SMED30027845

Overview
NameSMED30027845
Smed IDSMED30027845
Length (bp)3108
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027845 (SMED30027845) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027845 (SMED30027845) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027845 (SMED30027845) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027845 (SMED30027845) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Homology
BLAST of SMED30027845 vs. Ensembl Zebrafish
Match: BX548011.3 (pep chromosome:GRCz11:4:68562464:68565244:1 gene:ENSDARG00000113526.1 transcript:ENSDART00000192954.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX548011.3)

HSP 1 Score: 115.161 bits (287), Expect = 1.216e-27
Identity = 87/213 (40.85%), Postives = 106/213 (49.77%), Query Frame = -3
Query: 1541 RANPFTEGTDL---ICRLPLPTLF*DYRLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLPETLDDVSEIACVTTLCCRNNQISVFKFRNVNLIPFRFRRLLNQ*LDKLSINRRLSPPSDN*VTRSLRTD*PMFKYCSHGTLLHFSLQGSHLNNCYYYQDLYP*PLHSDSRQ*LLSNHG 2170
            R  P   G+DL   + RL +PT     RL TLETCCGY YG  R+L LLP+IFKG +   G  +N GAF  + P L +  F G +   K++   P                 R  ++    F ++N  PFR                RLS P  N V  SLRTD PMF  CSHGTLLHF LQ S LN CYY+QDL+P  LH   R  L  + G
Sbjct:   59 RLKPQNYGSDLPTSLTRL-VPT---RQRLFTLETCCGYGYGPARDLHLLPRIFKGRRELTGRRRNHGAFQGAGPSLGLNPFQGALPFTKKRELFPGLTPASPGSFASPHWAPRGARLRHSGFGDLNPTPFRS--------AGGDGGHRLSLP--NSVRPSLRTDSPMFICCSHGTLLHFGLQSSRLNICYYHQDLHPRLLHPGPRPRLPRHRG 257          
BLAST of SMED30027845 vs. Ensembl Zebrafish
Match: CT583728.14 (pep chromosome:GRCz11:4:55797866:55801210:-1 gene:ENSDARG00000112047.1 transcript:ENSDART00000186943.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT583728.14)

HSP 1 Score: 114.775 bits (286), Expect = 1.820e-27
Identity = 79/202 (39.11%), Postives = 97/202 (48.02%), Query Frame = -3
Query: 1541 TDLICRLPLPTLF*DYRLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLPETLDDVSEIACVTTLCCRNNQISVFKFRNVNLIPFRFRRLLNQ*LDKLSINRRLSPPSDN*VTRSLRTD*PMFKYCSHGTLLHFSLQGSHLNNCYYYQDLYP*PLHSDSRQ*LLSNHG 2146
            T L C +P        RL TLETCCGY YG  R+L LLP+IFKG +   G  +N GAF  + P L +  F G +   K++   P                 R  ++    F ++N  PFR              +    P   N V  SLRTD PMF  CSHGTLLHF LQ S LN CYY+QDL+P  LH   R  L  + G
Sbjct:   69 TSLTCLVPT-----RQRLFTLETCCGYGYGPARDLHLLPRIFKGRRELTGRRRNHGAFQGAGPSLGLNPFQGALPFTKKRELFPGLTPASPGSFASPHWAPRGARLRHSGFGDLNPTPFR----------SAGGDGGHRPSLPNSVRPSLRTDSPMFICCSHGTLLHFGLQSSRLNICYYHQDLHPRLLHPGPRPRLPRHRG 255          
BLAST of SMED30027845 vs. Ensembl Zebrafish
Match: CT583728.25 (pep chromosome:GRCz11:4:55781670:55785014:-1 gene:ENSDARG00000116179.1 transcript:ENSDART00000181348.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT583728.25)

HSP 1 Score: 114.775 bits (286), Expect = 1.820e-27
Identity = 79/202 (39.11%), Postives = 97/202 (48.02%), Query Frame = -3
Query: 1541 TDLICRLPLPTLF*DYRLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLPETLDDVSEIACVTTLCCRNNQISVFKFRNVNLIPFRFRRLLNQ*LDKLSINRRLSPPSDN*VTRSLRTD*PMFKYCSHGTLLHFSLQGSHLNNCYYYQDLYP*PLHSDSRQ*LLSNHG 2146
            T L C +P        RL TLETCCGY YG  R+L LLP+IFKG +   G  +N GAF  + P L +  F G +   K++   P                 R  ++    F ++N  PFR              +    P   N V  SLRTD PMF  CSHGTLLHF LQ S LN CYY+QDL+P  LH   R  L  + G
Sbjct:   69 TSLTCLVPT-----RQRLFTLETCCGYGYGPARDLHLLPRIFKGRRELTGRRRNHGAFQGAGPSLGLNPFQGALPFTKKRELFPGLTPASPGSFASPHWAPRGARLRHSGFGDLNPTPFR----------SAGGDGGHRPSLPNSVRPSLRTDSPMFICCSHGTLLHFGLQSSRLNICYYHQDLHPRLLHPGPRPRLPRHRG 255          
BLAST of SMED30027845 vs. Ensembl Zebrafish
Match: CT583728.27 (pep chromosome:GRCz11:4:55813426:55829342:-1 gene:ENSDARG00000117174.1 transcript:ENSDART00000185611.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT583728.27)

HSP 1 Score: 113.62 bits (283), Expect = 3.814e-27
Identity = 75/186 (40.32%), Postives = 92/186 (49.46%), Query Frame = -3
Query: 1541 RLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLPETLDDVSEIACVTTLCCRNNQISVFKFRNVNLIPFRFRRLLNQ*LDKLSINRRLSPPSDN*VTRSLRTD*PMFKYCSHGTLLHFSLQGSHLNNCYYYQDLYP*PLHSDSRQ*LLSNHG 2098
            RL TLETCCGY YG  R+L LLP+IFKG +   G  +N GAF  + P L +  F G +   K++   P                 R  ++    F ++N  PFR              +    P   N V  SLRTD PMF  CSHGTLLHF LQ S LN CYY+QDL+P  LH   R  L  + G
Sbjct:   84 RLFTLETCCGYGYGPARDLHLLPRIFKGRRELTGRRRNHGAFQGAGPSLGLNPFQGALPFTKKRELFPGLTPASPGSFASPHWAPRGARLRHSGFGDLNPTPFR----------SAGGDGGHRPSLPNSVRPSLRTDSPMFICCSHGTLLHFGLQSSRLNICYYHQDLHPRLLHPGPRPRLPRHRG 259          
BLAST of SMED30027845 vs. Ensembl Zebrafish
Match: CABZ01072614.1 (pep scaffold:GRCz11:KZ115963.1:1221:1388:1 gene:ENSDARG00000110428.1 transcript:ENSDART00000181375.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01072614.1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.720e-21
Identity = 44/55 (80.00%), Postives = 46/55 (83.64%), Query Frame = 1
Query: 2536 MPRHLISDVHEWINEIPTVPIYYLAKLQPRERAWKI*RGKKTLLSLTLVRLCRET 2700
            MPRHLISD HEW+NEIPTVP  YLAK QPRERAW+  RGKKTLLSLTLV  C ET
Sbjct:    1 MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKKTLLSLTLVWPCEET 55          
BLAST of SMED30027845 vs. UniProt/SwissProt
Match: sp|Q8TGM7|ART2_YEAST (Putative uncharacterized protein ART2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ART2 PE=5 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.398e-13
Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = -1
Query: 2854 VCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVL 3006
            VCI TENQNQ  F PF   ++SVL E  LGHLRY LTDVPPQ NSPPD V 
Sbjct:    2 VCIHTENQNQGGFYPFVLLEISVLHEPPLGHLRYRLTDVPPQPNSPPDNVF 52          
BLAST of SMED30027845 vs. UniProt/SwissProt
Match: sp|Q6CQE5|TAR1_KLULA (Protein TAR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TAR1-A PE=4 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 2.190e-13
Identity = 34/55 (61.82%), Postives = 41/55 (74.55%), Query Frame = -3
Query:  215 LPLSDFTYYLTLSSKFFSTFPHGTCLLSDSHKYLALDGVYHPIWTAFSNNPTHRK 379
             P ++FTY+ TL SKFFS+F H TC LS S +YLALDG+YHP+  AF NN T RK
Sbjct:    7 FPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDGIYHPLRAAFPNNSTRRK 61          
BLAST of SMED30027845 vs. UniProt/SwissProt
Match: sp|Q8TGM6|TAR1_YEAST (Protein TAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAR1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.339e-12
Identity = 33/55 (60.00%), Postives = 41/55 (74.55%), Query Frame = -3
Query:  215 LPLSDFTYYLTLSSKFFSTFPHGTCLLSDSHKYLALDGVYHPIWTAFSNNPTHRK 379
             P ++FTY+ TL SKFFS+F H TC LS S +YLALDG+YHP+  AF NN T R+
Sbjct:   22 FPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDGIYHPLRAAFPNNSTLRR 76          
BLAST of SMED30027845 vs. UniProt/SwissProt
Match: sp|Q3E811|RRT15_YEAST (Regulator of rDNA transcription protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRT15 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.561e-11
Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = -1
Query: 2869 VCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSP 3006
            VCI TENQNQ  F PF   ++SVL E  LGHLRY LTDVPPQ NSP
Sbjct:    2 VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47          
BLAST of SMED30027845 vs. TrEMBL
Match: A0A5B6TN23 (Senescence-associated protein OS=Gossypium australe OX=47621 GN=EPI10_034369 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.647e-53
Identity = 79/114 (69.30%), Postives = 85/114 (74.56%), Query Frame = -3
Query: 2432 VSKETIRVVVFHCRRESPTYTTPLMSPYKVGLESSSTGSSFPAIFSKPVPLAVVSLDSR*GQ*ESR*SIHARH*LDDEAFGYLKRVIVTPAVNQRLFEFLHIDIHGTGQKSHCV 2773
            +SK T++VVVF  R  +PTY TPL S +KVGLESSSTGSSFPA  +KPVPLAVVSLDSR GQ ES           DEAFGYLKRVIVTPAV  RL EFLH DI  TGQKSHCV
Sbjct:  237 ISKITLKVVVFQFRPRAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESH----------DEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCV 340          

HSP 2 Score: 99.3673 bits (246), Expect = 1.647e-53
Identity = 49/68 (72.06%), Postives = 52/68 (76.47%), Query Frame = -1
Query: 2842 LKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVLRTAR 3045
             + SKGSIG AFTV IRT NQNQ SF PF  H++SVLVEL LGHLRY LTDVPPQ NSPPD V R  R
Sbjct:  149 FRRSKGSIGHAFTVRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDR 216          
BLAST of SMED30027845 vs. TrEMBL
Match: A0A1I7WDS0 (Uncharacterized protein OS=Heterorhabditis bacteriophora OX=37862 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.813e-50
Identity = 118/207 (57.00%), Postives = 129/207 (62.32%), Query Frame = -1
Query:  880 PTYDIDPV*VPRYSAIHFQGWLIRQVSCYTLLSG*RLPCPPSCCLYQPTPFVVSHERDVRHLNQMFGSSHIASSAYQKWPTRHSYSMYISNKERHTSNPFKV*E*VENISSPILLIIRFTR*NYNHKCQLS*GKLRREPATRWFD*SFAPILMSDDRFARQNRGGPPSEFPLTSTCTSIVHHLSGLYMIAQTPPRCEHL*TGRCCTL 1500
            P+Y + P  V        Q   I +VSCYTLLSG RLP PPSCCLYQPTPF+ SHER VRHLN  FGSSH ASSAYQKWPT  + S    NKE  TS P K    VE +S P  LIIRFT  N+    QLS GKLRREP       SFAPI  S DRFARQNR G P EFPL S+C+SIVHHLSG  + A   P C+    G    L
Sbjct:  107 PSYSLRPGPVTAGYRSFAQAPSIFRVSCYTLLSGYRLPWPPSCCLYQPTPFMGSHERKVRHLNPAFGSSHSASSAYQKWPTWSTRSCQQFNKETETSYPLK----VEIVSPPSPLIIRFTGYNHAPLLQLSWGKLRREP-------SFAPIPKSIDRFARQNRYGLPPEFPLASSCSSIVHHLSGRKLYALPLPICKQTRQGHGAPL 302          
BLAST of SMED30027845 vs. TrEMBL
Match: A0A1C7LLU5 (Uncharacterized protein (Fragment) OS=Grifola frondosa OX=5627 GN=A0H81_15002 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 8.933e-47
Identity = 75/122 (61.48%), Postives = 82/122 (67.21%), Query Frame = -3
Query: 2369 RRESPTYTTPLMSPYKVGLESSSTGSSFPAIFSKPVPLAVVSLDSR*GQ*ESR*SIHARH*LDDEAFGYLKRVIVTPAVNQRLFEFLHIDIHGTGQKSHCVKAIY*PSQCFVLIRQSDSSSP 2734
            R +SPTY+TP MS + V LESSSTGSSFPA  +KPVPLAVVSLD                  +DEAFGYLKRVIVTPAV  RL EFLH DI  TGQKSHCV   + PSQC+VLIR   S  P
Sbjct:   99 RWDSPTYSTPSMSFHNVKLESSSTGSSFPADSAKPVPLAVVSLD------------------NDEAFGYLKRVIVTPAVYPRLVEFLHFDIQSTGQKSHCVNTTFWPSQCYVLIRHYGSILP 202          

HSP 2 Score: 84.3445 bits (207), Expect = 8.933e-47
Identity = 41/64 (64.06%), Postives = 45/64 (70.31%), Query Frame = -1
Query: 2854 LKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVL 3045
             + +KGSIG  F VCI TENQNQ  F PF   ++SVL E  LGHLRY LTDVPPQ NSPPD V 
Sbjct:   23 FRGTKGSIGHTFMVCIHTENQNQGDFYPFVLLEISVLDESPLGHLRYLLTDVPPQPNSPPDNVF 86          

HSP 3 Score: 115.931 bits (289), Expect = 7.500e-23
Identity = 91/232 (39.22%), Postives = 106/232 (45.69%), Query Frame = -1
Query: 1066 TNYQLIDVYHLHLITELPDRLGPTNPCSNTVHMEPFSTSVFKDLXXXXXXXXXXXTRDRSTLTHASSFLATTAPSYTISHTRSV*TPTYDIDP-V*VPRYSAIHFQGWLIRQVSCYTLLSG*RLPCPPSCCLYQPTPFVVSHERDVRHLNQMFGSSHIASSAYQKWPTRHSYSMYISNKERHTSNPFKV*E*VENISSPILLIIRFTR*NYNHKCQLS*GKLRREPATRWFD 1758
            T++++     +   TELP  LG TNPC   V MEPFSTSVFK                      ASS   T+ P+Y+ +         ++ D  V V R SAIHFQG+            G RLP PPSCCL + TPFVVS ER  RHLN  FGSS IASSAYQKWPTR+S S                                              GKLR+EPATRWFD
Sbjct:  264 TDFRVAARTSVLFETELPYLLGSTNPCPTAVTMEPFSTSVFK----------------------ASSL--TSTPAYSSARH-------FNADGGVWVTRLSAIHFQGY------------GFRLPWPPSCCLDELTPFVVSDERVFRHLNPTFGSSRIASSAYQKWPTRNSQSPS--------------------------------------------GKLRQEPATRWFD 408          
BLAST of SMED30027845 vs. TrEMBL
Match: J9I0R4 (Uncharacterized protein OS=Oxytricha trifallax OX=1172189 GN=OXYTRI_13058 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.146e-46
Identity = 87/164 (53.05%), Postives = 94/164 (57.32%), Query Frame = -2
Query:  876 FLMSVMLGTLTRCLVHPTSPVLLTKNGPLGIRIRCTSPIKRDILRTHLKFENKLRTFRPQYF*SFALPGKTTIT--------NASYPEGNFGGNQLLDGSISLSPLYSCPTIDLHVRTAAVLHQSFL*LQPAQA*FTIFRVST*SLKLRPDANIFRRVDVALCV 1343
            +LMSV LGTLTR   HP+SPVLLTKNGPLG RI    P   +  R        LR  R        +P  +  +          SYPEGNFGGNQLLDGSISLSPLY   TIDLHVRTA  LHQSF  L P QA FTIFRV T  L L+P       VD A C 
Sbjct:  663 YLMSVQLGTLTRRQEHPSSPVLLTKNGPLGTRIE---PPCLNQERPGFLPIQSLRIGR-----GHCIPEASNHSLYLIKLRICPSYPEGNFGGNQLLDGSISLSPLYPSSTIDLHVRTATSLHQSFPWLHPTQAQFTIFRVLTFMLVLKPFTRGSWSVDAAACA 818          

HSP 2 Score: 87.8113 bits (216), Expect = 1.146e-46
Identity = 56/100 (56.00%), Postives = 62/100 (62.00%), Query Frame = -3
Query: 1400 LRTD*PMFKYCSHGTLLHFSLQGSHLNNCYYYQDLYP*PLHSDSRQ*LLSNHGTLLHDIAYSFGVNTNLRHRSGIGPTLQRHPFSGLVDSAGELLHTP*R 1699
            LR + P+   CSHG LLHF LQ SHLNNCYY+QDL+    +  SRQ L +N   LL   A            S IG TLQRHPFSGLV SAGELLHTP R
Sbjct:  569 LRIESPVTNCCSHGNLLHFGLQNSHLNNCYYHQDLHQTLFNPGSRQRLRNNAHALLLIAASL------SLQWSSIGRTLQRHPFSGLVHSAGELLHTPQR 662          

HSP 3 Score: 149.443 bits (376), Expect = 1.368e-32
Identity = 125/278 (44.96%), Postives = 146/278 (52.52%), Query Frame = -1
Query: 1855 SQAQQGXXXXXXXXXXXXXXXFR*IVDRDSRNLVNPFMHVTN*MTRHLAT*RES*LLPPLTSACLNFFTLTFMALGRNHIASKPFTSHRNALF*LDSRIPLVHASSRLTVNCTMTTMNPKTHKS*PNPPINQVEKVPLQLHLGFPQNRIKT---AQFQFNRLLD*AHHTRSLEPILLPKVRI*FADFPYLHCSKTI-GCSPWRPAADIGTA*NEIYNCSLRFSRAIRGASDTTRTAVLLTFHIPFSR*PDSRDMFMYTKKRELFPKHLMTSLRSLVLP 2676
            SQAQQGLLSPL  PSPFPWL  R IVDRDS NLVNPFM VTN MTRHLAT RES LLPP T A LNFFTLTF ALGRNHI S PF  H NA F L+ R+PLV +SS   V+C+                     ++   L +G    R ++    Q Q N           L  I  P+V   F   P     +   GC PWRP A +GT   EI   SLRFS  I  A DT+++ VL   + P S              +  F +  + SL SL+LP
Sbjct:  296 SQAQQGLLSPLIVPSPFPWLWVRQIVDRDSGNLVNPFMRVTNQMTRHLATLRESQLLPPFTRAWLNFFTLTFRALGRNHIVSTPFQGHHNAWFLLNCRVPLVRSSSESIVHCS--------------------GRIAPYLPVGLSSFRARSLWGPQTQNNLTFRAGPDCPILRAIPFPEVTELFCRLPLSTLFQLARGCQPWRPDAVMGTTWCEII--SLRFSWTIVNAPDTSKSKVLFQTYNPSS-------------GQSNFRRFTLASLSSLMLP 538          

HSP 4 Score: 89.7373 bits (221), Expect = 3.314e-14
Identity = 53/78 (67.95%), Postives = 58/78 (74.36%), Query Frame = -2
Query: 2838 LSDTSCFKL*RHQKDR*AALSRSVFVLKIKIK*AFPLLVDTRFLSWLSSPWDTCVTI*QMYRPSQTPHLTLSSEQLES 3071
             SDTS  KL + QKDR A LS+ VFVLKIKIK AFPLLV  RFL  LS P DTCV + QM RPSQTPHLT+SS Q+ S
Sbjct:  194 FSDTSSLKLLK-QKDRQAMLSQFVFVLKIKIKQAFPLLVYKRFLFSLSLPQDTCVIVQQMCRPSQTPHLTMSSTQISS 270          
BLAST of SMED30027845 vs. TrEMBL
Match: J9HKN0 (Uncharacterized protein OS=Oxytricha trifallax OX=1172189 GN=OXYTRI_14248 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 1.184e-46
Identity = 87/164 (53.05%), Postives = 94/164 (57.32%), Query Frame = -2
Query:  876 FLMSVMLGTLTRCLVHPTSPVLLTKNGPLGIRIRCTSPIKRDILRTHLKFENKLRTFRPQYF*SFALPGKTTIT--------NASYPEGNFGGNQLLDGSISLSPLYSCPTIDLHVRTAAVLHQSFL*LQPAQA*FTIFRVST*SLKLRPDANIFRRVDVALCV 1343
            +LMSV LGTLTR   HP+SPVLLTKNGPLG RI    P   +  R        LR  R        +P  +  +          SYPEGNFGGNQLLDGSISLSPLY   TIDLHVRTA  LHQSF  L P QA FTIFRV T  L L+P       VD A C 
Sbjct:  663 YLMSVQLGTLTRRQEHPSSPVLLTKNGPLGTRIE---PPCLNQERPGFLPIQSLRIGR-----GHCIPEASNHSLYLIKLRICPSYPEGNFGGNQLLDGSISLSPLYPSSTIDLHVRTATSLHQSFPWLHPTQAQFTIFRVLTFMLVLKPFTRGSWSVDAAACA 818          

HSP 2 Score: 87.8113 bits (216), Expect = 1.184e-46
Identity = 56/100 (56.00%), Postives = 62/100 (62.00%), Query Frame = -3
Query: 1400 LRTD*PMFKYCSHGTLLHFSLQGSHLNNCYYYQDLYP*PLHSDSRQ*LLSNHGTLLHDIAYSFGVNTNLRHRSGIGPTLQRHPFSGLVDSAGELLHTP*R 1699
            LR + P+   CSHG LLHF LQ SHLNNCYY+QDL+    +  SRQ L +N   LL   A            S IG TLQRHPFSGLV SAGELLHTP R
Sbjct:  569 LRIESPVTNCCSHGNLLHFGLQNSHLNNCYYHQDLHQTLFNPGSRQRLRNNAHALLLIAASL------SLQWSSIGRTLQRHPFSGLVHSAGELLHTPQR 662          

HSP 3 Score: 149.443 bits (376), Expect = 1.182e-32
Identity = 125/278 (44.96%), Postives = 146/278 (52.52%), Query Frame = -1
Query: 1855 SQAQQGXXXXXXXXXXXXXXXFR*IVDRDSRNLVNPFMHVTN*MTRHLAT*RES*LLPPLTSACLNFFTLTFMALGRNHIASKPFTSHRNALF*LDSRIPLVHASSRLTVNCTMTTMNPKTHKS*PNPPINQVEKVPLQLHLGFPQNRIKT---AQFQFNRLLD*AHHTRSLEPILLPKVRI*FADFPYLHCSKTI-GCSPWRPAADIGTA*NEIYNCSLRFSRAIRGASDTTRTAVLLTFHIPFSR*PDSRDMFMYTKKRELFPKHLMTSLRSLVLP 2676
            SQAQQGLLSPL  PSPFPWL  R IVDRDS NLVNPFM VTN MTRHLAT RES LLPP T A LNFFTLTF ALGRNHI S PF  H NA F L+ R+PLV +SS   V+C+                     ++   L +G    R ++    Q Q N           L  I  P+V   F   P     +   GC PWRP A +GT   EI   SLRFS  I  A DT+++ VL   + P S              +  F +  + SL SL+LP
Sbjct:  296 SQAQQGLLSPLIVPSPFPWLWVRQIVDRDSGNLVNPFMRVTNQMTRHLATLRESQLLPPFTRAWLNFFTLTFRALGRNHIVSTPFQGHHNAWFLLNCRVPLVRSSSESIVHCS--------------------GRIAPYLPVGLSSFRARSLWGPQTQNNLTFRAGPDCPILRAIPFPEVTELFCRLPLSTLFQLARGCQPWRPDAVMGTTWCEII--SLRFSWTIVNAPDTSKSKVLFQTYNPSS-------------GQSNFRRFTLASLSSLMLP 538          

HSP 4 Score: 89.7373 bits (221), Expect = 3.371e-14
Identity = 53/78 (67.95%), Postives = 58/78 (74.36%), Query Frame = -2
Query: 2838 LSDTSCFKL*RHQKDR*AALSRSVFVLKIKIK*AFPLLVDTRFLSWLSSPWDTCVTI*QMYRPSQTPHLTLSSEQLES 3071
             SDTS  KL + QKDR A LS+ VFVLKIKIK AFPLLV  RFL  LS P DTCV + QM RPSQTPHLT+SS Q+ S
Sbjct:  194 FSDTSSLKLLK-QKDRQAMLSQFVFVLKIKIKQAFPLLVYKRFLFSLSLPQDTCVIVQQMCRPSQTPHLTMSSTQISS 270          
BLAST of SMED30027845 vs. Ensembl Cavefish
Match: wu:fi09b08 (wu:fi09b08 [Source:ZFIN;Acc:ZDB-GENE-030131-5630])

HSP 1 Score: 92.4337 bits (228), Expect = 1.292e-22
Identity = 45/55 (81.82%), Postives = 47/55 (85.45%), Query Frame = 1
Query: 2536 MPRHLISDVHEWINEIPTVPIYYLAKLQPRERAWKI*RGKKTLLSLTLVRLCRET 2700
            MPRHLISD HEW+NEIPTVP YYLAK QPRERAW+  RGKKTLLSLTLV  C ET
Sbjct:    1 MPRHLISDAHEWMNEIPTVPTYYLAKPQPRERAWQNQRGKKTLLSLTLVWHCEET 55          
BLAST of SMED30027845 vs. Ensembl Cavefish
Match: ENSAMXT00000038176.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000544.1:4818:11684:1 gene:ENSAMXG00000035219.1 transcript:ENSAMXT00000038176.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 2.391e-14
Identity = 37/104 (35.58%), Postives = 52/104 (50.00%), Query Frame = -3
Query: 1787 RLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLPETLDDVSEIACVTTLCCRNNQISVFKFRNVNLIPFR 2098
            RL TLETCCGY YG  R+L  LP+IFKG +   G  ++RGAF  + P+L +  F G +   K++   P           +     R   +    F ++N  PFR
Sbjct:   25 RLFTLETCCGYGYGPARDLHPLPRIFKGQRELTGRRQSRGAFQGAGPYLGVNPFQGALPFTKKRELFPVPPLASPGSFALPHWAPRGAYLRHSGFGDLNPTPFR 128          

HSP 2 Score: 33.8834 bits (76), Expect = 2.391e-14
Identity = 16/20 (80.00%), Postives = 17/20 (85.00%), Query Frame = -2
Query: 2109 SQSFYRRYGSNLPTSLTYIV 2168
            SQS  R YGS+LPTSLTYIV
Sbjct:    1 SQSLSRSYGSDLPTSLTYIV 20          
BLAST of SMED30027845 vs. Ensembl Cavefish
Match: ENSAMXT00000056251.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000324.1:2396:8895:1 gene:ENSAMXG00000029631.1 transcript:ENSAMXT00000056251.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.290e-10
Identity = 36/104 (34.62%), Postives = 52/104 (50.00%), Query Frame = -3
Query: 1787 RLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLPETLDDVSEIACVTTLCCRNNQISVFKFRNVNLIPFR 2098
            R +TLETCCGY YG  R+L  LP+IFKG +   G  ++RGAF  + P+L +  F G +   K++   P           +     R   +    F ++N  PFR
Sbjct:   32 RPVTLETCCGYGYGPARDLHPLPRIFKGQRELTGRRQSRGAFQGAGPYLGVNPFQGALPFTKKRELFPVPPLASPGSFALPHWAPRGAYLRHSGFGDLNPTPFR 135          
BLAST of SMED30027845 vs. Ensembl Cavefish
Match: ENSAMXT00000053994.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000656.1:21:2715:1 gene:ENSAMXG00000034184.1 transcript:ENSAMXT00000053994.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.594e-6
Identity = 38/98 (38.78%), Postives = 47/98 (47.96%), Query Frame = -3
Query: 1895 PSYPVPRANPFTEGTDLICRLPLPTLF*DYRLLTLETCCGYRYGLKRNL*LLPQIFKGHQGRFGHHKNRGAFDISHPFLQIT*F*GHVYVYKEKRTLP 2188
            P+ P  RANP+ E TDL CRLPLPTLF                   R+L  LP+IFKG +   G  +    F    P  +     G   ++KEKRTLP
Sbjct:  119 PTDPALRANPYLEVTDLTCRLPLPTLF----------------QHARDLHPLPRIFKGQRELTGRRQVPRRFPGRGPLSRGEPIPGSPALHKEKRTLP 200          
BLAST of SMED30027845 vs. Ensembl Yeast
Match: YLR154W-A (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; encoded within the 25S rRNA gene on the opposite strand [Source:SGD;Acc:S000028675])

HSP 1 Score: 69.707 bits (169), Expect = 2.013e-15
Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = -1
Query: 2854 VCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVL 3006
            VCI TENQNQ  F PF   ++SVL E  LGHLRY LTDVPPQ NSPPD V 
Sbjct:    2 VCIHTENQNQGGFYPFVLLEISVLHEPPLGHLRYRLTDVPPQPNSPPDNVF 52          
BLAST of SMED30027845 vs. Ensembl Yeast
Match: TAR1 (Protein potentially involved in regulation of respiratory metabolism; located in the mitochondria; interacts genetically with RPO41 and physically with Coq5p; encoded within the 25S rRNA gene on the opposite strand [Source:SGD;Acc:S000028422])

HSP 1 Score: 68.9366 bits (167), Expect = 1.929e-14
Identity = 33/55 (60.00%), Postives = 41/55 (74.55%), Query Frame = -3
Query:  215 LPLSDFTYYLTLSSKFFSTFPHGTCLLSDSHKYLALDGVYHPIWTAFSNNPTHRK 379
             P ++FTY+ TL SKFFS+F H TC LS S +YLALDG+YHP+  AF NN T R+
Sbjct:   22 FPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDGIYHPLRAAFPNNSTLRR 76          
BLAST of SMED30027845 vs. Ensembl Yeast
Match: RRT15 (Putative protein of unknown function; identified by fungal homology comparisons and RT-PCR; identified in a screen for mutants with decreased levels of rDNA transcription [Source:SGD;Acc:S000028567])

HSP 1 Score: 63.5438 bits (153), Expect = 3.688e-13
Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = -1
Query: 2869 VCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSP 3006
            VCI TENQNQ  F PF   ++SVL E  LGHLRY LTDVPPQ NSP
Sbjct:    2 VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47          
BLAST of SMED30027845 vs. Ensembl Nematostella
Match: EDO25991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T944])

HSP 1 Score: 107.071 bits (266), Expect = 1.658e-27
Identity = 55/77 (71.43%), Postives = 62/77 (80.52%), Query Frame = -1
Query: 2833 LQTLKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVL---RTARKHP 3054
            L+ LKT KGSIG AFTVCI TENQNQVSF PF  H++SVL+ELTLGHLRY LTDVPPQ NS PD+V    R+AR+ P
Sbjct:   36 LKLLKT-KGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARERP 111          
BLAST of SMED30027845 vs. Ensembl Nematostella
Match: EDO27487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T944])

HSP 1 Score: 107.071 bits (266), Expect = 1.658e-27
Identity = 55/77 (71.43%), Postives = 62/77 (80.52%), Query Frame = -1
Query: 2833 LQTLKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVL---RTARKHP 3054
            L+ LKT KGSIG AFTVCI TENQNQVSF PF  H++SVL+ELTLGHLRY LTDVPPQ NS PD+V    R+AR+ P
Sbjct:   36 LKLLKT-KGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARERP 111          
BLAST of SMED30027845 vs. Ensembl Nematostella
Match: EDO25368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T944])

HSP 1 Score: 107.071 bits (266), Expect = 1.658e-27
Identity = 55/77 (71.43%), Postives = 62/77 (80.52%), Query Frame = -1
Query: 2833 LQTLKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVL---RTARKHP 3054
            L+ LKT KGSIG AFTVCI TENQNQVSF PF  H++SVL+ELTLGHLRY LTDVPPQ NS PD+V    R+AR+ P
Sbjct:   36 LKLLKT-KGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARERP 111          
BLAST of SMED30027845 vs. Ensembl Nematostella
Match: EDO26578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBM8])

HSP 1 Score: 107.071 bits (266), Expect = 1.767e-27
Identity = 53/71 (74.65%), Postives = 58/71 (81.69%), Query Frame = -1
Query: 2842 LQTLKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVLRTAR 3054
            L+ LKT KGSIG AFTVCI TENQNQVSF PF  H++SVL+ELTLGHLRY LTDVPPQ NS PD+V  T R
Sbjct:   36 LKLLKT-KGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDR 105          
BLAST of SMED30027845 vs. Ensembl Nematostella
Match: EDO26790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB26])

HSP 1 Score: 106.686 bits (265), Expect = 1.879e-27
Identity = 53/71 (74.65%), Postives = 58/71 (81.69%), Query Frame = -1
Query: 2842 LQTLKTSKGSIGRAFTVCIRTENQNQVSFSPFGRHQVSVLVELTLGHLRYHLTDVPPQSNSPPDTVLRTAR 3054
            L+ LKT KGSIG AFTVCI TENQNQVSF PF  H++SVL+ELTLGHLRY LTDVPPQ NS PD+V  T R
Sbjct:   21 LKLLKT-KGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDR 90          
BLAST of SMED30027845 vs. Planmine SMEST
Match: SMESG000056391.1 (SMESG000056391.1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.511e-17
Identity = 53/118 (44.92%), Postives = 67/118 (56.78%), Query Frame = -1
Query: 2140 LNFFT-LTFMALGRNHIASK--PFTSHRNALF*LDSRIPLVHASSRLTVNCTMTTMNPKTHKS*PNPPINQVEKVPLQLHLGFPQNRIKTAQFQFNRLLD*AHHTRSLEPILLPKVRI 2484
            L+FFT  + + + R++   K  PF + RN         P    S+    +C    +  K      N  INQ EKVP QLH  FPQN IKTAQFQ N++L+ A+HTR LEPILLPKVRI
Sbjct:   82 LHFFTQRSIIGISRDYKFQKFIPFMARRNTR-------PET-TSTVYNDDCKFENLQSK-----QNSRINQFEKVPFQLHFIFPQNSIKTAQFQINKILNKAYHTRFLEPILLPKVRI 186          
BLAST of SMED30027845 vs. Planmine SMEST
Match: SMESG000023237.1 (SMESG000023237.1)

HSP 1 Score: 55.0694 bits (131), Expect = 2.032e-7
Identity = 26/39 (66.67%), Postives = 32/39 (82.05%), Query Frame = 2
Query: 1151 MIRSIGDEMFSTYSQTLNGFEVCLSLLEMYIEYECLVGH 1267
            MIRSIGDEM S YSQTLNGFE+CLS L++   ++CL+ H
Sbjct:    1 MIRSIGDEMLSDYSQTLNGFELCLSSLKI---HKCLIHH 36          
The following BLAST results are available for this feature:
BLAST of SMED30027845 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX548011.31.216e-2740.85pep chromosome:GRCz11:4:68562464:68565244:1 gene:E... [more]
CT583728.141.820e-2739.11pep chromosome:GRCz11:4:55797866:55801210:-1 gene:... [more]
CT583728.251.820e-2739.11pep chromosome:GRCz11:4:55781670:55785014:-1 gene:... [more]
CT583728.273.814e-2740.32pep chromosome:GRCz11:4:55813426:55829342:-1 gene:... [more]
CABZ01072614.12.720e-2180.00pep scaffold:GRCz11:KZ115963.1:1221:1388:1 gene:EN... [more]
back to top
BLAST of SMED30027845 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8TGM7|ART2_YEAST1.398e-1368.63Putative uncharacterized protein ART2 OS=Saccharom... [more]
sp|Q6CQE5|TAR1_KLULA2.190e-1361.82Protein TAR1 OS=Kluyveromyces lactis (strain ATCC ... [more]
sp|Q8TGM6|TAR1_YEAST1.339e-1260.00Protein TAR1 OS=Saccharomyces cerevisiae (strain A... [more]
sp|Q3E811|RRT15_YEAST2.561e-1169.57Regulator of rDNA transcription protein 15 OS=Sacc... [more]
back to top
BLAST of SMED30027845 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5B6TN231.647e-5369.30Senescence-associated protein OS=Gossypium austral... [more]
A0A1I7WDS02.813e-5057.00Uncharacterized protein OS=Heterorhabditis bacteri... [more]
A0A1C7LLU58.933e-4761.48Uncharacterized protein (Fragment) OS=Grifola fron... [more]
J9I0R41.146e-4653.05Uncharacterized protein OS=Oxytricha trifallax OX=... [more]
J9HKN01.184e-4653.05Uncharacterized protein OS=Oxytricha trifallax OX=... [more]
back to top
BLAST of SMED30027845 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
wu:fi09b081.292e-2281.82wu:fi09b08 [Source:ZFIN;Acc:ZDB-GENE-030131-5630][more]
ENSAMXT00000038176.12.391e-1435.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056251.11.290e-1034.62pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000053994.11.594e-638.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30027845 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YLR154W-A2.013e-1568.63Dubious open reading frame; unlikely to encode a f... [more]
TAR11.929e-1460.00Protein potentially involved in regulation of resp... [more]
RRT153.688e-1369.57Putative protein of unknown function; identified b... [more]
back to top
BLAST of SMED30027845 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO259911.658e-2771.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274871.658e-2771.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253681.658e-2771.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265781.767e-2774.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267901.879e-2774.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027845 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027845 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000056391.14.511e-1744.92SMESG000056391.1[more]
SMESG000023237.12.032e-766.67SMESG000023237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027845 ID=SMED30027845|Name=SMED30027845|organism=Schmidtea mediterranea sexual|type=transcript|length=3108bp
TCATTAAGCGGAGGAAAAGAAACTAACAAGGATTTCCCTAGTAGTGGCGA
ACGACCGGGAATTAGCCCAGCACTGAATCCTGTATCTTTGATACTAGGAG
TTGTGGTGTACAGGTTGTGTTTTTAATGGTTGAGTATACTCCAAATTCAC
TTGATTGTGATGTTGTCCATAGAGGGTGTTAGACCCGTTGGAGTATACAA
GGCTGTTATTGACACTTCCTATGAGTCGGATTGTTTGAGAATGCAGTCCA
AATTGGGTGGTAAACTCCATCTAAGGCTAAATACTTGTGCGAGTCCGATA
GTAAACAAGTACCGTGAGGGAAAGTTGAAAAGAACTTTGAAGAGAGAGTT
AAATAGTACGTGAAATCGCTTAGAGGTAAACGAGTGGAGCCGAAGCTGAT
GTATGGGATTCAGTTGATTGTGTGTTATCTTGTCTTTATTGAAATCTCTC
AAGGATTCTCTAGAGATGAGCTCGTAATATGCGATCAATGCACTTTCTAT
GCATCAAAACTGCGACCAATAGAGCTGTTTTTCTGTCGTGTTGATAAAGG
TGACCAGTTCTTCGGAATCGGTTTTATAGTTCAATGCACGGTTAAACATA
GTGTATTGGTGATTGCGATTTGCTAATTTTAGTGATTGTCAATGCTGATT
GTTTGATGGTTAGCTCGAAACGAGATAGCTGTTGAATGGTTGGTGTAGAT
GATTGCTAAAGGGTAAATCTATAGTCTGCAGTGTATATGTAGGTTACCTG
CTCGTCCCGTCTTGAAACACGGACCAAGGAGTTTTATATGATCGCGAGTC
AAAGGGCTTTACGAAACCCCATGGCGAAATTAATGTAAAGGCTTGCTTCG
GTAAGCTGTGATGTGACCTCGTGGAAACACAGAGTGCAACATCGACCCGT
CTAAAGATGTTCGCATCTGGGCGGAGTTTGAGCGATCATGTAGAGACCCG
AAAGATGGTGAACTATGCTTGTGCAGGTTGAAGTCAGAGGAAACTCTGAT
GGAGGACCGCCGCGGTTCTGACGTGCAAATCGATCGTCGGACATGAGTAT
AGGGGCGAAAGACTAATCGAACCATCTAGTAGCTGGTTCCCTCCGAAGTT
TCCCTCAGGATAGCTGGCATTTGTGATTGTAGTTTTACCTGGTAAAGCGA
ATGATTAGAAGTATTGGGGACGAAATGTTCTCAACTTATTCTCAAACTTT
AAATGGGTTCGAAGTATGTCTCTCTTTATTGGAGATGTACATCGAATACG
AATGCCTAGTGGGCCATTTTTGGTAAGCAGAACTGGCGATGTGGGATGAA
CCAAACATCTGGTTAAGGTGCCTAACATCACGCTCATGAGAAACCACAAA
AGGTGTTGGTTGATAAAGACAGCAGGACGGTGGACATGGAAGTCGTCATC
CGCTAAGGAGTGTGTAACAACTCACCTGCCGAATCAACCAGCCCTGAAAA
TGGATGGCGCTGTAGCGTGGGACCTATACCGGATCGATGTCGTAAGTTGG
TGTTTACACCGAACGAGTATGCGATATCGTGTAGGAGGGTGCCGTGGTTG
CTAAGAAGCTACTGGCGTGAGTCAGAGTGGAGCGGTCACGGGTACAGATC
TTGGTAGTAGTAGCAATTATTCAAGTGAGATCCTTGAAGACTGAAGTGGA
GAAGGGTTCCATGTGAACAGTATTTGAACATGGGTTAGTCGGTCCTAAGC
GATCTGGTAACTCAGTTATCAGATGGAGGTGATAGACGTCTATTAATTGA
TAGTTTGTCTAGTTATTGATTCAATAGCCTCCTGAAGCGAAAGGGAATCA
GGTTAACATTCCTGAACTTGAATACGGAAATTTGGTTGTTTCGGCAACAC
AAGGTGGTAACACAAGCGATCTCAGAGACGTCATCAAGTGTTTCGGGAAG
AGTTCTCTTTTCTTTGTATACATAAACATGTCCCTAGAATCAGGTTATCT
GGAGAAAGGGATGTGAAATGTCAAAAGCACCGCGGTTCTTGTGGTGTCCG
AAGCGCCCCTGATGGCCCTTGAAAATCTGAGGGAGCAGTTATAAATTTCG
TTTCAAGCCGTACCGATATCCGCAGCAGGTCTCCAAGGTGAGCAGCCTAT
AGTCTTAGAACAATGTAGGTAAGGGAAGTCGGCAAATTAGATCCGTACCT
TCGGTAAAAGGATTGGCTCTAGGGACCGGGTATGATGGGCTTAATCAAGA
AGTCGATTGAATTGGAATTGGGCTGTTTTGATTCTGTTTTGGGGAAACCC
TAGATGGAGTTGAAGTGGAACTTTTTCGACTTGATTGATGGGCGGGTTAG
GCTATGATTTGTGAGTTTTCGGATTCATGGTCGTCATTGTGCAATTAACG
GTCAACCTAGAACTGGCATGGACTAGAGGAATCCGACTGTCTAATTAAAA
CAAAGCATTGCGATGGCTAGTAAATGGCTTTGACGCAATGTGATTTCTGC
CCAGTGCCATGAATGTCAATGTGAAGAAATTCAAACAAGCGCTGGTTAAC
GGCGGGAGTAACTATGACTCTCTTCAGGTAGCCAAATGCCTCGTCATCTA
ATTAGTGACGTGCATGAATGGATTAACGAGATTCCTACTGTCCCTATCTA
CTATCTAGCGAAACTACAGCCAAGGGAACGGGCTTGGAAAATATAGCGGG
GAAAGAAGACCCTGTTGAGCTTGACTCTAGTCCGACTTTGTAGGGAGACA
TTAGAGGTGTAGTATAAGTGGGAGACTCACGTCGACAGTGAAATACCACT
ACTCTGATCGTTTCTTTACTTACTCAGTAATGCAGTGCAGTTGATTCAGG
TCAATTTATTGTGGAGAAAAGAAAGCGATCTTCGGATGCTTTCGAGCTGT
TCTGAGGACAGTGTCAGGTGGGGAGTTTGACTGGGGCGGTACATCTGTCA
AATGGTAACGCAGGTGTCCCAAGGTGAGCTCAACCAGGACAGAAACCTGG
TGTCGACCAAAAGGGGAAAAGCTCACTTGATTTTGATTTTCAGTACGAAT
ACAGACCGTGAAAGCGCGGCCTATCGATCCTTTTGATGTCTTCAGAGTTT
GAAGCAAGAGGTGTCAGAAAGACAAATTCATTAGTGTGTTGGAGCAAATT
TATGTTAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0002111X2 cell