45.95%), Query Frame = 2
Query:  209 QDKRIKEEQIKCFHLMNESINDQQTINET---CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVD------------------------GVASKQCLSTG------KWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLT---LNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPM--HELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR----WLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTVNGGIQ 1453
             D   K+EQ  C   +  + ND   +NE+   CP  WD I CW     G +V   CP     F  D                        GV  + C   G       +F   G     +    P++  +  +Y +++A+  +GY+ S+++L  A  I   FR+L+C RN +H++LFVSF+LRAI  ++    L + +  S  + + + C+ +    +Y +++N   +F+E  YL  +L   TF       ++Y I  W  P +   +W ++R+ FD+  CWD +D      +WVI+   +   + N +LF+ ++  +  K+ +  M  +E +   R+A S  +L+ +FG++  VF         A +   ++  E  +L  E  + S QG +V++L+CF++ EV +EI+R    W   R+      F M   + H        P  + S VNGG Q
Sbjct:   23 SDCIFKKEQAMCLERIQRA-NDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEVFRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACG-----FDDYEPESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLV-ETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDS--TALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVF---------AFSPENVSKRE--RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRY------FTMDFKHRH--------PSLASSGVNGGTQ 445          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. UniProt/SwissProt
Match: sp|P25961|PTH1R_RAT (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Rattus norvegicus OX=10116 GN=Pth1r PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 7.021e-37
Identity = 133/413 (32.20%), Postives = 199/413 (48.18%), Query Frame = 2
Query:  197 PRVIQDKRIKEEQIKCFHLMNESINDQQTI----NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--------AILYY-LTLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P     K  KE+    F+  ++   D  T        C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W V  G   +W NYS C      E    +    +G I   GY++S+ SL +A  I   FRRL+C RN +H+ +F+SF+LR        A+LY   TL+  E+ +E   ++I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + I  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VLV +FGV+  VF+ +   T V+       TL  ++++ E L +S QG  V+I++CF + EV +EIR+
Sbjct:   71 PASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK---WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPY-TEVS------GTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. UniProt/SwissProt
Match: sp|P41593|PTH1R_MOUSE (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Mus musculus OX=10090 GN=Pth1r PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 7.021e-37
Identity = 133/413 (32.20%), Postives = 199/413 (48.18%), Query Frame = 2
Query:  197 PRVIQDKRIKEEQIKCFHLMNESINDQQTI----NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--------AILYY-LTLNSYEKKSERYYNLII---------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P     K  KE+    F+  ++   D  T        C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W V  G   +W NYS C      E    +    +G I   GY++S+ SL +A  I   FRRL+C RN +H+ +F+SF+LR        A+LY   TL+  E+ +E   ++I                CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + I  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VLV +FGV+  VF+ +   T V+       TL  ++++ E L +S QG  V+I++CF + EV +EIR+
Sbjct:   71 PASTSGKPRKEKAPGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK---WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPY-TEVS------GTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRK 472          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. UniProt/SwissProt
Match: sp|P50133|PTH1R_PIG (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Sus scrofa OX=9823 GN=PTH1R PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.794e-36
Identity = 127/392 (32.40%), Postives = 193/392 (49.23%), Query Frame = 2
Query:  251 LMNESINDQQTINE--TCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII--------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            L  ES  D  + ++   C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I               CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPAI   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   87 LYPESGEDTGSRHQGRPCLPEWDHILCWPLGAPGEVVAMPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPLPPVAATSYVGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAIFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 467          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. UniProt/SwissProt
Match: sp|Q9TU31|PTH1R_CANLF (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Canis lupus familiaris OX=9615 GN=PTH1R PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.725e-35
Identity = 126/396 (31.82%), Postives = 193/396 (48.74%), Query Frame = 2
Query:  251 LMNESINDQQTINET------CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYYNLII--------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            L  ES  D++    +      C   WD I CWP  + G +V  PCP+YI  F   G A ++C   G W +  G   +W NYS C      E    +    +G I   GY+VS+ SL +A  I   FRRL+C RN +H+ LF+SF+LRA+  ++         TL+  E+ +E     I               CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+     T V+       TL  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   87 LYPESEEDKEVPTGSRHRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPTAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK---WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVS------GTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 471          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. UniProt/SwissProt
Match: sp|P25107|PTH1R_DIDVI (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Didelphis virginiana OX=9267 GN=PTH1R PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 3.363e-35
Identity = 128/430 (29.77%), Postives = 209/430 (48.60%), Query Frame = 2
Query:  140 QLNSQIKIISVAGVRIHRVPRVIQDKRIKEEQIKCFHLMNES--INDQQTINET-CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGCRPKTDKEKMHYKTIQAIGQI---GYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEKKSERYY------------NLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFI--PIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            +L   +++  +A      + R  + K+ K  + K +    ES  ++D+  + +  C   WD I CWP    G +V  PCP+YI  F   G A ++C S G W +  G   +W NYS C      E    +    +G I   GY++S+ SL +A  I   FRRL+C RN +H+ LFVSF+LRA+  ++         + +  E+ +E                 + CRV  T   Y +  N   + VE  YLH+++F   F+   + LW + +  W LPA+   +WV VR    N  CWD      K   W+IQV  +   + N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ +VF+  P   V+ +         L  ++++ E L +S QG  V+I++CF + EV +EI++
Sbjct:   51 RLKEVLRVPELAESAKDWMSRSAKTKKEKPAE-KLYSQAEESREVSDRSRLQDGFCLPEWDNIVCWPAGVPGKVVAVPCPDYIYDFNHKGRAYRRCDSNGSWELVPGNNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFVSFMLRAVSIFIKDAVLYSGVSTDEIERITEEELRAFTEPPPADKAGFVGCRVAVTVFLYFLTTNYYWILVEGLYLHSLIFMAFFSEKKY-LWGFTLFGWGLPAVFVAVWVTVRATLANTECWDLSSGNKK---WIIQVPILAAIVVNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGI---------LWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKK 466          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. TrEMBL
Match: A0A1B6MKS4 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.18026 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 9.574e-49
Identity = 136/414 (32.85%), Postives = 217/414 (52.42%), Query Frame = 2
Query:  209 QDKRIKEEQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRK--GISWTNYSGCR-----------PKTDKEKM---HYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLII----------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEI-RRWLFRRFNY 1351
            Q++R++E  I+C+  ++ S     T  E CP  WD I CWP T+ G L   PCP YI GF     ASKQC + G WFVR     +WTNYS C            P  +   +   +   ++A+  +GY VS+ +LV+A  IF  F+RL C RNK+H+ LFVSF+LRA    L  + + K      +  +                C+++ +   Y I+AN + + +E  YLHN++F+  F+ +   +  Y+   W LP +    WV VR   ++  CW T+++ Y   F +I+  T    L N++LF+N++R + SK+ A    E    RR A S  VL+ +FGV+ +VF+ I  +            +E++ L+ + L +S QG  V+IL+C ++ EV +E+ ++W  RR ++
Sbjct:   19 QERRVRENAIECYAAISNSSVSASTSLEDCPTVWDGIMCWPHTAPGILRELPCPGYIVGFNPQRFASKQCTTDGDWFVRSTTNTTWTNYSQCYSDRTTDVIVKFPGMENASLVAQYVPIVKAVSHVGYGVSLATLVVAFCIFATFKRLRCPRNKLHMHLFVSFMLRAFFTLLKDSLFVKGIGLPSDFTVKDGVSYFVHGNQSSWQCKLLVSVWQYFIMANYSWILMEGLYLHNLIFFSVFSDTSS-IALYVFLGWGLPMLFVTPWVFVRALLEDTLCWTTNENQYY--FQLIKGPTTLSILINLVLFINIVRVLMSKLRASISEETRRFRRWAKSTLVLMPLFGVHYVVFLTISYLG-------IEGKVELVWLFIDQLFASFQGFFVAILYCLLNGEVRTELAKKW--RRLSW 420          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. TrEMBL
Match: R7UVQ3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220667 PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.816e-48
Identity = 131/404 (32.43%), Postives = 221/404 (54.70%), Query Frame = 2
Query:  197 PRVIQDKRIKEEQIKCFHLMNESINDQQTINET-CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI--SWTNYSGC----RPKTDKEKM--HYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLN--------SYEKKSERYYNLII--------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR--RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P++ +  R+K  ++ C+  M   +N+   I    CP  WD I CWP T++G     PCP+YI+ F VD  A+K C + G+WF+      +WTNYS C     P+   + +  H   +  +  +GYA+SI+ L++A  + L F++L+C RN +H++LFV+F+LRA+L +L  N          +  ++++  L          C+++ T   Y + AN T +FVE  YLH ++F   F+     +  YI   W  P +  I WV+VR   D+  CW+ + +  K  FW+I+     L + N L FLN++R +++KM      E   +  R++A S  VL+ +FG++ +VFI ID        +R  + +E++ LY E   +S QG+ +++LFCF + EV +E+++
Sbjct:   12 PKLQEQMRVKA-RLDCYQRM---LNETAPIEGVHCPRRWDSIACWPPTAAGVQAEQPCPDYINKFIVDENATKICKADGEWFISSETNHTWTNYSQCISTANPEVPSQLLVDHVPNLLILANVGYALSIVMLLVAVILMLYFKKLHCPRNTVHINLFVTFILRAVLSFLKENLMVQGVGLPQDVHTDKHGMLAFNHQGTHWECKLLMTVYMYILGANCTWIFVEGLYLHMLIFMAVFS-ENSSVAQYIAIGWFSPLLFVIPWVVVRATLDDFMCWNVYTN--KNYFWIIRGPLTFLMVVNFLFFLNIVRVVFTKMSTGTAMEARGQRYRKMAKSTLVLIPLFGIHYMVFIWID-------PSRASDVVELVWLYFEMFFNSFQGVFIALLFCFFNGEVRAEVKK 401          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. TrEMBL
Match: A0A2T7PB55 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09920 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.020e-48
Identity = 132/402 (32.84%), Postives = 208/402 (51.74%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRK--GISWTNYSGC-------RPKTDK----------EKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLT-------LNSYEKKSERYYNLII----------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMI-AQPMHELTFR-RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIR-RWLFRRFNYTPNTFRMQSSY 1384
            C  +WD I CWP T SG     PCP+Y+ GF   G AS+QC+  G WFV      SWTNY+ C       +P   +           + H   I+ +  +GY VS+ +L +A  I + FRRL+C RN +H++LF +FLLRA+L +L        L   +   E     ++          C+++  A NY + A+   +FVE  YLH ++    F+   H  W YI+  W  P +  + WV++R   ++ +CW+TH  P    FW+I+   +     N + F+N++R +++K++   P     FR RR+A S  VL+ +FGV+ +VF+ +    S+          E++KLY E   +S QG  V+ LFCF++ EV +EIR +W+  R+    N+ + Q  Y
Sbjct:   10 CNATWDSIMCWPQTMSGETAVQPCPDYVHGFYTSGFASRQCMDDGSWFVNPIFNTSWTNYTQCTFDSSEPQPHVSETNTWLNVDLLTQAHLNRIKVMYNLGYGVSLAALTIAIFIMIYFRRLHCPRNTVHLNLFSAFLLRAVLSFLRDNLLVAHLGLPDDVMETVPGAVVFRDDGSTHWKCKLLFAAFNYVLAASCMWIFVEGLYLHTLIIVAVFSEKNHIRW-YILLGWGGPLVFIVPWVVLRATVEDTYCWNTH--PTIAIFWIIKGPLLLAVAVNFVFFVNIVRVLFTKLVKTAPPKARRFRYRRMAKSTLVLIPLFGVHYIVFLGLPERISLNA--------ELVKLYYEMFFNSFQGFFVASLFCFMNGEVKAEIRKKWI--RYKLRTNSRKFQKVY 398          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. TrEMBL
Match: A0A023F656 (Putative adenylate cyclase-coupled calcitonin receptor (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.838e-48
Identity = 122/367 (33.24%), Postives = 198/367 (53.95%), Query Frame = 2
Query:  290 ETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFV--RKGISWTNYSGC---RPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSY--------------EKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWL 1333
            + CP  WD I CWP T S +L   PCP Y  GF  +  A+K CL+ G W+    +  +WT+Y+ C    P     + +   ++ + QIGY++S+ISL++A  +   F+RL C RN +H+ LFVSF++RA +  L    +                      N  IC+ + +   Y I+AN + + +E  YLHN++F   F+     +  Y++  W LP +  + WV V+  F+N+ CW  + +PY   FW+I+       + N +LF+N++R +  K+      E    RR A S  +LV +FGV+  + I +   +S    N+   TLE++ L+CE L++S QG LV++L+CF++ EV SEI ++L
Sbjct:    1 DECPTVWDGILCWPNTPSDTLASLPCPIYFKGFSSEKSATKYCLTNGTWYFDYSRNQTWTDYTACMEGSPNLTYLEKYLPIVKIMSQIGYSISLISLIIAFILLANFKRLRCPRNVLHMHLFVSFIMRAGITLLKETMFVSGIGFQHEIDAVVPGDISSLPNNSICKFVTSLWQYFIMANYSWILMEGLYLHNLIFLALFS-DTSAITIYVLLGWGLPLLFVVPWVTVKAMFENVLCWTLNSNPYY--FWIIRGPIALSVVLNFILFINIVRVLLLKLTVSISEETKRYRRWAKSTLLLVPLFGVHYALLIGL---SSSMNKNQ---TLELVWLFCEQLLASSQGFLVAVLYCFMNGEVRSEIAKFL 358          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. TrEMBL
Match: A0A154PCD4 (Parathyroid hormone/parathyroid hormone-related peptide receptor (Fragment) OS=Dufourea novaeangliae OX=178035 GN=WN55_11363 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.058e-47
Identity = 135/425 (31.76%), Postives = 214/425 (50.35%), Query Frame = 2
Query:  275 QQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKG--ISWTNYSGC-----------RPKTDKE-----KMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLT----------LNSYEKKSERYYNLI-------ICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIR-------------RWLFRRFNYTPNTFRMQSSYLHQRNPK 1405
            +  I+  CP  WD I CWP+T+ G L   PCP+YI GF +   AS+QC+  G WF+      +W+NYS C            P   +      K     ++ I ++GY VS  +LV+A  I    ++L C RN +H+ LF SF+LRA +  +            +    K+ + Y L+       +C+   +   Y I+AN   + +E  YLHN++F   FT     +  Y+   W LPAI    W++ R+  DN +CW TH++PY   F +I+V T+   L N +LF+N++R +  K+ +    E    +R A S  VLV +FGV+  VF+ +     V        T+EV+ L+C+ L +S QG  V++L+CF++ EV +E+              RW+ RR  ++ +T    +S L QR+ +
Sbjct:   27 KGNISGWCPEFWDKILCWPSTAPGDLAILPCPSYIAGFDIQANASRQCMQDGHWFLNNDTHTTWSNYSQCYRESLVTLVMELPGGQENNDTVIKKFIPIVKTISKVGYTVSFFTLVVAFFILAVIKKLRCPRNMLHMHLFASFMLRAFMALMKDILFVSGIALASDMMIKNGKTYWLVDEKESSWLCKAFTSFWQYFILANYFWILMEGLYLHNLVFLALFTDVNSSIAGYVCLGWGLPAIFVSCWIVARVTLDNKYCWTTHENPYL--FHLIRVPTMLSILINFVLFVNIVRVLLLKLKSTVSEETQRYKRWAKSTLVLVPLFGVHYTVFLGMSYSIGVN------ETVEVVWLFCDQLFASFQGFFVAVLYCFLNGEVRTEVSRAIRSQRLPRLRPRWMSRRSTHSGSTCSCNASKLGQRSKR 443          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Cavefish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 152.525 bits (384), Expect = 1.228e-39
Identity = 125/437 (28.60%), Postives = 214/437 (48.97%), Query Frame = 2
Query:  110 LFLLSWKVSPQLNSQIKIISVAGVRIHRVPRVIQDKRIKEEQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGC----RPKTDKEKMH-YKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLN-SYEKKSERYYNLII-------------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR-WL 1333
            L + SW  + Q++ ++ + +   V +           + + +++C     ++I++    +E C   WD + CWP  S G++   PCP+Y+  F  +G A ++C   G W   +  +W NYS C     P  ++ K   ++ +  +  +GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRAI  ++     Y     + Y+ ++                   C++      Y +  N   + VE  YLH+++F   F+ S + LW + +  W +PA+    W +VR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFGV+ +VF        V   + +      M++YCE   +S QG  VSI++CF + EV +E+R+ WL
Sbjct:   15 LQVFSWSSAQQMDPEVGLTAQEQVLL-----------LYDIKLQCL----QNISEHNPADEVCAPGWDGLICWPQGSLGTITKVPCPSYVYDFNHNGYAYRKCDVNGSWVSVENRTWVNYSECLWFLTPGKERGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDRVVYANGGVQQYDAMLMDDINTVSIGPLDKTQYVGCKITVLLFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKY-LWGFTLIGWGVPALFVSAWAVVRATLADARCWELSAGNIK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVF--------VGMPHTFTGLGWEMRMYCELFFNSFQGFFVSIIYCFCNGEVQTEMRKMWL 424          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Cavefish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 147.517 bits (371), Expect = 2.974e-38
Identity = 118/378 (31.22%), Postives = 189/378 (50.00%), Query Frame = 2
Query:  287 NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGC----RPKTDKEKMH-YKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLN-SYEKKSERYYNLII-------------------CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR-WL 1333
            +E C   WD + CWP  S G++   PCP+Y+  F  +G A ++C   G W   +  +W NYS C     P  ++ K   ++ +  +  +GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRAI  ++     Y     + Y+ ++                   C++      Y +  N   + VE  YLH+++F   F+ S + LW + +  W +PA+    W +VR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFGV+ +VF        V   + +      M++YCE   +S QG  VSI++CF + EV +E+R+ WL
Sbjct:   53 DEVCAPGWDGLICWPQGSLGTITKVPCPSYVYDFNHNGYAYRKCDVNGSWVSVENRTWVNYSECLWFLTPGKERGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDRVVYANGGVQQYDAMLMDDINTVSIGPLDKTQYVGCKITVLLFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKY-LWGFTLIGWGVPALFVSAWAVVRATLADARCWELSAGNIK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVF--------VGMPHTFTGLGWEMRMYCELFFNSFQGFFVSIIYCFCNGEVQTEMRKMWL 418          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Cavefish
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:103034973])

HSP 1 Score: 144.05 bits (362), Expect = 6.161e-37
Identity = 125/417 (29.98%), Postives = 206/417 (49.40%), Query Frame = 2
Query:  197 PRVIQDKRI-KEEQIKCFHLMNESINDQQTIN------ETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI--SWTNYSGC--RPKTDKEK-MHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEK-KSERYYNLIICRVIKTAQN-----------YAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVM----KLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            P+   D  I  EEQ++   L++  +   QT++      + CP  WD + CWP    G+L   PCP YI  F   G A ++C S   W + + +  +W NY+ C   P  ++E+ + ++ +  +  +GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRA+  ++          L  ++      + N +    + T+Q            Y +  N   + VE  YLH+++F   F      LW + +  W +PA+    W IVR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFGV+ +VF+ +             +T+E +    ++YCE   +S QG  VSI++CF + EV +EI++
Sbjct:   11 PQAGSDGEITAEEQVQM--LLDARLQCLQTVSSHDLAVDECPAEWDGLICWPRGYPGTLAKVPCPRYIYDFNHAGHAYRRCDSNSSWLLGESLNKTWANYTECIKSPGPNRERQVFFERLHIMYTVGYAVSFGSLLVAILIIGYFRRLHCTRNYIHMHLFVSFMLRAVSIFVKDRVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFM-AFLSDTKYLWGFTLIGWGVPAVFVATWAIVRATVADSRCWELSAGNIK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMP------------HTIEGLGWEVRMYCELFFNSFQGFFVSIIYCFCNGEVQTEIKK 409          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Cavefish
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:103034973])

HSP 1 Score: 141.739 bits (356), Expect = 4.272e-36
Identity = 122/406 (30.05%), Postives = 202/406 (49.75%), Query Frame = 2
Query:  227 EEQIKCFHLMNESINDQQTIN------ETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI--SWTNYSGC--RPKTDKEK-MHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYL---------TLNSYEK-KSERYYNLIICRVIKTAQN-----------YAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVM----KLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            EEQ++   L++  +   QT++      + CP  WD + CWP    G+L   PCP YI  F   G A ++C S   W + + +  +W NY+ C   P  ++E+ + ++ +  +  +GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRA+  ++          L  ++      + N +    + T+Q            Y +  N   + VE  YLH+++F   F      LW + +  W +PA+    W IVR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFGV+ +VF+ +             +T+E +    ++YCE   +S QG  VSI++CF + EV +EI++
Sbjct:   32 EEQVQM--LLDARLQCLQTVSSHDLAVDECPAEWDGLICWPRGYPGTLAKVPCPRYIYDFNHAGHAYRRCDSNSSWLLGESLNKTWANYTECIKSPGPNRERQVFFERLHIMYTVGYAVSFGSLLVAILIIGYFRRLHCTRNYIHMHLFVSFMLRAVSIFVKDRVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFM-AFLSDTKYLWGFTLIGWGVPAVFVATWAIVRATVADSRCWELSAGNIK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMP------------HTIEGLGWEVRMYCELFFNSFQGFFVSIIYCFCNGEVQTEIKK 419          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Cavefish
Match: gcgra (glucagon receptor [Source:NCBI gene;Acc:103044520])

HSP 1 Score: 139.428 bits (350), Expect = 1.804e-35
Identity = 127/413 (30.75%), Postives = 211/413 (51.09%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKV--DGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKM---HYKTI----QAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--------AILYYLTLN-----------SYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEI----RRWLFR-------RFNYTPNTFRMQSSYLHQRNPKRQLP 1417
            C  ++D   CWP     + V  PCP Y+   +    G+   +C + G+W  +K     N S C    D ++M   HY  I    + +  +GY++S+ +LVLA  I + FR+L+C RN +H++LF SF+LR        A+L   +LN            +  K+E     I CR       Y+IIAN+  + VE  YLHN+L     T  G+ L  Y+   W  P I  + W+IV+  ++N  CW+ + +     +W+I+   +   L N  +F+++++ + SK+ A  M    ++ R+A S   L+ + G++ ++F    +VT  +T+N  +  L + KL+ +   +S QGLLV+IL+CF+++EV SEI    +RW          R  Y+ NT ++ +S L Q   K +LP
Sbjct:   54 CNRTFDKYACWPDGLPNTTVSVPCPWYLPWHRTVRQGLVYLECDADGQWAKKK-----NTSECE-HNDPDQMDTQHYGRILSKFRTMYTVGYSLSLGALVLALGILVAFRKLHCMRNNIHMNLFASFILRAASILIKDALLERPSLNIDPGITTEMEMEWLVKNEVSQTAIGCRTAVVMMQYSIIANSYWLLVEGIYLHNLLAVTVLT-EGNYLSIYLCIGWGAPLIFVLPWIIVKYLYENEECWEQNIN--MEYWWIIRSPILLAVLINFFIFIHIIKILVSKLRAHQMRYNDYKCRLAKSTLTLIPLLGIHLVLF---SLVTDESTSNGAM-PLRLTKLFIDLFFNSFQGLLVAILYCFVNKEVQSEILKRWKRWKLGKDIEEEYRHTYS-NTAQVTNSMLIQAPAKSRLP 452          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 140.584 bits (353), Expect = 3.689e-37
Identity = 124/405 (30.62%), Postives = 191/405 (47.16%), Query Frame = 2
Query:  209 QDKRIKEEQIKCFHLMNESINDQQTINET--------CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGIS-WTNYSGCRP-------KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRA--------ILYY-----LTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
             D   KEEQ+  F L     + ++TI+ T        C   WD + CWP    GS+V   CP+YI  F   G A ++C S G W +      W NYS C           +KE +H  +I  +  IGY+VS+ SL +A  I   FRRL+C RN +H+ LFVSF+LRA        +LY      L        +E  +    CRV+ T   Y +  +   V VE  YL++++F  TF+ SG RLW + +  W  P +   +W   R    N  CWD      K   W+ Q   +     N +LF+N++R + +K+          R   R++  S  VL+ +FGV+ ++F  +     +    +       +++Y E   +S QG  V+I++CF + EV  E+++
Sbjct:   13 DDVITKEEQM--FMLTEAKTHCEKTIHSTNASSADTHCTAEWDGLICWPWGLPGSMVREKCPSYIYDFNAHGHAYRKCESNGTWKMSTANRLWANYSECTEFLNPHVQAKEKESIHRLSI--LYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAASIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFL-TFSASG-RLWTFALIGWGFPVVFVFVWAAARATLANSQCWDLSAGWLK---WIYQAPILAAVAVNFVLFVNIVRVLATKLRETNAARQESRQQYRKLLKSTLVLMPLFGVHYVLFAAMPYTDVIGLAWQ-------IQMYYEMTFNSFQGFFVAIIYCFCNGEVRGEMKK 401          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 7.692e-28
Identity = 92/349 (26.36%), Postives = 162/349 (46.42%), Query Frame = 2
Query:  296 CPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGI--SWTNYSGCRPKT-DKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLII-CRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRW 1330
            C  +WD   CW  T +G +    CP+Y   F +    +K C + G+WF       +W+NY+ C   T DK KM       +   G+ VSI+ L+++  IF  F+ L+C+R  +H +LF+S++L +I+  + L +     E   +  + C+V++    Y +  N   +  E  YLH ++    F    H  WYY++          +  V   I +D+  CW +         ++I    +   L N+   LN++R + +K+      E +   +   +  +LV + G+   V +P      V     YI     M+++  HLI   QG LV+ +FCF + EV + ++R+
Sbjct:   41 CNRTWDGWLCWGDTMAGDVAVQHCPDYFPDFDLQEKVTKICNTDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFY-LAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKPVWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLFWYYLLGWGFPIVPALMHAVARTIYYDD-NCWISSA---THLLYIIHGPVVAALLVNLFFLLNIVRVLVTKLKVTHRAETSMYMKAVRATLILVPLLGI-QFVLVPWKPERFVGEIYDYI-----MQIFPTHLI---QGFLVATIFCFCNGEVQAALKRY 375          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009958.1 (pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 gene:ENSPMAG00000008983.1 transcript:ENSPMAT00000009958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 2.053e-27
Identity = 101/345 (29.28%), Postives = 168/345 (48.70%), Query Frame = 2
Query:  323 CWPTTSSGSLVFAPCPNYIDGFKVDGVAS--KQCLSTGKWFVRKGISWTNYSGCRP--KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIR----RWL 1333
            CWP++ +  +V  PCP+  +G + D   S  ++C++   W  R     +NYS C     + +   HYK    +  +G+ VS+++L+ A  IF C R + C RN +H +L  +F+LR   ++L         ER  N   C +I T  NY  + N   +FVE  YLH  +   T++    R W +I   W++PA I IIW +V++ F++  CW     P K   ++ Q   I + L N +   N++  + +K+ A    E    R+   +  VL+ + G+  ++F        ++         +V+ LY    + S QG  VS+ +CF++ EV S IR    RWL
Sbjct:   23 CWPSSEASRVVIRPCPDRFNGVQYDTSKSVYRECMADATWARR-----SNYSLCEAIILSKRNSQHYKVALVVNYLGHCVSLLALMTAFTIFWCLRSIRCLRNAIHWNLMTTFILRNATWFLLQLIDLSTQER--NEPWCCIIITIFNYFQVTNFFWMFVEGCYLHTAIVM-TYSTDKLRKWIFICIGWVIPAPIIIIWAMVKLHFEDEKCW-FGKTPGKYIDYIYQGPIILVLLINFIFLFNIVTILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEIS---------QVIFLYVNSFLMSFQGFFVSVFYCFLNGEVRSAIRKRWHRWL 349          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.037e-26
Identity = 104/360 (28.89%), Postives = 175/360 (48.61%), Query Frame = 2
Query:  323 CWPTTSSGSLVFAPCPNYIDGFKVDGVAS--KQCLSTGKWFVRKGISWTNYSGCRPKTDKEK---MHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHE-LTFRRRIAHSISVLVIVFGV-YNLVFI-PIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRRFNYTPNTFRMQS 1378
            CWP + +G  V  PCP   +G + D   S  ++CL+ G W  R     +NYS C+P  D +K    HYK    +  +G+ +S+ +L+ A   F   R + C RN +H  L  +F+LR   + L         ER  N   CRV+ T  NY  + N   +FVE  YLH  +   T++    R   ++   W +PA I I+W +V++ +++  CW    +    D+ + Q   I + L N +   N++R + +K+ A    E + + R+   +  VL+ + G+ Y L F+ P +   S           +V+ +Y    + S QG  VS+ +CF++ EV S +R    +R+N   +  R+Q+
Sbjct:   52 CWPESEAGRTVATPCPERFNGVRYDSSKSVIRECLANGTWAQR-----SNYSLCKPIIDAKKPNSQHYKIALIVNYLGHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWLLLQIIDLSTQER--NEPWCRVVITVFNYFQVTNFFWMFVEGCYLHTAIV-MTYSTDKLRKSIFVCIGWCIPAPIIIVWAMVKLFYEDEKCWFGKTEGKYIDY-IYQGPIILVLLVNFIFLFNIVRILMTKLRASTTSETIQYSRKAVKATLVLLPLLGITYMLFFVNPGEDPVS-----------QVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALR----KRWNRWMDNHRLQA 387          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003797.1 (pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 gene:ENSPMAG00000003461.1 transcript:ENSPMAT00000003797.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 4.538e-23
Identity = 57/187 (30.48%), Postives = 97/187 (51.87%), Query Frame = 2
Query:  323 CWPTTSSGSLVFAPCPNYIDG--FKVDGVASKQCLSTGKWFVRKGISWTNYSGCRP-----KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYY 862
            CWP+T  G +V  PCP + +G  +++     ++CL  G W +      +NYS C+P     +   E  HY+    I  +G+ +S+ +LV+A  +F+  R + C RN +H +L  +F+LR  ++Y TL   + +++   N   CRV+ T  NY  + N   +F E  YLH  +   T++    R W +
Sbjct:   54 CWPSTPVGQVVSRPCPEFFNGVRYEIHRTVYRECLENGTWALI-----SNYSECKPIVENKEVQTESFHYEVALIINYLGHCISLAALVIAFLLFMGLRSIRCLRNIIHWNLISTFILRNSMFY-TLQLIDFRTQE-ANEPWCRVVSTIYNYFHVTNFFWMFGEGCYLHTAIVM-TYSTDKLRKWVF 232          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Medaka
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:101167084])

HSP 1 Score: 145.591 bits (366), Expect = 2.254e-37
Identity = 128/398 (32.16%), Postives = 196/398 (49.25%), Query Frame = 2
Query:  227 EEQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKW-FVRK-GISWTNYSGC----RPKTDKEKMH--YKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAI-------LYYLTLNSYEKKSERYYNL-------------IICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRR 1327
            E +I+C+   N S  +  T +E CP  WD + CWP  S G +   PCP+YI  F   G A ++C   G W FV +   +WTNYS C    +P  D+E     ++ +  +   GYAVS  SL++A  I   FRRL+C RN +H+ LFVSF+LRA+       + Y +    +  S    NL             I C++      Y +  N   + VE  YLH+++F   F      LW +I   W +PA+   IW IVR    +  CW+      K   W+ QV  +T    N +LF+N++R + +K+          R   R++A S  VLV+VFG++ ++F        V   + +      M++Y E   +S QG  VSI++C+ + EV +EI++
Sbjct:   53 EVKIQCYQ--NLSSMEPTTTDEVCPPDWDGLICWPHGSPGQVTEVPCPSYIYDFNHKGHAYRKCDVNGSWVFVEQWNKTWTNYSECLSFLQPFKDEEARQDFFERLYVMYTTGYAVSFSSLLVAIMIIGYFRRLHCTRNYIHMHLFVSFMLRAVSIFVKDKVVYSSAGLQDFDSALLDNLKTVSIASVDKSHYIGCKMTVVLFIYFLATNYYWILVEGLYLHSLIF-MAFRSDSKYLWGFIFIGWGVPAVFVAIWAIVRATLADARCWELSAGNVK---WIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGIHYIIF--------VGMPHTFQGPSWEMRMYFELFFNSFQGFFVSIIYCYCNGEVQTEIKK 436          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Medaka
Match: pth1r (parathyroid hormone 1 receptor [Source:NCBI gene;Acc:101155466])

HSP 1 Score: 139.813 bits (351), Expect = 1.845e-35
Identity = 130/415 (31.33%), Postives = 196/415 (47.23%), Query Frame = 2
Query:  209 QDKRIKEEQIKCF----HLMNESINDQQTI-NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWF-VRKGISWTNYSGCRP-----KTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYY-----LTLNSYEKKSERYY----------------NLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVF--IPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRR 1342
             D   KEEQI       H    +I  +  I N  C   WD I CWP    G LV   CP YI  F   G+A ++C + G W       +W NY+ C           EK  +  +  I  +GY+VS+ SL++A  I   FRRL+C RN +H+ LFVS++LRAI  +     L   S  +  ER                    I C+V+ T   Y +  N   + VE  YLH+++F  TF      LW + +  W +PA+   IW  VR  F +  CWD      K   W+ QV  +   + N +LFLN++R + +K+          R   R++  S  VL+ +FGV+ ++F  +P   V+ +           +++++ E L +S QG LV+I++CF + EV +EI++   RR
Sbjct:   27 DDVLTKEEQITQLVIAKHTCENNIASRSKIPNGFCSAEWDGIVCWPEGPPGKLVSTACPEYIYDFNHKGLAYRRCDNNGTWEQASANKTWANYNECAKFLYHYNHSHEKEVFHRLYLIYTVGYSVSLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSYMLRAISIFVKDVVLYSESPLENMERVTLDDLKSITIAPPVNKTQFIACKVVVTLFMYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAVFVSIWATVRATFADTECWDLSAGNLK---WIYQVPILMAVVVNFILFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIIFNAMPYTEVSGIPW---------LIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIKKSWNRR 428          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Medaka
Match: pth3r (parathyroid hormone/parathyroid hormone-related peptide receptor [Source:NCBI gene;Acc:101173747])

HSP 1 Score: 139.813 bits (351), Expect = 2.335e-35
Identity = 122/382 (31.94%), Postives = 191/382 (50.00%), Query Frame = 2
Query:  263 SINDQQTI--NETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKW--FVRKGISWTNYSGC------RPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRA--------ILYYLTLNS-YEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFR---RRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRR 1342
            SI  Q  I     C   WD I CWP + +G LV  PCP YI  F   G A +QC  TG W        +W NY+ C        ++ +EK+ +K +  +  +GY++S+ SL++A +I   F+RL+C RN +H+ LF SF+ RA        +LY +T +S  E  +ER Y    C+   T   Y +  N+  +  E  YLH+++F    +   + LW   I  W +PA+   +WV  R    +  CWD      K   W+ QV  +     N LLF+N++R + SK+      +L  R   R++  S  VL+ +FGV+ +VF+ I   T V         L  ++++ E   +S QG  V+ ++CF + EV +E+++   RR
Sbjct:   48 SIQTQTAIIKEGDCVPEWDGIICWPQSRAGQLVSVPCPEYIYDFNHRGRAYRQCDVTGNWELVTSNNHTWANYTECTRYLTSNHRSLQEKV-FKRLHLMYTVGYSISLSSLLVAVSILCYFKRLHCTRNYIHIHLFTSFICRAVSIFVKDSVLYSITDDSKAEFPAERQYT-AGCKAAVTFFLYFLATNHYWILAEGLYLHSLIFMALLSDKNY-LWVLTIMGWGIPAVFVSVWVSARASLADTQCWDISAGNLK---WIYQVPILAGIFVNFLLFINIIRVLASKLWETNTGKLNPRQQYRKLLRSTLVLMPLFGVHYIVFMAIP-YTEVN------GLLWQVQMHYEMFFNSSQGFFVAFIYCFCNGEVQAEVKKAWLRR 416          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Medaka
Match: ENSORLT00000005607.2 (vasoactive intestinal polypeptide receptor [Source:NCBI gene;Acc:101169670])

HSP 1 Score: 137.117 bits (344), Expect = 5.461e-35
Identity = 105/396 (26.52%), Postives = 196/396 (49.49%), Query Frame = 2
Query:  215 KRIKEEQIKCFH--LMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNY-----SGC--------RPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYY------LTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSK--MIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEI-RRW 1330
            K +KEE+  C    L ++S+   + I+  C   WD + CWP    G  V   CP +   F  +G   + C + G         WT         C          ++    +++ +++ +  +GYA+S+ISL +A AI   FR+L+C RN +H+ LF+SF+L+AI  +       + N+Y   S      + C+ +    NY I+AN + + VE  +L  ++    F++  H +WY +++  +   +I          +++  CW+T    ++   W+++V  +     N++ FL ++R + SK  M     +E +  +++  S   LV VFG++ +VF+ + +  S        +++  +K++ E ++SS QGL+V+ L+CF++ EV  E  RRW
Sbjct:   27 KLVKEEE-DCMRNLLFHKSLKSTENISVQCSGMWDNLTCWPAAPLGETVSKLCPEF---FHSEGKVQRNCTANG---------WTELFIPYEDACVFNVTLHFLNESPDTHLYFSSVRTVYTVGYALSLISLAIAIAILCLFRKLHCTRNYIHIQLFISFILKAIFIFARDTLLFSENTYHCNSYP----VGCKFVPIFSNYCILANYSWLLVEGHFLFTLVSRSFFSLKKHLIWYIVLSWGLPLIVIVAWSCARYF-YEDEGCWET--GSHEWILWILRVPVLLSICTNLIFFLGILRVLVSKLRMPDARRNEFSQYKKLIKSTFFLVAVFGLHYMVFVFLRVEAS--------SSMSKIKMFAELVLSSTQGLMVATLYCFMNGEVQQEFKRRW 394          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Medaka
Match: ENSORLT00000023741.2 (vasoactive intestinal polypeptide receptor 2 [Source:NCBI gene;Acc:101170814])

HSP 1 Score: 135.961 bits (341), Expect = 1.253e-34
Identity = 108/365 (29.59%), Postives = 190/365 (52.05%), Query Frame = 2
Query:  278 QTINETCPISWDFIRCWPTTSSGSLVFAPCPN-YIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLR--AILYYLTLNSYEKKS---ERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFY-HTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDF--WVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFI----PIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWL 1333
            QT    CP  W+ + CWP  + G ++  PCP+ ++  F+  G  S+ C   G   V   I    YS    +  K+ + YK ++ +  +G+++S+I+L+ +  +   FRRL+C RN +HV+LFVSF+LR  A+L   TL   E ++       +L+ C+      NY ++AN   + VE  YLH +L   HT++    RL  Y+   W +P +  + W+I R+  ++  CW+ +D+P       W I    I   +  + +   L++ +    +    ++ +  RR+A S  +L+ +FGV+ +VF     P D +            L+ +K++ +  + S QGL+V++L+CF++ EV SE+RR L
Sbjct:   48 QTAAAGCPGEWNNVSCWPNAAVGEVLTLPCPSPFLLFFEKKGNLSRNCTEKGWSSVYPDIRSACYSEITDQ-PKQLVFYKVVRVLSTVGHSLSLIALLTSTTLICLFRRLHCTRNYIHVNLFVSFMLRAVAVLAKDTLLFSEDEATDCSTQPSLVGCKATLVFFNYFVMANFFWLLVEGLYLHTLLLVIHTYST---RLSIYMFIGWGIPFVFVVAWIISRVNLEDTSCWEINDNPVPDRLINWPIMASIIINFILFISIIRVLVQKLRCSEVGG--NDQSQYRRLAKSTLLLIPLFGVHYVVFFYLMEPDDQI------------LKQIKIFFDLGLGSFQGLIVAVLYCFLNSEVQSELRRSL 394          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Planmine SMEST
Match: SMESG000056335.1 (SMESG000056335.1)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 458/464 (98.71%), Postives = 460/464 (99.14%), Query Frame = 2
Query:   80 MSFGVLIIFHLFLLSWKVSPQLNSQIKIISVAGVRIHRVPRVIQDKRIKEEQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTVNGGIQNENLLK 1471
            MSFGVL IFHLFLLSWKVSPQLNSQIKIISVAGVRIHRVPRVIQDKRIKEEQIKCFHLMNESIND QTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASK+ LSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYIITAW+LPAIITIIWVIVRIEFDNLFCWDTHDDPYKRDFWVIQVYTITLTLGNVLLFLNLMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTVNG IQNENLLK
Sbjct:    1 MSFGVLFIFHLFLLSWKVSPQLNSQIKIISVAGVRIHRVPRVIQDKRIKEEQIKCFHLMNESINDHQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKEFLSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYIITAWVLPAIITIIWVIVRIEFDNLFCWDTHDDPYKRDFWVIQVYTITLTLGNVLLFLNLMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSCSTVNGVIQNENLLK 464          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 290.041 bits (741), Expect = 4.582e-93
Identity = 169/393 (43.00%), Postives = 253/393 (64.38%), Query Frame = 2
Query:  167 SVAGVRIHRVPRVIQDKRIKEEQIKCFHLM---NESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKM-HYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWL 1333
             +  VRI+++P+  Q + I EE IKC   M   N S+ D  TIN  CP+SWD I CWP T +G LV + CPNY+D F+++G  +K+C + G W+++  ++WTNYS C+ K D      ++ I+ IGQ+GYA+SI+SLV+A  I   FRRL C RN +H++LF +F  RAI +YLT  S+ +  + Y     CR ++   NY   A+   +F EA Y+HN++FYHTF  S      YI+  W++P  +  IW ++R +F+N++CWD  +D + RDFW +  Y I LTL N ++F+ L  S+ SKM +    E    +++A SI +LVIVFGVYN+VF+P++I+ ++A  N      E++KLY  H+ +SCQG LVS+L CF++ EVH EI+R++
Sbjct:    5 DIYSVRIYQIPQDKQMESIIEEHIKCLGRMSFLNYSL-DIVTINSKCPVSWDGIMCWPETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVTWTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLT--SFLQTEKIY-----CRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSHISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIA-DNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFI 388          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 290.041 bits (741), Expect = 6.155e-93
Identity = 169/393 (43.00%), Postives = 253/393 (64.38%), Query Frame = 2
Query:  167 SVAGVRIHRVPRVIQDKRIKEEQIKCFHLM---NESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKM-HYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWL 1333
             +  VRI+++P+  Q + I EE IKC   M   N S+ D  TIN  CP+SWD I CWP T +G LV + CPNY+D F+++G  +K+C + G W+++  ++WTNYS C+ K D      ++ I+ IGQ+GYA+SI+SLV+A  I   FRRL C RN +H++LF +F  RAI +YLT  S+ +  + Y     CR ++   NY   A+   +F EA Y+HN++FYHTF  S      YI+  W++P  +  IW ++R +F+N++CWD  +D + RDFW +  Y I LTL N ++F+ L  S+ SKM +    E    +++A SI +LVIVFGVYN+VF+P++I+ ++A  N      E++KLY  H+ +SCQG LVS+L CF++ EVH EI+R++
Sbjct:   16 DIYSVRIYQIPQDKQMESIIEEHIKCLGRMSFLNYSL-DIVTINSKCPVSWDGIMCWPETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVTWTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLT--SFLQTEKIY-----CRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSHISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIA-DNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFI 399          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 290.426 bits (742), Expect = 6.564e-93
Identity = 169/393 (43.00%), Postives = 253/393 (64.38%), Query Frame = 2
Query:  167 SVAGVRIHRVPRVIQDKRIKEEQIKCFHLM---NESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKM-HYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWL 1333
             +  VRI+++P+  Q + I EE IKC   M   N S+ D  TIN  CP+SWD I CWP T +G LV + CPNY+D F+++G  +K+C + G W+++  ++WTNYS C+ K D      ++ I+ IGQ+GYA+SI+SLV+A  I   FRRL C RN +H++LF +F  RAI +YLT  S+ +  + Y     CR ++   NY   A+   +F EA Y+HN++FYHTF  S      YI+  W++P  +  IW ++R +F+N++CWD  +D + RDFW +  Y I LTL N ++F+ L  S+ SKM +    E    +++A SI +LVIVFGVYN+VF+P++I+ ++A  N      E++KLY  H+ +SCQG LVS+L CF++ EVH EI+R++
Sbjct:   24 DIYSVRIYQIPQDKQMESIIEEHIKCLGRMSFLNYSL-DIVTINSKCPVSWDGIMCWPETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVTWTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLT--SFLQTEKIY-----CRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSHISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIA-DNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFI 407          
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 290.041 bits (741), Expect = 7.328e-93
Identity = 169/393 (43.00%), Postives = 253/393 (64.38%), Query Frame = 2
Query:  167 SVAGVRIHRVPRVIQDKRIKEEQIKCFHLM---NESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYIDGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKM-HYKTIQAIGQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLTLNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHTFTVSGHRLWYYXXXXXXXXXXXXXXXXXXXXEFDNLFCWDTHDDPYKRDFWVIQVYTIXXXXXXXXXXXXXMRSIYSKMIAQPMHELTFRRRIAHSISVLVIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVSILFCFIHREVHSEIRRWL 1333
             +  VRI+++P+  Q + I EE IKC   M   N S+ D  TIN  CP+SWD I CWP T +G LV + CPNY+D F+++G  +K+C + G W+++  ++WTNYS C+ K D      ++ I+ IGQ+GYA+SI+SLV+A  I   FRRL C RN +H++LF +F  RAI +YLT  S+ +  + Y     CR ++   NY   A+   +F EA Y+HN++FYHTF  S      YI+  W++P  +  IW ++R +F+N++CWD  +D + RDFW +  Y I LTL N ++F+ L  S+ SKM +    E    +++A SI +LVIVFGVYN+VF+P++I+ ++A  N      E++KLY  H+ +SCQG LVS+L CF++ EVH EI+R++
Sbjct:   15 DIYSVRIYQIPQDKQMESIIEEHIKCLGRMSFLNYSL-DIVTINSKCPVSWDGIMCWPETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVTWTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLT--SFLQTEKIY-----CRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSHISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIA-DNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFI 398          
The following BLAST results are available for this feature:
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTH1R2.308e-3631.62parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R8.937e-3631.74parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R8.937e-3631.74parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R8.937e-3631.74parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R8.937e-3631.74parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-15.044e-1525.20Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-15.044e-1525.20Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-16.660e-1525.20Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-16.660e-1525.20Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-16.660e-1525.20Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hec1.568e-1926.39gene:FBgn0030437 transcript:FBtr0343652[more]
hec1.568e-1926.39gene:FBgn0030437 transcript:FBtr0073753[more]
Pdfr2.011e-1822.67gene:FBgn0260753 transcript:FBtr0070436[more]
Pdfr2.667e-1822.67gene:FBgn0260753 transcript:FBtr0340084[more]
Pdfr2.667e-1822.67gene:FBgn0260753 transcript:FBtr0340085[more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth2rb1.124e-4131.54parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
pth2rb4.641e-4131.54parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
pth1r1.266e-3330.79parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r1.467e-3330.70parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth3r5.264e-3330.81parathyroid hormone 3 receptor [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sstr59.931e-3629.50somatostatin receptor 5 [Source:Xenbase;Acc:XB-GEN... [more]
sstr53.467e-3429.43somatostatin receptor 5 [Source:Xenbase;Acc:XB-GEN... [more]
slc17a94.425e-3429.53solute carrier family 17 member 9 [Source:Xenbase;... [more]
slc17a95.321e-3429.53solute carrier family 17 member 9 [Source:Xenbase;... [more]
slc17a95.613e-3429.53solute carrier family 17 member 9 [Source:Xenbase;... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pth1r1.004e-3732.20parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Pth1r1.004e-3732.20parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Pth1r1.004e-3732.20parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Adcyap1r12.021e-3627.98adenylate cyclase activating polypeptide 1 recepto... [more]
Adcyap1r11.941e-3326.70adenylate cyclase activating polypeptide 1 recepto... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25961|PTH1R_RAT7.021e-3732.20Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|P41593|PTH1R_MOUSE7.021e-3732.20Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|P50133|PTH1R_PIG8.794e-3632.40Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|Q9TU31|PTH1R_CANLF2.725e-3531.82Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|P25107|PTH1R_DIDVI3.363e-3529.77Parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6MKS49.574e-4932.85Uncharacterized protein OS=Graphocephala atropunct... [more]
R7UVQ31.816e-4832.43Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2T7PB552.020e-4832.84Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A023F6565.838e-4833.24Putative adenylate cyclase-coupled calcitonin rece... [more]
A0A154PCD41.058e-4731.76Parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth2rb1.228e-3928.60parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
pth2rb2.974e-3831.22parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
pth2ra6.161e-3729.98parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
pth2ra4.272e-3630.05parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
gcgra1.804e-3530.75glucagon receptor [Source:NCBI gene;Acc:103044520][more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r3.689e-3730.62parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000000542.17.692e-2826.36pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000009958.12.053e-2729.28pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 ... [more]
ENSPMAT00000004899.11.037e-2628.89pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000003797.14.538e-2330.48pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 g... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth2ra2.254e-3732.16parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
pth1r1.845e-3531.33parathyroid hormone 1 receptor [Source:NCBI gene;A... [more]
pth3r2.335e-3531.94parathyroid hormone/parathyroid hormone-related pe... [more]
ENSORLT00000005607.25.461e-3526.52vasoactive intestinal polypeptide receptor [Source... [more]
ENSORLT00000023741.21.253e-3429.59vasoactive intestinal polypeptide receptor 2 [Sour... [more]
back to top
BLAST of Parathyroid hormone/parathyroid hormone-related peptide receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056335.10.000e+098.71SMESG000056335.1[more]
SMESG000047057.14.582e-9343.00SMESG000047057.1[more]
SMESG000047057.16.155e-9343.00SMESG000047057.1[more]
SMESG000047057.16.564e-9343.00SMESG000047057.1[more]
SMESG000047057.17.328e-9343.00SMESG000047057.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027851 ID=SMED30027851|Name=Parathyroid hormone/parathyroid hormone-related peptide receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1524bp
AAATGTGATTGGTTAAAAAATTAATTTTAACACAAAATTAGTAAATACTG
ATTAATTTCAATAATAGTTTTTAATATTCATGTCTTTTGGAGTTTTAATC
ATATTTCATCTATTTTTGTTATCTTGGAAGGTGTCTCCTCAGTTAAATTC
ACAGATCAAAATAATATCAGTAGCCGGTGTTCGAATTCACAGAGTTCCTC
GTGTCATACAGGATAAGAGAATCAAAGAAGAACAAATCAAATGTTTTCAC
TTAATGAATGAATCCATAAATGACCAACAAACAATAAATGAAACCTGTCC
AATTTCATGGGATTTTATCCGTTGTTGGCCAACTACTTCTTCAGGGAGTC
TCGTATTTGCTCCTTGCCCGAATTACATTGATGGCTTCAAAGTTGATGGA
GTAGCTTCGAAACAATGTTTAAGTACTGGAAAATGGTTTGTTAGAAAGGG
AATTTCTTGGACAAATTACTCTGGTTGCCGCCCGAAGACTGATAAAGAAA
AGATGCATTATAAAACAATTCAAGCGATTGGACAAATTGGATATGCAGTT
TCAATTATATCTCTGGTTTTGGCAGCAGCTATTTTTTTATGTTTCCGCCG
GCTTAATTGCGAAAGAAACAAAATGCATGTCAGTTTATTTGTCAGTTTTC
TTTTGAGAGCAATTCTCTATTATTTGACTTTGAATAGCTATGAAAAGAAG
AGTGAACGATATTACAACTTAATTATTTGTCGAGTCATTAAAACTGCTCA
GAATTATGCTATAATTGCTAACAACACATGCGTATTTGTAGAAGCTGCGT
ATTTACATAATATTTTGTTTTATCACACCTTTACTGTTTCCGGCCATCGA
TTGTGGTATTATATAATAACAGCTTGGATATTGCCAGCAATTATTACAAT
CATTTGGGTAATTGTTAGGATAGAATTCGATAATTTATTTTGTTGGGATA
CTCACGATGACCCTTATAAACGAGATTTTTGGGTCATTCAAGTGTACACA
ATTACGCTAACTTTGGGCAATGTTCTTTTATTTCTCAACTTAATGAGATC
AATTTATTCGAAAATGATTGCCCAGCCAATGCATGAATTAACGTTTAGAA
GAAGAATTGCACATTCAATAAGTGTTTTGGTAATAGTATTTGGAGTGTAC
AATTTAGTTTTCATTCCAATAGACATTGTGACCTCTGTGGCCACGACAAA
TAGATATATCAACACTTTGGAAGTAATGAAATTATACTGTGAGCATTTGA
TAAGTTCTTGTCAAGGTCTTCTTGTCAGCATTTTATTTTGTTTTATTCAC
CGTGAAGTACATTCAGAAATTCGACGATGGCTATTCAGAAGATTTAACTA
TACTCCAAATACGTTTAGAATGCAGTCTTCGTATTTGCATCAAAGGAACC
CGAAAAGACAACTTCCTGTGACATCATGTTCAACTGTAAATGGAGGAATT
CAAAACGAAAACTTACTTAAATAATTAATATTTTTGATTGAAAACGTGAC
TGTCCAATGTGTACCAATTTGTAC
back to top

protein sequence of SMED30027851-orf-1

>SMED30027851-orf-1 ID=SMED30027851-orf-1|Name=SMED30027851-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MSFGVLIIFHLFLLSWKVSPQLNSQIKIISVAGVRIHRVPRVIQDKRIKE
EQIKCFHLMNESINDQQTINETCPISWDFIRCWPTTSSGSLVFAPCPNYI
DGFKVDGVASKQCLSTGKWFVRKGISWTNYSGCRPKTDKEKMHYKTIQAI
GQIGYAVSIISLVLAAAIFLCFRRLNCERNKMHVSLFVSFLLRAILYYLT
LNSYEKKSERYYNLIICRVIKTAQNYAIIANNTCVFVEAAYLHNILFYHT
FTVSGHRLWYYIITAWILPAIITIIWVIVRIEFDNLFCWDTHDDPYKRDF
WVIQVYTITLTLGNVLLFLNLMRSIYSKMIAQPMHELTFRRRIAHSISVL
VIVFGVYNLVFIPIDIVTSVATTNRYINTLEVMKLYCEHLISSCQGLLVS
ILFCFIHREVHSEIRRWLFRRFNYTPNTFRMQSSYLHQRNPKRQLPVTSC
STVNGGIQNENLLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
IPR000832GPCR_2_secretin-like
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 156..180
score: 28.47
coord: 276..301
score: 24.12
coord: 233..258
score: 30.05
coord: 124..148
score: 37.36
coord: 194..217
score: 31.07
coord: 360..381
score: 40.83
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 120..374
e-value: 2.0E-42
score: 145.2
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 44..117
e-value: 6.1E-12
score: 55.7
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 46..109
e-value: 1.1E-11
score: 44.8
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 29..112
score: 17.614
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 7..111
e-value: 4.3E-20
score: 73.9
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 19..113
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 112..409
e-value: 1.1E-56
score: 194.0
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 21..414
NoneNo IPR availableCDDcd152737tmB1_NPR_B7_insect-likecoord: 122..395
e-value: 2.1692E-57
score: 188.733
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 128..404
NoneNo IPR availableTMHMMTMhelixcoord: 157..176
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
NoneNo IPR availableTMHMMTMhelixcoord: 360..382
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00649G_PROTEIN_RECEP_F2_1coord: 48..72
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 122..382
score: 27.503