Thymidine phosphorylase

Overview
NameThymidine phosphorylase
Smed IDSMED30027834
Length (bp)5243
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thymidine phosphorylase (SMED30027834) t-SNE clustered cells

Violin plots show distribution of expression levels for Thymidine phosphorylase (SMED30027834) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thymidine phosphorylase (SMED30027834) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thymidine phosphorylase (SMED30027834) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027834

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027834 SmedASXL_068316SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30027834SMESG000008845.1 dd_Smed_v4_869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027834SMESG000008845.1 dd_Smed_v4_869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30027834SMESG000008845.1 dd_Smed_v4_869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027834SMESG000008845.1 dd_Smed_v6_869_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027834SMESG000008845.1 dd_Smed_v4_869_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thymidine phosphorylase vs. Ensembl Human
Match: TYMP (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 327.02 bits (837), Expect = 4.870e-98
Identity = 176/417 (42.21%), Postives = 252/417 (60.43%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN 5094
            +I  K  G  LS  +I  FV  V       AQIGA LMAI+L+GM+ +ET+ LT+++A   ++  W +  W  ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF  +   + M  +L+ +G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E + AL++DVKFG       +E+A  LA++++  G SL + +   +  M+ PLG C+G+ALE+ E L  + G   PD+++++  +   LL       +  + A ++  A+  G AL  F++ML +QGV   LA +LC       R++LP A   E L    P    +P   AG V  + A  + ++  +LG GR R  + L  GVG EL+   G  + RG PW +V+ + 
Sbjct:   39 LIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEA-WRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELL--APADAPLP---AGTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDG 449          
BLAST of Thymidine phosphorylase vs. Ensembl Human
Match: TYMP (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 323.939 bits (829), Expect = 5.280e-97
Identity = 175/417 (41.97%), Postives = 251/417 (60.19%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN 5094
            +I  K  G  LS  +I  FV  V       AQIGA LMAI+L+GM+ +ET+ LT+++A   ++  W +  W  ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF  +   + M  +L+ +G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E + AL++DVKFG       +E+A  LA++++  G SL + +   +  M+ PLG C+G+ALE+ E L  + G   PD+++++  +   LL       +  + A ++  A+  G AL  F++ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  + ++  +LG GR R  + L  GVG EL+   G  + RG PW +V+ + 
Sbjct:   39 LIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEA-WRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELL--------APAD--GTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDG 444          
BLAST of Thymidine phosphorylase vs. Ensembl Human
Match: TYMP (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 323.939 bits (829), Expect = 5.280e-97
Identity = 175/417 (41.97%), Postives = 251/417 (60.19%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN 5094
            +I  K  G  LS  +I  FV  V       AQIGA LMAI+L+GM+ +ET+ LT+++A   ++  W +  W  ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF  +   + M  +L+ +G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E + AL++DVKFG       +E+A  LA++++  G SL + +   +  M+ PLG C+G+ALE+ E L  + G   PD+++++  +   LL       +  + A ++  A+  G AL  F++ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  + ++  +LG GR R  + L  GVG EL+   G  + RG PW +V+ + 
Sbjct:   39 LIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEA-WRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELL--------APAD--GTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDG 444          
BLAST of Thymidine phosphorylase vs. Ensembl Human
Match: TYMP (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 323.939 bits (829), Expect = 5.280e-97
Identity = 175/417 (41.97%), Postives = 251/417 (60.19%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN 5094
            +I  K  G  LS  +I  FV  V       AQIGA LMAI+L+GM+ +ET+ LT+++A   ++  W +  W  ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF  +   + M  +L+ +G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E + AL++DVKFG       +E+A  LA++++  G SL + +   +  M+ PLG C+G+ALE+ E L  + G   PD+++++  +   LL       +  + A ++  A+  G AL  F++ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  + ++  +LG GR R  + L  GVG EL+   G  + RG PW +V+ + 
Sbjct:   39 LIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEA-WRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELL--------APAD--GTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDG 444          
BLAST of Thymidine phosphorylase vs. Ensembl Human
Match: TYMP (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 323.939 bits (829), Expect = 5.280e-97
Identity = 175/417 (41.97%), Postives = 251/417 (60.19%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN 5094
            +I  K  G  LS  +I  FV  V       AQIGA LMAI+L+GM+ +ET+ LT+++A   ++  W +  W  ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF  +   + M  +L+ +G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E + AL++DVKFG       +E+A  LA++++  G SL + +   +  M+ PLG C+G+ALE+ E L  + G   PD+++++  +   LL       +  + A ++  A+  G AL  F++ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  + ++  +LG GR R  + L  GVG EL+   G  + RG PW +V+ + 
Sbjct:   39 LIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEA-WRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELL--------APAD--GTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDG 444          
BLAST of Thymidine phosphorylase vs. Ensembl Zebrafish
Match: tymp (thymidine phosphorylase [Source:ZFIN;Acc:ZDB-GENE-100415-1])

HSP 1 Score: 130.954 bits (328), Expect = 1.574e-34
Identity = 70/127 (55.12%), Postives = 87/127 (68.50%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGF 4242
            +I+ K  G  LS  EI  FV+ V+   I ++QIGA LMAI  KGM  +ET  LT+ M +  + F W   +W   V+DKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF
Sbjct:   13 LIKLKRNGGQLSLAEIHTFVQGVTTGAIQKSQIGAMLMAIWQKGMTDEETLALTREMMNSGDTFKWPN-EWL--VLDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGF 136          
BLAST of Thymidine phosphorylase vs. Ensembl Zebrafish
Match: tymp (thymidine phosphorylase [Source:ZFIN;Acc:ZDB-GENE-100415-1])

HSP 1 Score: 130.954 bits (328), Expect = 1.574e-34
Identity = 70/127 (55.12%), Postives = 87/127 (68.50%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGF 4242
            +I+ K  G  LS  EI  FV+ V+   I ++QIGA LMAI  KGM  +ET  LT+ M +  + F W   +W   V+DKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF
Sbjct:   13 LIKLKRNGGQLSLAEIHTFVQGVTTGAIQKSQIGAMLMAIWQKGMTDEETLALTREMMNSGDTFKWPN-EWL--VLDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGF 136          
BLAST of Thymidine phosphorylase vs. Ensembl Zebrafish
Match: CR749164.1 (pep chromosome:GRCz11:21:30355767:30361679:1 gene:ENSDARG00000116832.1 transcript:ENSDART00000189948.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR749164.1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.630e-29
Identity = 37/93 (39.78%), Postives = 58/93 (62.37%), Query Frame = -2
Query: 2723 QFHKIRMK*EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNN-KFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQK 2998
            Q   IR    FLG  ++YR+FI++FS +  PL  ++K NN +  W+ +   AF  LK + +++PILR PD  +PF++   ASN  +GA+L Q+
Sbjct:  740 QPETIRQLQRFLGFANFYRRFIRNFSSVAAPLTAMVKANNARLKWNPDAVRAFTQLKTRFSSAPILRHPDPEQPFVVEIYASNTGIGAILSQR 832          

HSP 2 Score: 72.0182 bits (175), Expect = 1.630e-29
Identity = 59/247 (23.89%), Postives = 102/247 (41.30%), Query Frame = -1
Query: 1998 KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRK--FIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYLTELQN*QRRDSQLKQFFEQAISVKKKDWKQIESENGKYIIHDGILKCLKNN-------EELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNT 2711
            K H  A+ SR L   E+N     +E LA+   +  +R +L G K  FIV TDH  ++++   +    +  RW++    +DF++ +  G  N  ADA+SR+ +++   +  E  I                           +  + V    W  IE E         IL+  +NN       E    V    R  L+ + HD    GH  +  T+  ++ +Y W +I ++V ++   C  C   K++
Sbjct:  838 KLHPCAFYSRKLNSAERNYDVGNRELLAMKAALEEWRHWLEGAKHPFIVITDHKNLEYIRSCKRLNPRQARWALFFTRFDFQVTYIPGSKNIKADALSRLSDDETSEIPDEPII---------------------------KDPLIVAPIQW-DIEQE---------ILQAAENNPSQQPCPENKIFVPPSLRERLISEVHDHPSSGHPGSTATVQMIQSRYWWSSIHKDVINFINRCSPCQMSKHS 1047          

HSP 3 Score: 57.7658 bits (138), Expect = 1.769e-7
Identity = 31/108 (28.70%), Postives = 60/108 (55.56%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMNFVLRGIWH--TLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  +P+ FQ  +N + R + +   +VYI+ I+++SN   EH++ V  V +RL   +L  K  KCE  ++ + ++G     EG+  + + +  V  +P P+   +++
Sbjct:  641 FGLANSPSVFQAFVNEIFRDMLNKWVIVYIDDILVYSNSLSEHIQHVRAVLKRLIKNQLYAKSSKCEFHQTCISFLGYIISPEGVAMDQQKVDSVTQWPQPETIRQLQ 748          
BLAST of Thymidine phosphorylase vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 124.79 bits (312), Expect = 5.282e-28
Identity = 113/441 (25.62%), Postives = 187/441 (42.40%), Query Frame = -1
Query: 1998 FGLT*APANFQRGMNFVLRGIWHTL--VYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEV-RISWFDQLL*KIY*RLFAYRSSIKRITKEKQQIYMEQKSARCV*YTKEK---IDNLTYITVS---RFYKTVHAND*CQ*CCIGSGVGSKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGR--KFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYLTELQN*QRRDSQLKQFFEQAISVKKKDWKQIESENGKYIIHDGILKCLKNNEELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNT 3287
            FGL+ APA FQ  +N VLR +      VY++ I+IFS+   EH++ +  V QRL    L +K  KC      V ++G     EGL+ +P+ IK V  +P P +   + R   F     +         + +  +T  K        SA    ++K K   +     IT     +F   V A++      +     S G   K H  AY S  L   E N     +E LA+   +  +R +L G    FIV+TDH  ++++   +   S+  RW++    ++F I +R G  N   DA+SR+ +  +                           R S L+    + I +    W +IES+    +  DG+   +        V EK R+ ++   H   +  H    +T   +K ++ WPA+ ++V+D+  +C VC   K +
Sbjct:  650 FGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSSKTP--FRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAILSQRSSSDG---KIHPCAYYSHRLSAAESNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAKRLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSRLFDSSE---------------------------RTSSLEPVVPKRIVISNITW-EIESKVRAAL--DGVTPPIGCPPSRLFVPEKLRSDVIRWGHSSKVACHPGVSRTSFVIKQRFWWPALARDVRDFVLACSVCAVSKTS 1055          

HSP 2 Score: 75.8702 bits (185), Expect = 5.094e-13
Identity = 33/83 (39.76%), Postives = 49/83 (59.04%), Query Frame = -2
Query: 2723 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQK 2971
             FLG  ++YR+FI++FS +  PL  L      F WS   + AF  LK    ++PIL  PD ++ F++  DAS V +GA+L Q+
Sbjct:  758 RFLGFANFYRRFIRNFSQLAAPLTALTSSKTPFRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAILSQR 840          
BLAST of Thymidine phosphorylase vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 122.865 bits (307), Expect = 2.016e-27
Identity = 111/458 (24.24%), Postives = 199/458 (43.45%), Query Frame = -1
Query: 2004 FGLT*APANFQRGMNFVLRGI---WHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEV-RISWFDQLL*KIY*RLFAYRSSIKRITK----------EKQQIYMEQKSARCV*YTKEKI-----DNLTYITVSRFYKTVHAND*CQ*CCIGSGVGS-----KGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLG--RKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKAS----NYLTELQN*QRRDSQLKQFFEQAISVKKKDWKQIESENGKYIIHDGILKCLKNNEELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRK 3287
            FGL+  P+ FQ  MN V R +   W        +II+SN   EH++ V  V QR+   +L  K  KCE  ++++ ++G     EG+  +   ++ V+ +P+PQN  E+ R   F     +      +  + +  +TK          E +Q + + K+     +T   I      +L +I        V A++        +GVG+     +G   K +  A+ SR L   E+N     +E LA+   +  +R +L G  ++F + TDH  +++L   +    +  RW++    +DF + +R G  N+ ADA+SR+ +EDK  +  E  I   +  +    + LTE+Q   R ++                   ++  N    + + I                 R  LL   HD    GH     TL  +K ++ WP++ ++V ++ + CK+C + K
Sbjct:  640 FGLSNCPSVFQSFMNDVFRDMLDRW--------VIIYSNTMKEHVEHVRMVLQRMIQHRLYAKLEKCEFHQTQIAFLGYVISAEGITMDDTKVQAVQRWPLPQNLKELQRFLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFSDLKTQ----FTTAPILRHPNPDLPFIV------EVDASN--------TGVGAVLSQRQGQPSKMYPCAFFSRKLTSAERNYDVGNRELLAMKLALEEWRHWLEGASQQFTILTDHKNLEYLRSAKRLNPRQARWALFFTRFDFIVTYRPGSKNSKADALSRL-SEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENN-----------------PPVDCPNHLIFVPNNI-----------------RTRLLTHIHDTPSSGHPGITATLELVKARFWWPSLTKDVINYVQKCKICQSTK 1036          

HSP 2 Score: 86.2705 bits (212), Expect = 3.346e-16
Identity = 40/85 (47.06%), Postives = 56/85 (65.88%), Query Frame = -2
Query: 2717 FLGLTSYYRKFIKDFSHIVHPLNVLLKKNN-KFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVG 2968
            FLG  ++YR+FI+ FS I  PL  + K+N+ K +WS   + AF  LK + TT+PILR P+   PF++  DASN  +GAVL Q+ G
Sbjct:  742 FLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSSEARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQRQG 826          
BLAST of Thymidine phosphorylase vs. Ensembl Xenopus
Match: MGC115716 (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 347.051 bits (889), Expect = 9.358e-105
Identity = 183/432 (42.36%), Postives = 262/432 (60.65%), Query Frame = 1
Query: 3850 NVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN-DLEITKIEFLKSAITV 5142
             +  II  K  GL L++EEI + V+  ++    ++Q+GA LMA++L+GM+ +ET  LTK          W + +W   +VDKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF P      M  IL   G  I GQ+  +VP DK  Y +RDVTATVDS+PLITAS++SKK  E++ AL++DVKFGE     T EEA  LA S++  G SL +    L+ +M+SP+G C+GN LE+ E L  + G    D++E++      LL    + SS    ++KI  A++ G AL+ F+ ML++QGV   +A +L     L  AS+ ELL + + H   + S   G V  I A+ +      LG GR R  D +N+ VG EL+   G  +E+G PW ++++EN  L+  + ++L+ AI +
Sbjct:   48 RIADIIAKKRDGLPLTAEEIKHVVQAATRGHAQDSQLGALLMAVRLRGMDPEETLALTKEFVASGCVLQWPK-EWSGILVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGFSPEQSPAQMLEILRSVGCCIVGQSKDLVPADKIFYEMRDVTATVDSLPLITASVISKKVAENVSALILDVKFGEAAQSPTLEEARILANSLVSAGVSLGIPTSALVSNMDSPIGRCVGNTLEVIEALECMEGAGPDDLRELVMHTGGHLLWLCGQASSETHGSEKIARALADGSALQCFRGMLEAQGVPSEIARTLSSTSNLRTASHQELLRNVRHHELSVLSSSPGTVKLIRAKPIAETLNALGAGRSRANDPINHSVGAELLVSMGQHVEQGDPWIRIHYENPQLQDEQRKYLQEAICI 478          
BLAST of Thymidine phosphorylase vs. Ensembl Xenopus
Match: MGC115716 (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 339.347 bits (869), Expect = 9.870e-103
Identity = 182/432 (42.13%), Postives = 260/432 (60.19%), Query Frame = 1
Query: 3850 NVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN-DLEITKIEFLKSAITV 5142
             +  II  K  GL L++EEI + V+  ++    ++Q+GA LMA++L+GM+ +ET  LTK          W + +W   +VDKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF P      M  IL   G  I GQ+  +VP DK  Y +RDVTATVDS+PLITAS++SKK  E++ AL++DVKFGE     T EEA  LA S++  G SL +    L+ +M+SP+G C+GN LE+ E L  + G    D++E++      LL    + SS    ++KI  A++ G AL+ F+ ML++QGV   +A +L     L  AS+ ELL  +K          +G V  I A+ +      LG GR R  D +N+ VG EL+   G  +E+G PW ++++EN  L+  + ++L+ AI +
Sbjct:   10 RIADIIAKKRDGLPLTAEEIKHVVQAATRGHAQDSQLGALLMAVRLRGMDPEETLALTKEFVASGCVLQWPK-EWSGILVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGFSPEQSPAQMLEILRSVGCCIVGQSKDLVPADKIFYEMRDVTATVDSLPLITASVISKKVAENVSALILDVKFGEAAQSPTLEEARILANSLVSAGVSLGIPTSALVSNMDSPIGRCVGNTLEVIEALECMEGAGPDDLRELVMHTGGHLLWLCGQASSETHGSEKIARALADGSALQCFRGMLEAQGVPSEIARTLSSTSNLRTASHQELLRVEK----------SGTVKLIRAKPIAETLNALGAGRSRANDPINHSVGAELLVSMGQHVEQGDPWIRIHYENPQLQDEQRKYLQEAICI 430          
BLAST of Thymidine phosphorylase vs. Ensembl Xenopus
Match: MGC115716 (thymidine phosphorylase [Source:HGNC Symbol;Acc:HGNC:3148])

HSP 1 Score: 339.347 bits (869), Expect = 1.288e-102
Identity = 182/432 (42.13%), Postives = 260/432 (60.19%), Query Frame = 1
Query: 3850 NVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN-DLEITKIEFLKSAITV 5142
             +  II  K  GL L++EEI + V+  ++    ++Q+GA LMA++L+GM+ +ET  LTK          W + +W   +VDKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF P      M  IL   G  I GQ+  +VP DK  Y +RDVTATVDS+PLITAS++SKK  E++ AL++DVKFGE     T EEA  LA S++  G SL +    L+ +M+SP+G C+GN LE+ E L  + G    D++E++      LL    + SS    ++KI  A++ G AL+ F+ ML++QGV   +A +L     L  AS+ ELL  +K          +G V  I A+ +      LG GR R  D +N+ VG EL+   G  +E+G PW ++++EN  L+  + ++L+ AI +
Sbjct:   18 RIADIIAKKRDGLPLTAEEIKHVVQAATRGHAQDSQLGALLMAVRLRGMDPEETLALTKEFVASGCVLQWPK-EWSGILVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGFSPEQSPAQMLEILRSVGCCIVGQSKDLVPADKIFYEMRDVTATVDSLPLITASVISKKVAENVSALILDVKFGEAAQSPTLEEARILANSLVSAGVSLGIPTSALVSNMDSPIGRCVGNTLEVIEALECMEGAGPDDLRELVMHTGGHLLWLCGQASSETHGSEKIARALADGSALQCFRGMLEAQGVPSEIARTLSSTSNLRTASHQELLRVEK----------SGTVKLIRAKPIAETLNALGAGRSRANDPINHSVGAELLVSMGQHVEQGDPWIRIHYENPQLQDEQRKYLQEAICI 438          
BLAST of Thymidine phosphorylase vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 5.225e-39
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = -1
Query: 2970 GLT*APANFQRGMNFVLRGIWH---TLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3284
            GL  APA FQR M   + G  H    LVY++ +I+F     EH + +  VF RL+   LK+ P KC+  +  V YVG     EG+ T+P  I+ V ++P P+   E+R
Sbjct:  451 GLCGAPATFQRLMERTV-GDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELR 557          

HSP 2 Score: 68.9366 bits (167), Expect = 5.225e-39
Identity = 39/110 (35.45%), Postives = 51/110 (46.36%), Query Frame = -2
Query: 2711 FLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFT------------------------WSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGE 2968
            FLG   YYR+F+K FS +  PLN LL+ N +                          W++    AFD LK  LT +P+L   D TKP+ L  DAS   LG +L Q+   E
Sbjct:  559 FLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQEYNKE 668          

HSP 3 Score: 63.929 bits (154), Expect = 5.225e-39
Identity = 34/99 (34.34%), Postives = 55/99 (55.56%), Query Frame = -1
Query: 2406 IAYASRSLKLHEKNNSNIEKETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNED 2699
            +A+ SRSL   E+N    + E LAL + +     +YL G +F V TD+NP+ +++      +   RW  AL  Y F +++R G+ N +AD +SR  + D
Sbjct:  672 VAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAKLDATGHRWLAALAHYKFSLRYRPGRDNRDADGLSRRPHGD 770          

HSP 4 Score: 62.7734 bits (151), Expect = 6.330e-9
Identity = 28/90 (31.11%), Postives = 54/90 (60.00%), Query Frame = -1
Query: 2001 KDWKQIESENGKYIIHDGILKCLKNNEELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKN 2270
            K+W ++   +G  +++        + +   ++ +KHR+++LM  HD    GHL   KTL  ++ +++WP ++Q+V+D+C+SC  CI RK 
Sbjct:  873 KEWDRLRLRDG--LVYRRAPSATDSEKWQLMLPQKHRDSVLMALHDEH--GHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKT 958          
BLAST of Thymidine phosphorylase vs. Ensembl Xenopus
Match: ENSXETT00000011934.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:51966053:51967075:1 gene:ENSXETG00000005538.1 transcript:ENSXETT00000011934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 1.634e-36
Identity = 39/98 (39.80%), Postives = 66/98 (67.35%), Query Frame = -1
Query: 2418 KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRI 2711
            ++H +AY SR L   E   + +E+E LA+ + + + R YLLGR+F + TDH P++W+ ++R   +++ RW ++LQ + F ++ R GKL  NADA+SR+
Sbjct:  130 EEHPVAYLSRKLTPAECRYAIVERECLAIKWALESLRYYLLGRQFKLITDHAPLKWMAQNREKNARVTRWFLSLQNFKFSVEHRPGKLQGNADALSRV 227          

HSP 2 Score: 82.4185 bits (202), Expect = 1.634e-36
Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = -2
Query: 2708 FLGLTSYYRKFIKDFSHIVHPLNVLLK--KNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2968
            FLG+  YYR+F+ +F+ +  PL  L K  K    TW+   ++AF  LK  L   P+L  P+F K F++ TDAS V LGAVL Q V GE+
Sbjct:   43 FLGIVGYYRRFVPNFASLASPLTDLTKGSKAGAITWTPEAEEAFLNLKASLCRYPVLIAPNFKKEFLVQTDASEVGLGAVLSQVVNGEE 131          
BLAST of Thymidine phosphorylase vs. Ensembl Mouse
Match: Tymp (thymidine phosphorylase [Source:MGI Symbol;Acc:MGI:1920212])

HSP 1 Score: 313.153 bits (801), Expect = 1.514e-93
Identity = 170/414 (41.06%), Postives = 244/414 (58.94%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVY 5085
            +I  K  G  L   +I  FV  V      + QIGA LMAI+L+GMN +ET+ LT+++A+  ++  W +  W+ ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGR LG TGGT+DKLE+I GF      + M  ILE+ G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E +  L++DVKFG       +E+A  LA+ ++  G SL + +   +  M++PLG  +G+ LE+ E L  L G   PD+++++  +   +L    +  + ++ A ++  A+  G A   F+ ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  +  +  DLG GR R    +  GVG E++   G  + RG PW +V+
Sbjct:   25 LIRLKRDGGHLREADIRNFVHAVIDGRAQDTQIGAMLMAIRLQGMNLEETSVLTRALAESGQQLEWPKA-WHQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFGVTQSPEQMLHILEEVGCCIVGQSAKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEKARELAKMLVRVGVSLGLKVAAALTAMDNPLGRSVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAILWISGQAETQDQGAARVAAALDDGSARRRFQLMLSAQGVDPGLAKALCSGSPTQRRQLLPHAREQEELL--------APAD--GIVECVRALPLARVLHDLGAGRSRAGQPIRPGVGAEVLVDVGQCLSRGTPWLRVH 427          
BLAST of Thymidine phosphorylase vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 55.8398 bits (133), Expect = 6.442e-7
Identity = 29/87 (33.33%), Postives = 45/87 (51.72%), Query Frame = -2
Query: 2708 FLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2968
            F+G    +R  I D+  +V PL+ LLK+   + W++  + +F  LK+ L  +  L  P+   PF L    S V+L A L Q+  G K
Sbjct: 1040 FMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKSFLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRK 1126          
BLAST of Thymidine phosphorylase vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 55.8398 bits (133), Expect = 6.442e-7
Identity = 29/87 (33.33%), Postives = 45/87 (51.72%), Query Frame = -2
Query: 2708 FLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2968
            F+G    +R  I D+  +V PL+ LLK+   + W++  + +F  LK+ L  +  L  P+   PF L    S V+L A L Q+  G K
Sbjct: 1040 FMGFMDSHRDVISDYEDLVGPLHGLLKQKPDWQWNQEHEKSFLALKRALVCALCLSTPNPNLPFYLEVTVSQVSLTASLHQEHSGRK 1126          
BLAST of Thymidine phosphorylase vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 53.1434 bits (126), Expect = 4.548e-6
Identity = 26/74 (35.14%), Postives = 40/74 (54.05%), Query Frame = -2
Query: 2726 YRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQ 2947
            YR F+++F+ I  PL   L  +  + W + +Q+A ++LK+    SP+L  P    PF L TD +   L A L Q
Sbjct: 1080 YRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQ 1153          
BLAST of Thymidine phosphorylase vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 53.1434 bits (126), Expect = 4.548e-6
Identity = 26/74 (35.14%), Postives = 40/74 (54.05%), Query Frame = -2
Query: 2726 YRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQ 2947
            YR F+++F+ I  PL   L  +  + W + +Q+A ++LK+    SP+L  P    PF L TD +   L A L Q
Sbjct: 1080 YRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQ 1153          
BLAST of Thymidine phosphorylase vs. UniProt/SwissProt
Match: sp|P19971|TYPH_HUMAN (Thymidine phosphorylase OS=Homo sapiens OX=9606 GN=TYMP PE=1 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 2.536e-96
Identity = 175/417 (41.97%), Postives = 251/417 (60.19%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN 5094
            +I  K  G  LS  +I  FV  V       AQIGA LMAI+L+GM+ +ET+ LT+++A   ++  W +  W  ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF  +   + M  +L+ +G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E + AL++DVKFG       +E+A  LA++++  G SL + +   +  M+ PLG C+G+ALE+ E L  + G   PD+++++  +   LL       +  + A ++  A+  G AL  F++ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  + ++  +LG GR R  + L  GVG EL+   G  + RG PW +V+ + 
Sbjct:   39 LIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEA-WRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELL--------APAD--GTVELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLRVHRDG 444          
BLAST of Thymidine phosphorylase vs. UniProt/SwissProt
Match: sp|Q5FVR2|TYPH_RAT (Thymidine phosphorylase OS=Rattus norvegicus OX=10116 GN=Tymp PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.688e-93
Identity = 169/414 (40.82%), Postives = 246/414 (59.42%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVY 5085
            +I  K  G  LS  +I  FV  +      + QIGA LMAI+L+GM+ +ET+ LT+++A+  ++  W +  W+ ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGR LG TGGT+DKLE+I GF      + M  ILE+ G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E +  L++DVKFG       +E+A  LA+ ++  G  L + +   +  M++PLG  +G+ LE+ E L  L G   PD+++++  +   +L    +  + ++ A ++  A+  G AL  F+ ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  +  +  +LG GR R    +  GVG EL+   G ++ RG PW +V+
Sbjct:   32 LIRLKRNGGHLSEADIRNFVHALMDGRAQDTQIGAMLMAIRLQGMDLEETSVLTQALAESGQQLEWPKA-WHQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFSVTQSPEQMLQILEEVGCCIVGQSEKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEKARELAKMLVRVGMGLGLQVAAALTAMDNPLGRNVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAILWLSGQAETQDQGAARVAAALDDGSALHRFQLMLSAQGVDPGLARALCSGSPTQRRQLLPHARKQEELLS--------PAD--GIVECVRALPLACVLHELGAGRSRAGQPIRPGVGAELLVDVGQWLSRGTPWLRVH 434          
BLAST of Thymidine phosphorylase vs. UniProt/SwissProt
Match: sp|Q99N42|TYPH_MOUSE (Thymidine phosphorylase OS=Mus musculus OX=10090 GN=Tymp PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.059e-92
Identity = 170/414 (41.06%), Postives = 244/414 (58.94%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCV------RKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVY 5085
            +I  K  G  L   +I  FV  V      + QIGA LMAI+L+GMN +ET+ LT+++A+  ++  W +  W+ ++VDKHSTGGVGDK+S +LAP L+ACG K+PMISGR LG TGGT+DKLE+I GF      + M  ILE+ G  I GQ+  +VP D  LYA RDVTATVDS+PLITASILSKK +E +  L++DVKFG       +E+A  LA+ ++  G SL + +   +  M++PLG  +G+ LE+ E L  L G   PD+++++  +   +L    +  + ++ A ++  A+  G A   F+ ML +QGV   LA +LC       R++LP A   E L          P+D  G V  + A  +  +  DLG GR R    +  GVG E++   G  + RG PW +V+
Sbjct:   25 LIRLKRDGGHLREADIRNFVHAVIDGRAQDTQIGAMLMAIRLQGMNLEETSVLTRALAESGQQLEWPKA-WHQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFGVTQSPEQMLHILEEVGCCIVGQSAKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEKARELAKMLVRVGVSLGLKVAAALTAMDNPLGRSVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAILWISGQAETQDQGAARVAAALDDGSARRRFQLMLSAQGVDPGLAKALCSGSPTQRRQLLPHAREQEELL--------APAD--GIVECVRALPLARVLHDLGAGRSRAGQPIRPGVGAEVLVDVGQCLSRGTPWLRVH 427          
BLAST of Thymidine phosphorylase vs. UniProt/SwissProt
Match: sp|P39142|PDP_BACSU (Pyrimidine-nucleoside phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=pdp PE=1 SV=2)

HSP 1 Score: 286.96 bits (733), Expect = 4.000e-84
Identity = 163/411 (39.66%), Postives = 242/411 (58.88%), Query Frame = 1
Query: 3853 VVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVY 5085
            +V II  K  G  L++EEI +FV   +   I + Q  A  MAI  + M+ +E A+LT +M +  E  + S  +     VDKHSTGGVGD  + +LAP+++A  + +  +SGRGLG TGGTIDKLEAI GF           ++      + GQ+ ++ P DK+LYA+RDVT TV+SIPLI +SI+SKK      A+++DVK G G FMKTEE+A  LA++M+  G ++    + +I DM+ PLG+ IGNALE+ E +  L GE   D+ E++  +  Q++    K  + +E   K++E + +GKALE FK  LK+QG    + D       LP A+Y            ++P+  AG V+ I A+++G+    LG GR  KED+++  VG+ L  K GD +E+G+P   +Y
Sbjct:    3 MVDIIIKKQNGKELTTEEIQFFVNGYTDGSIPDYQASALAMAIFFQDMSDRERADLTMAMVNSGETIDLSAIEGIK--VDKHSTGGVGDTTTLVLAPLVAALDVPVAKMSGRGLGHTGGTIDKLEAIMGFHVELTKDEFIKLVNRDKVAVIGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKTEEDAAELAKAMVRIGNNVGRQTMAVISDMSQPLGFAIGNALEVKEAIDTLKGEGPEDLHELVLTLGSQMVVLAKKADTLDEARAKLEEVMKNGKALEKFKDFLKNQGGDSSIVDDPSK---LPQAAYQ----------IDVPAKEAGVVSEIVADEIGVAAMLLGAGRATKEDEIDLAVGIMLRKKVGDKVEKGEPLVTLY 398          
BLAST of Thymidine phosphorylase vs. UniProt/SwissProt
Match: sp|Q8NVF6|PDP_STAAW (Pyrimidine-nucleoside phosphorylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=pdp PE=3 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 6.163e-84
Identity = 172/447 (38.48%), Postives = 260/447 (58.17%), Query Frame = 1
Query: 3853 VVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITK-IEFLKSAITVKPEKILSEIRVKKYCI 5190
            ++ IIE K  G  L++EEI++F+    K +I + Q  +  MAI  + MN  E A LT +M +  +  + S  D     VDKHSTGGVGD  + +LAP+++A  + +  +SGRGLG TGGTIDKLEAI GF    D      ++ ++   + GQ+ ++ P DK+LYA+RDVT TV+SIPLI +SI+SKK      A+++DVK G G FMKT E+A ALA +M+  G ++  + + +I DMN PLG  IGNALE+ E +  L G+   D+ E++  +  Q++   NK  + EE    + EAI+SG ALE FK  +K+QG  E + D     + LP A Y            E  +  +G+VT + +  +G+ +  LG GR+ KED ++  VG+ L  K GD +E G+    + H N  ++   ++ L S+IT+  + ++S   + K  I
Sbjct:    3 MIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMIDLS--DIKGVKVDKHSTGGVGDTTTLVLAPLVAAVDVPVAKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFVKLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKTLEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMVVLANKAETLEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDH---PERLPQAQYQ----------IEYKAKKSGYVTELVSNDIGVASMMLGAGRLTKEDDIDLAVGIVLNKKIGDKVEEGESLLTI-HSNRQDVDDVVKKLDSSITI-ADHVVSPTLIHKIII 432          
BLAST of Thymidine phosphorylase vs. TrEMBL
Match: A0A068Y394 (Thymidine phosphorylase OS=Echinococcus multilocularis OX=6211 PE=3 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 2.389e-102
Identity = 182/444 (40.99%), Postives = 274/444 (61.71%), Query Frame = 1
Query: 3838 MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALH-GEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIAS----YMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITKIEFL-KSAITVKPE 5151
            MA+ ++  I+  K+ G  LSS EIDY+ K ++++ ++ AQIGAFLMA+  +GM  +E  NLT +M  +S+K  W+   W   VVDKHSTGGVGDK SHILAP+++ACG K+PMISGRGLG+TGGTIDKLE+I G+      + +  +L DSGFFI GQT  +VP D++LY  RDVT TV S+PLITASILSKK  E +R L++D+K G G   +  +E   LA S+I  G+ LD+ +V +I  M+ PLG CIGNALE+AEV   L  G     ++E++  +   ++K     +   +    + EA+  G+A  + +KML +QGV   +A++LC             Y+ ++         + +  +G+++ I+A  +  +   LG GR + +D +++ VG+ L+   GD ++ G+ W  +Y++     +K+E +  SAITV  E
Sbjct:    1 MATISISGILSKKANGGSLSSTEIDYYTKELAEDNVNIAQIGAFLMAVFTRGMTTEEVTNLTAAMVSHSDKLRWNDQQWAKSVVDKHSTGGVGDKTSHILAPMIAACGGKVPMISGRGLGVTGGTIDKLESIDGYSASIGEERLKNMLNDSGFFIVGQTERLVPADQQLYNYRDVTGTVPSVPLITASILSKKLCEGLRVLVVDIKLGSGALFQNLDEVRELANSLITVGRKLDLKVVAVISWMDQPLGSCIGNALEMAEVFSILSGGSFQGRLRELVLTLGENMMKATELTTDRAKARVMMLEAVRDGRAQMAMRKMLVNQGVSSGVAEALCSPPPPDCIDPIDYYLGVMGKMANGKKSVKAPRSGYISDIDAGTIAQVVWRLGAGRNKPDDAIDHTVGIRLLKHVGDAVKSGEVWCIIYYKEKELDSKLEIMTHSAITVLEE 444          
BLAST of Thymidine phosphorylase vs. TrEMBL
Match: A0A0R3UIX0 (Thymidine phosphorylase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7410 PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 3.830e-102
Identity = 191/442 (43.21%), Postives = 268/442 (60.63%), Query Frame = 1
Query: 3853 VVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGE-MSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILP------IASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITKIEFL-KSAITVKPEK 5154
            V  ++  K++G  LS ++ D  V  + K  I   Q+GAFLMA+  KGM  +E ANLT SM  YS+K  W+   W   VVDKHSTGGVGDKISHI+AP++SACG K+PMISGRGLGITGGTIDKLE+IKG+      + +  +L ++GFFI GQT  +VP D++LY  RDVT TV S+PLITASILSKK  E +R L+MD+K G G   +T EE   LA S++  G+ LD+ +V +I  M+ PLG CIGNALE+AEV   L G+ +   + ++   +   +L   N   +       + +A+   KA  +  KML SQGV   +A +LC     P      I  Y++++       T I S   GF++ I+A  +  +   LG GR + +D++++ VG+ L+   GD +E G+ W  VYH+ D    K+  +  SA+TV  E+
Sbjct:    3 VSEMLNLKARGQELSKKDYDDLVNHLCKKTISAVQLGAFLMAVYTKGMTPEEVANLTSSMVSYSDKLRWNDQQWAKVVVDKHSTGGVGDKISHIIAPVISACGGKVPMISGRGLGITGGTIDKLESIKGYSANIPEEKLKSVLNEAGFFIIGQTERLVPADRQLYKYRDVTGTVASVPLITASILSKKLCEGLRGLVMDIKLGSGALFQTLEEVEELANSLVTVGRKLDLKVVAVISLMDEPLGDCIGNALEMAEVFTILAGKPLQGRLGDLTLTIGQSMLSAANLVPNETRARNALTDALRDRKAQAAMCKMLVSQGVDSEMAVALCSPP--PEDCTDDIDHYLQVMGKMANKKTPITSPRGGFISQIDAGTIAQVVWRLGAGRDKPDDEIDHTVGIRLLKHVGDPVEEGETWCIVYHKEDTLDAKLGIMTHSAVTVLNEE 442          
BLAST of Thymidine phosphorylase vs. TrEMBL
Match: A0A5G3K6M9 (Thymidine phosphorylase OS=Xenopus tropicalis OX=8364 GN=MGC115716 PE=3 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 1.469e-101
Identity = 183/432 (42.36%), Postives = 262/432 (60.65%), Query Frame = 1
Query: 3850 NVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN-DLEITKIEFLKSAITV 5142
             +  II  K  GL L++EEI + V+  ++    ++Q+GA LMA++L+GM+ +ET  LTK          W + +W   +VDKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF P      M  IL   G  I GQ+  +VP DK  Y +RDVTATVDS+PLITAS++SKK  E++ AL++DVKFGE     T EEA  LA S++  G SL +    L+ +M+SP+G C+GN LE+ E L  + G    D++E++      LL    + SS    ++KI  A++ G AL+ F+ ML++QGV   +A +L     L  AS+ ELL + + H   + S   G V  I A+ +      LG GR R  D +N+ VG EL+   G  +E+G PW ++++EN  L+  + ++L+ AI +
Sbjct:   48 RIADIIAKKRDGLPLTAEEIKHVVQAATRGHAQDSQLGALLMAVRLRGMDPEETLALTKEFVASGCVLQWPK-EWSGILVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGFSPEQSPAQMLEILRSVGCCIVGQSKDLVPADKIFYEMRDVTATVDSLPLITASVISKKVAENVSALILDVKFGEAAQSPTLEEARILANSLVSAGVSLGIPTSALVSNMDSPIGRCVGNTLEVIEALECMEGAGPDDLRELVMHTGGHLLWLCGQASSETHGSEKIARALADGSALQCFRGMLEAQGVPSEIARTLSSTSNLRTASHQELLRNVRHHELSVLSSSPGTVKLIRAKPIAETLNALGAGRSRANDPINHSVGAELLVSMGQHVEQGDPWIRIHYENPQLQDEQRKYLQEAICI 478          
BLAST of Thymidine phosphorylase vs. TrEMBL
Match: A0A1L8GZP9 (Thymidine phosphorylase OS=Xenopus laevis OX=8355 GN=XELAEV_18017943mg PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 9.522e-101
Identity = 191/433 (44.11%), Postives = 262/433 (60.51%), Query Frame = 1
Query: 3850 NVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKE-IIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHEN-DLEITKIEFLKSAITV 5142
             +  II  K  GL LS+EEI + V+  ++    ++Q+GA LMA++L GM+ QET  LTK          W   +W   +VDKHSTGGVGDK+S  LAP L+ACG K+PMISGRGLG TGGT+DKLE+I GF P      M  IL   G  I GQ+  +VP DK  Y +RDVTATVDS+PLITAS++SKK  E+I AL++DVKFGE     T EEA  LA+S++  G SL +    L+ +M+SP+G C+GN LE+ E L  + G    D++E +IH   H LL    + SS    ++KI +A+  G AL+ F++ML+ QGV   +A +L     L  AS+ ELL  KK          +G V  I A+ +  I   LG GR +  D +N+ VG EL+   G  +E G PW ++++EN  L+  + E+L+ AI +
Sbjct:   18 RIADIIAKKRDGLPLSAEEIRHVVQAATRGHAQDSQLGALLMAVRLCGMDPQETLALTKEFVASGCVLQWP-TEWNGVLVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFSPQQSPAQMLEILRSVGCCIVGQSKDLVPADKIFYEMRDVTATVDSLPLITASVISKKVAENISALILDVKFGEAAQSPTLEEARILAKSLVNAGVSLGIPTSALVSNMDSPIGRCVGNTLEVKEALECMEGAGPGDLRELVIHTGGH-LLWLCGQASSESHGSEKIAKALDDGSALQCFREMLEVQGVPSDIARTLSSTSKLRQASHQELLRVKK----------SGTVKLIRAKPIAEILNALGAGRSKANDPINHSVGAELLVSLGQHVEEGDPWIRIHYENPQLQDEQREYLQEAICI 438          
BLAST of Thymidine phosphorylase vs. TrEMBL
Match: A0A5N5LGT0 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00086280 PE=4 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 6.630e-100
Identity = 178/418 (42.58%), Postives = 266/418 (63.64%), Query Frame = 1
Query: 3838 MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHE 5091
            M + +   +I  K  G  LS+EEI  F++ V  + I E+QIGA LMAI+LK M  +ET  LTK M    E F+W + +W   VVDKHSTGGVGDK+S  LAP L+ACG K+PMISG GL  TGGT+DKLE+I  F     ++ +  IL+D G  I GQT+++VP D+ LYA+RD+TATVDS+PLITASI+SKK  E + AL++DVKFG+    K  + A +LA+S++  G SL +    ++  M++P+G C+GNA+E+ E L  L G    D+K ++  +  Q+L+   ++++ +E  + I E + +GKAL+ F+ ML++QGV   ++ SLC  K    A Y + L  +  + TE+ +   G V  I+   + ++   LG GR +  + +N+ VG EL+   G  I+RG+PW +++H+
Sbjct:    5 MDASSFPEMIRRKRDGGQLSAEEIHAFIEGVKSHTIQESQIGAMLMAIRLKNMVAEETMVLTKEMMMSGEVFHWPK-EWAGLVVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGHGLAHTGGTLDKLESIPDFNIHQSVEQVKQILQDVGCCIVGQTDTLVPADRVLYALRDITATVDSVPLITASIMSKKAAEGLNALVLDVKFGKAALYKDLDSARSLAQSLVTVGNSLGIKTGAVLSRMDAPIGRCVGNAVEVYEALECLKGRGPDDLKTLVTSLGGQVLQMSGRSATLKEGKEAISEVLKNGKALQKFQAMLEAQGVTAAISHSLCSEK----AEYFKYL-KRAQYQTELKATDDGTVLGIDGMPIAMVLHKLGAGRSKAGEPINHSVGAELLVDPGQQIKRGQPWIRIHHD 416          
BLAST of Thymidine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000052546.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:13031363:13036570:1 gene:ENSAMXG00000033629.1 transcript:ENSAMXT00000052546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 2.418e-59
Identity = 82/308 (26.62%), Postives = 134/308 (43.51%), Query Frame = -1
Query: 1971 DHVIAYASRSLKLHEKNNSNIEK---ETLALVYGIA-TFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRI----QNEDKDIVK----------------------AEDTIFAVIKAS-------NYLTELQN*QRRDSQLKQFFEQAISVKKKDWKQIESENGKY-----------IIHDGILKCL---KNNEEL--TIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKN---------TCDKIKVPLK 2708
            + VIAYASR L+  EKN+ N      E LAL + +   FR +L+  KF V TDHNP+++L        +  RW   + EY+F I ++ G+ NANAD +SR+    + E KD  K                       E  +   ++AS           E++  Q+ D  ++  +   +  K     +  +   K            + H  + +C+   ++ E +   IV E  +  +    H+   GGH   R TL  ++  Y+WP++ ++V+DW K CK C   K+         TC  +  PL+
Sbjct: 1048 ERVIAYASRGLRGSEKNDKNYSAFKLELLALKWAVTEKFRDFLMFAKFSVVTDHNPLRYLDSANLGVVEQ-RWVAQMAEYNFDISYKPGRQNANADVLSRLPAHEEPEAKDTGKDFILINTEEVRACLWPAAERREVEPAVHVAVQASIRKGVSGYSWGEIEEQQKCDPDIRPVYSAVLRGKNLSPAEQRAMTPKLRKLSKQFDRLKLRHGALFRCICHPRDGEGVWQLIVPESLQRKVYESQHEH--GGHFGERSTLEMMRQSYYWPSMSRDVQDWIKQCKRCALAKDVLPRNRAPMTCSSVSAPLE 1352          

HSP 2 Score: 84.7297 bits (208), Expect = 2.418e-59
Identity = 42/93 (45.16%), Postives = 54/93 (58.06%), Query Frame = -2
Query: 2714 EFLGLTSYYRKFIKDFSHIVHPLNVLL-------KKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGG 2971
            + LG  SYYR+F+  F+ +  PL+ L+       +     TWS   Q AFD LK  L + P+L  PDFT+PF+L TD S   LGAVL QK GG
Sbjct:  954 QVLGFMSYYRRFVPKFAQLAKPLHALVGGKMNRGRATGPITWSGECQTAFDKLKGCLMSPPVLAYPDFTQPFILTTDGSLHGLGAVLSQKQGG 1046          

HSP 3 Score: 83.9593 bits (206), Expect = 2.418e-59
Identity = 45/108 (41.67%), Postives = 66/108 (61.11%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMNFVLRGIWHT--LVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  APA FQR M  VL  +     LVY++ IIIFS +F  H + +E VF RL+   LK+KP KC L K EV ++G     +G+Q + + ++ +E +PIP+   ++R
Sbjct:  846 FGLCNAPATFQRLMGVVLGDLAFDILLVYLDDIIIFSRDFKSHCERLELVFNRLRHHGLKLKPSKCFLLKPEVKFLGHIISAKGVQVDAEKVRVLETWPIPKTVKDIR 953          
BLAST of Thymidine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 2.416e-55
Identity = 77/304 (25.33%), Postives = 131/304 (43.09%), Query Frame = -1
Query: 1974 KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRI----------------------QNEDK--------DIVKAEDTIFAVIKASNYLT------------ELQN*QRRDS----------QLKQFFEQAISVKKKDWKQIESENGKYIIHDGIL-KCLKNNEELT----IVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPL 2711
            ++ VIAYASR L   E      + E LAL + +   F  +L G KF V TD+NP++++M      +   RW   L  +DF I++R G  NANAD +SR+                      Q+++K        D   +E        A  +L+            E++  QR D           Q  +    A +   +  K +  E  K ++ D IL + +++ +  +    ++ EK R  +    HD +  GH    +T + ++ +++WP +  +VK WC+ C+ C  RK     ++ PL
Sbjct:  571 RERVIAYASRGLNPAETRYPAHKLEFLALKWAVTDKFYDHLYGHKFSVLTDNNPLKYVMTTAKLDATGQRWVAQLSMFDFDIRYRQGGCNANADGLSRMPASEVAEALHTCPQLVPTSSQKQSQEKGDSAERAVDGTSSESGSNKEPSADQFLSAGSDALPSMSKQEIRAAQRTDPVIGPVLYYKCQYAKPKRSARTQSNEQEKLLRKEWKKLVVKDDILFRHVRDRQRGSFYQLVLPEKFRGYVKSSLHDES--GHFGVERTFALVRERFYWPRMFNDVKTWCEQCERCCLRKTPTAGLRAPL 872          

HSP 2 Score: 85.1149 bits (209), Expect = 2.416e-55
Identity = 43/107 (40.19%), Postives = 66/107 (61.68%), Query Frame = -1
Query: 2973 FGLT*APANFQRGMN--FVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEV 3287
            FGL  +P+ FQR M   F        L+Y++ I+IFS  F EHL+ ++ VF RL+   LK+KP KC L + EV+Y+G    ++G++T+P  I KV  + +P+N  E+
Sbjct:  362 FGLQNSPSTFQRLMTCCFGDLNFESLLIYLDDIVIFSRTFDEHLERLQMVFDRLRKYGLKLKPQKCHLLRREVLYLGHVVSSDGIKTDPDKISKVAGWKVPENRHEL 468          

HSP 3 Score: 78.5666 bits (192), Expect = 2.416e-55
Identity = 41/106 (38.68%), Postives = 62/106 (58.49%), Query Frame = -2
Query: 2702 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNK---------------FTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQ-KVGGEKIM 2971
            +FLG   YYR+FI+ ++ I  PL  L   + +               F W++  ++AF TLK KLTT+P+L   D+++PF+L TDAS   LGAVL Q + G E+++
Sbjct:  470 QFLGFAGYYRRFIEGYASIAAPLYRLTSGDPRKKKRGRKGPPAVGLPFIWTEECENAFQTLKTKLTTAPVLGYADYSQPFVLQTDASLAGLGAVLAQVQDGRERVI 575          
BLAST of Thymidine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000048059.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001896.1:45492:48938:1 gene:ENSAMXG00000034382.1 transcript:ENSAMXT00000048059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.057e-54
Identity = 84/294 (28.57%), Postives = 133/294 (45.24%), Query Frame = -1
Query: 2004 KDHVIAYASRSLKLHEKNNSNIEK---ETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSR------IQNEDKDIVKAE-------DTIFAVIKASNYLTEL-----QN*QRRDSQLKQ--FFEQAISVKKKD-----------------W--KQIESEN--------GKYIIHDGIL-KCLKNNE------ELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRK 2711
            ++ VIAYASR L+  E+N++N      E LAL + I   F +YLLG  F VYTD+NP+  L   R  A +  RW   L  Y F++K R+GK N NAD +SR      +  ED D ++         + + A +  S     +     Q      S++ Q    E+   V+++D                 W  +Q E+ N         +  + +G+L +C+++        +L +     + A     HD    GH +  KTL  L++ Y+WP +  +V+ WC  C+ C  RK
Sbjct:  469 QEKVIAYASRGLQGAERNDANYSSFKLELLALKWAITEKFHEYLLGSDFTVYTDNNPLAHLATARLGAVEQ-RWVARLASYRFQVKHRSGKSNVNADVLSRYPVGAAVVPEDDDGMEVPGFQEVTVEVVQACLSGSCLAASIGPVPDQPQPSGGSRIGQDWTMERWAEVQQQDPVISRVLYVFQTKRPLRWDERQWEAPNVLRLLKEMPRLQLQEGVLYRCIQDPNTNMPRYQLLLPQSLQKEAFTC-CHDKM--GHFATEKTLKTLQINYYWPHMAIDVQKWCSECQQCTLRK 758          

HSP 2 Score: 82.4185 bits (202), Expect = 2.057e-54
Identity = 45/98 (45.92%), Postives = 60/98 (61.22%), Query Frame = -2
Query: 2708 FLGLTSYYRKFIKDFSHIVHPLNVLL-----KKNNK------FTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2968
            FLGL  YYR+F+K FS I  PL+ LL     KK+        + WS   + AF++LK+ L  +P+L   DFT PF+L TDAS+  LGAVL QK  G++
Sbjct:  373 FLGLAGYYRRFVKGFSQIAAPLHRLLGGHPTKKSKAKALCPPWKWSNECETAFESLKQGLVQAPVLAFADFTLPFLLYTDASHRGLGAVLSQKQDGQE 470          

HSP 3 Score: 73.9442 bits (180), Expect = 2.057e-54
Identity = 39/108 (36.11%), Postives = 63/108 (58.33%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMNFVL--RGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  APA+FQR M   L  +     L+Y++ +I+F+ +F  HL  ++ VF RL    LK+KP KC+L +S V Y+G      G+  +P  +  V+ + +P++  E+R
Sbjct:  264 FGLCNAPASFQRLMESCLGDQNYQSLLIYLDDVIVFAADFNSHLDRLDFVFSRLSQQGLKLKPDKCKLLRSSVQYLGHVVSDAGIAPDPDKVMAVQQWRVPKSITELR 371          
BLAST of Thymidine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000051531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:23481988:23484356:-1 gene:ENSAMXG00000035923.1 transcript:ENSAMXT00000051531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 2.347e-52
Identity = 82/293 (27.99%), Postives = 132/293 (45.05%), Query Frame = -1
Query: 2004 KDHVIAYASRSLKLHEKNNSNIEK---ETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSR------IQNEDKDIVKAE-------DTIFAVIKASNYLTEL-----QN*QRRDSQLKQ--FFEQAISVKKKD-----------------W--KQIESEN--------GKYIIHDGIL-KCLKNNEE-----LTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRK 2711
            ++ VIAYASR L+  E+N++N      E LAL + I   F +YLLG  F VYTD+NP+  L   R  A +  RW   L  Y F++K R+GK N NAD +SR      +  ED D ++         + + A +  S     +     Q      S++ Q    E+   V+++D                 W  +Q E+ N         +  + +G+L +C+++        L ++ +  +       HD    GH +  KTL  L++ Y+WP +  +V+ WC  C+    RK
Sbjct:  208 QEKVIAYASRGLQGAERNDANYSSFKWELLALKWAITEKFHEYLLGSDFTVYTDNNPLAHLATARLGAVEQ-RWVARLASYRFQVKHRSGKSNVNADVLSRYPVGAAVVPEDDDGMEVPGFQEVTVEVVQACLSGSCLAASIGPVPDQPQPSEGSRIGQDWTMERWAEVQQQDPVISRVLYVFQTKRPLRWDERQWEAPNVLRLLKEMPRLQLQEGVLYRCIQDPNTNMPRCLLLLPQSLQKEAFTCCHDKM--GHFATEKTLKTLQINYYWPHMAIDVQKWCSECQQYTLRK 497          

HSP 2 Score: 79.7221 bits (195), Expect = 2.347e-52
Identity = 41/98 (41.84%), Postives = 58/98 (59.18%), Query Frame = -2
Query: 2708 FLGLTSYYRKFIKDFSHIVHPLNVLLKKNN-----------KFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2968
            FLGL  YYR+F+K FS    PL+ LL  ++            + W+   + AF++LK+ L  +P+L   DFT PF+L TDAS+  LGAVL QK  G++
Sbjct:  112 FLGLAGYYRRFVKGFSQTAAPLHRLLGGHSIKKSKAKALCPPWKWANECETAFESLKQGLVQAPVLAFADFTLPFLLYTDASHRGLGAVLSQKQDGQE 209          

HSP 3 Score: 73.1738 bits (178), Expect = 2.347e-52
Identity = 39/108 (36.11%), Postives = 62/108 (57.41%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMNFVL--RGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  APA+FQR M   L  +     L+Y++ +I+F+ +F  HL  ++ VF RL    LK+KP KC+L +S V Y+G      G+  +P  +  V+ + +P+   E+R
Sbjct:    3 FGLCNAPASFQRLMESCLGDQNYQSLLIYLDDVIVFAADFNSHLDRLDFVFSRLSQQGLKLKPDKCKLLRSSVQYLGHVVSDAGIAPDPDKVTAVQQWRVPKFITELR 110          
BLAST of Thymidine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000041345.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:32334536:32339002:1 gene:ENSAMXG00000029230.1 transcript:ENSAMXT00000041345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.208 bits (500), Expect = 3.375e-50
Identity = 148/477 (31.03%), Postives = 238/477 (49.90%), Query Frame = -1
Query: 1908 FGLT*APANFQRGMNFVLRGIW--HTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR-----ISWFDQLL*KIY*RLFAYRSSIKRITKEKQQIYM-EQKSARCV*YTKEKIDNLTYITVSRFYKTVHAND*CQ*CCIGSGVGSKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYL----TELQN*QRRDSQLK-QFFEQAISVKKKDWKQIESENGKYIIHDGILKCLKNNE---ELTIVLE-KHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPLKXXXXXXXXXXXXXMDIIGPLP 3287
            FG+  A A FQR M+ VL  +      VYIN I+++S+   +HL  +E VF+ L  A L +   KC L +  ++++G     EG+ T P  ++ ++A+P P++  E++       W+ + +       F+ R++I    K+K   ++  Q+  +     K+ +     +T   F +            +G+ V S+G    +HV+AYASR L+  E+N S  EKE LA+V+ +  +R YL GR F V TDH+ + W+  H    S+L RW+I LQ +DF +++R GK N   D +SRI +   + V A      V  +S+ L     E+   Q  D  L+ Q  E      +KD     ++N      D + + + N +    L +V+  +HR A L   HD  L GHL   KTL RL    +WP+I ++V  +CKSC++C   K    K+   L+       P  M  +D++GPLP
Sbjct:  752 FGIKNAAATFQRLMDSVLVNLKGKSCFVYINDIVVYSSTIEQHLGHLEEVFRCLHQAGLTLNLRKCNLLQRSLIFLGHVISGEGICTEPGKVEAIQAFPEPRSIKELQRFLGMAGWYHRFI-----THFSERAAILNALKKKNAPWIWTQECQKAFEDIKQALITAPVLTPPNFSEPFQIQTDASDQGLGA-VLSQGTDGLEHVVAYASRLLQGAERNYSTAEKECLAVVWAVEKWRVYLEGRHFTVITDHSALSWVFNHPKPTSRLTRWAIRLQTFDFSVQYRKGKCNIVPDTLSRIPDRMTEGVMAP---CQVTGSSDGLPVDWAEIARAQEVDGTLQPQRDETGNQETRKDRIHFVTKN------DILFRAVPNQQLGHTLQVVVPVQHREAFLQYAHDNPLSGHLGQMKTLLRLLNIAYWPSIRRDVWTYCKSCEICQKYKPRISKLSGRLQ-STPVVEPGYMLGVDLMGPLP 1212          
BLAST of Thymidine phosphorylase vs. Ensembl Sea Lamprey
Match: tymp (thymidine phosphorylase [Source:ZFIN;Acc:ZDB-GENE-100415-1])

HSP 1 Score: 148.673 bits (374), Expect = 2.127e-41
Identity = 75/134 (55.97%), Postives = 97/134 (72.39%), Query Frame = 1
Query: 3841 ASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGF 4242
            A+  +  II  K  G +L   +I++FV+ V+K  I E+QIGA LMAI+L+GMN  ETA LT++M    E+  W + +W+  VVDKHSTGGVGDK+S  LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF
Sbjct:    8 AAPQIPEIIRIKRDGGVLKDADIEFFVQGVAKGTIQESQIGAMLMAIRLQGMNASETAVLTRAMLSSGERLPWPK-EWHGLVVDKHSTGGVGDKVSLSLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGF 140          
BLAST of Thymidine phosphorylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008840.1 (pep scaffold:Pmarinus_7.0:GL476434:297925:301626:1 gene:ENSPMAG00000008002.1 transcript:ENSPMAT00000008840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 3.412e-12
Identity = 38/113 (33.63%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 4759 GKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKP--HVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHE 5091
            G AL  F+ ML +QGV+  +A  LC           +     KP  + T +  D  GFV +I+A  + I+ + LG GR +  D +N+ VGV+++   G  + RG+ W +V+HE
Sbjct:    2 GSALAKFEAMLTAQGVEAGVARRLCRDS--------DFSGTMKPAKYSTYLSVDQDGFVQSIDAMALAIVLQKLGVGRSQVGDPVNHSVGVQILAPVGHRLTRGEKWIRVFHE 106          
BLAST of Thymidine phosphorylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004123.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 4.551e-6
Identity = 37/150 (24.67%), Postives = 70/150 (46.67%), Query Frame = -1
Query: 1872 QLKQFFEQAISVKKKDWKQIESENGKYIIHDGILKCLKNNEE---LTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPLKXXXXXXXXXXXXXMDIIGPLPVISLPTPDIDLL 2312
            Q+ +F E  +  K K  + +     K+++   +L  +    E   + ++ E  +  +LM  H     GH   +KT+ +L+  Y+W  +  +VK+   SC VC  R     ++ +P   +   + P  +  +D++GPLPV S     + LL
Sbjct:   26 QMSEFPEHILHNKNKK-RALRKCANKFVLKGKVLYYVGRKRERRRMVVMDEDEKRNILMSVHGA---GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVC--RNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLL 169          
BLAST of Thymidine phosphorylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004121.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.198e-6
Identity = 35/141 (24.82%), Postives = 67/141 (47.52%), Query Frame = -1
Query: 1899 QLKQFFEQAISVKKKDWKQIESENGKYIIHDGILKCLKNNEE---LTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPLKXXXXXXXXXXXXXMDIIGPLPVIS 2312
            Q+ +F E  +  K K  + +     K+++   +L  +    E   + ++ E  +  +LM  H     GH   +KT+ +L+  Y+W  +  +VK+   SC VC  R     ++ +P   +   + P  +  +D++GPLPV S
Sbjct:   26 QMSEFPEHILHNKNKK-RALRKCANKFVLKGKVLYYVGRKRERRRMVVMDEDEKRNILMSVHGA---GHFGQKKTILKLEADYYWLGMISDVKNLIASCGVC--RNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTS 160          
BLAST of Thymidine phosphorylase vs. Ensembl Nematostella
Match: EDO43698 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXX2])

HSP 1 Score: 318.931 bits (816), Expect = 3.142e-96
Identity = 186/473 (39.32%), Postives = 283/473 (59.83%), Query Frame = 1
Query: 3838 MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGF-FPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFM-KTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRK-----ILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITKIEFLKSAITV----KPEKILSEIRVKKY--CIHLNKLSVFT 5217
            M+S  +  +I  K  G  L++E+I +FV+ V   +I ++QIGA LMA+ L+G+N +ET +LT++M D  E   W + +W   + DKHSTGGVGDK+S  LAP L+ CG+K+PMISGRGLG TGGT+DKLE+I G+ F L  ++ M   L D G  I GQT+++ P D+ LY++RD+T TV S PLI +SI+SKK  E++ AL++DVK G   F  KT E A   A ++ +T   L +    LI +M+ P+G  +GN++E+AE +R L+G+   D++E++      LLK +NK  S EE   KI  ++ +G AL  F++ML + GV    A++LC        +LP+A          P  TE+ ++  G V  INA     +   LG GR +  D +++ VG+ L  + G ++ +G  W  V+H+ +L+   IE L+ AI +    K E +  E R+ +    + + K S+FT
Sbjct:    1 MSSFRIEELIALKRDGFDLTAEQIKHFVERVVAKDIGDSQIGAMLMAMFLRGLNSEETVHLTRAMIDTGELLKWPE-EWKGSIGDKHSTGGVGDKVSLPLAPALAVCGVKVPMISGRGLGHTGGTLDKLESIPGYRFGLSPVE-MKKSLTDVGCCIAGQTDTLAPADRVLYSLRDITGTVASNPLIASSIMSKKASENLDALVLDVKCGRAAFTAKTPELARIFAVTLYKTCAGLGIKCAALITNMDHPIGLTVGNSVEVAESVRCLNGQGPEDLQELVCAQGGHLLKALNKVDSAEEGFNKIKTSLHNGTALRKFQEMLSAHGVSPDTANALCTPGADPYVVLPLA----------PQKTELRANKPGIVRDINAMACASVCGRLGAGRQKSTDAVDHSVGLILHVRVGQYVHKGDVWVCVHHKGNLDKEGIECLEKAIMIVESEKTESLPVESRIIEVIDSLSVRKSSLFT 461          
BLAST of Thymidine phosphorylase vs. Ensembl Medaka
Match: TYMP (thymidine phosphorylase [Source:NCBI gene;Acc:101159551])

HSP 1 Score: 280.796 bits (717), Expect = 8.248e-83
Identity = 163/428 (38.08%), Postives = 237/428 (55.37%), Query Frame = 1
Query: 3862 IIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDL-EITKIEFLKSAITV 5142
            +I  K  G  L+ E+I  F+  V+   I + Q GA LMAI  +GM   ET   T+ M    E  +W   +W   +VDKHSTGGVGDK+S +LAP L+ACG K+PMISGRGL  TGGT+DKLE+I GF      + +  IL   G  I GQT  +VP D+ LYA+RD T+TVDS+PLIT SI+SKK  E + AL++DVKFG     K ++ A  LA+ ++  G  L +    ++  M+  +G  +GN+LE+ E L  L G    D+ E+   +   LL      S   E  +++ +A+  G AL  F+ M+++QGV +  A+ LC         Y ++   K  H  E+ +   G V  I+   V  +   LG GR    D +N+ VG EL+      +  G PW ++++E+      +I+ L+ A+TV
Sbjct:    7 LIRKKRDGGQLTDEDIRVFIGAVTGKTIQDCQTGAMLMAIWQRGMVTAETTTFTREMMSSGEVMSWPD-EWRGLMVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLAHTGGTLDKLESIPGFQIQQSSEQIRNILGSVGCCIVGQTERLVPADRVLYALRDATSTVDSLPLITGSIISKKGAESLSALVLDVKFGRAALYKDQQGARELADMLMSAGNGLGIRTGAVLSRMDGVIGRRVGNSLEVMECLETLKGNGPDDLMELTTTLGGLLLTMTGAASDLSEGRRRLSDAVIGGAALSKFQAMMEAQGVAKETAEELCSAH----TDYFKVF-RKSEHQMELTAAADGIVCDIDGMVVAQVLHKLGAGRSMAGDPVNHSVGAELLVSLDQRVRTGSPWLRLHYEDPAPSPDQIQQLQKALTV 428          
BLAST of Thymidine phosphorylase vs. Ensembl Medaka
Match: ENSORLT00000041674.1 (pep primary_assembly:ASM223467v1:5:30088905:30092924:1 gene:ENSORLG00000022054.1 transcript:ENSORLT00000041674.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.697e-51
Identity = 80/293 (27.30%), Postives = 130/293 (44.37%), Query Frame = -1
Query: 1974 IAYASRSLKLHEKNNSN---IEKETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYLTELQN*QRRD-------SQLKQFFEQAISVKKKD---------------------------------------WKQIESENGKYIIHDGILKCLKNNEELTIVL-EKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPL 2699
            IAYASR LK  E+N  N   ++ E LAL + +   FR+YLLG   +V+TD+NP+ +L   +  A +  RW   L  +D++IK+R+G++N NADA+SR  N       AE  +  +   S+   +LQ  Q +         QL   F Q  + + +D                                       WK +   +G  +++  +L      E   ++L E     +L Q H     GH    +TL+ L+ + +WP + ++V  WC++C+ C   K+       PL
Sbjct:  647 IAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAKLGAMEQ-RWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHS----SAE--VGNMAPGSSLPRDLQQVQVQPVLAHCEMEQLMPVFPQRTTAEVQDLQVSDPVLASVLPFWRDQRYPNYSEREGLSKVALTLLRQWKNLAEVDG--LVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHH--GHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAKDNSRSHSAPL 928          

HSP 2 Score: 78.5666 bits (192), Expect = 1.697e-51
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = -2
Query: 2714 FLGLTSYYRKFIKDFSHIVHPLNVLL-------KKNNKFT-----WSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGG 2968
            FLG  SYYR+F++ F+ +  PL+ L+        +  K +     W+   Q  FD LK+KLT++P+L   DFT PF+L  DAS+  LGAVL Q+ GG
Sbjct:  546 FLGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKLTSAPVLAYADFTLPFILEVDASHNGLGAVLSQEQGG 642          

HSP 3 Score: 71.2478 bits (173), Expect = 1.697e-51
Identity = 39/108 (36.11%), Postives = 59/108 (54.63%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMN--FVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  AP  FQR M   F  +     L+Y++ I++FS+   EHL+ +E V  RL+  KL++K  KC   + EV Y+G     +G+ T+P  I+ V  +  P    E+R
Sbjct:  437 FGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELR 544          
BLAST of Thymidine phosphorylase vs. Ensembl Medaka
Match: ENSORLT00000032171.1 (pep primary_assembly:ASM223467v1:18:2114932:2117958:1 gene:ENSORLG00000025397.1 transcript:ENSORLT00000032171.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 3.974e-50
Identity = 79/293 (26.96%), Postives = 129/293 (44.03%), Query Frame = -1
Query: 1974 IAYASRSLKLHEKNNSN---IEKETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYLTELQN*QRRD-------SQLKQFFEQAISVKKKD---------------------------------------WKQIESENGKYIIHDGILKCLKNNEELTIVL-EKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPL 2699
            IAYASR LK  E+N  N   ++ E LAL + +   FR+YLLG   +V+TD+NP+ +L   +    +  RW   L  +D++IK+R+G++N NADA+SR  N       AE  +  +   S+   +LQ  Q +         QL   F Q  + + +D                                       WK +   +G  +++  +L      E   ++L E     +L Q H     GH    +TL+ L+ + +WP + ++V  WC++C+ C   K+       PL
Sbjct:  555 IAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAKLGEMEQ-RWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHS----SAE--VGNMAPGSSLPRDLQQVQVQPVLAHCEMEQLMPVFPQRTTAEVQDLQVSDPVLASVLPFWRDQRYPNYSEREGLSKVALTLLRQWKNLAEVDG--LVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHH--GHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAKDNSRSHSAPL 836          

HSP 2 Score: 75.485 bits (184), Expect = 3.974e-50
Identity = 40/97 (41.24%), Postives = 56/97 (57.73%), Query Frame = -2
Query: 2714 FLGLTSYYRKFIKDFSHIVHPLNVLL-------KKNNKFT-----WSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGG 2968
            FLG  SYYR+F++ F+ +  PL+ L+        +  K +     W+   Q  FD LK+KLT++P+L   DFT PF L  DAS+  LGAV  Q+ GG
Sbjct:  454 FLGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKLTSAPVLAYADFTLPFFLEVDASHNGLGAVFPQEQGG 550          

HSP 3 Score: 71.633 bits (174), Expect = 3.974e-50
Identity = 39/108 (36.11%), Postives = 59/108 (54.63%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMN--FVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  AP  FQR M   F  +     L+Y++ I++FS+   EHL+ +E V  RL+  KL++K  KC   + EV Y+G     +G+ T+P  I+ V  +  P    E+R
Sbjct:  345 FGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELR 452          
BLAST of Thymidine phosphorylase vs. Ensembl Medaka
Match: ENSORLT00000032005.1 (pep primary_assembly:ASM223467v1:7:31190450:31194463:1 gene:ENSORLG00000029990.1 transcript:ENSORLT00000032005.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.314e-49
Identity = 80/293 (27.30%), Postives = 130/293 (44.37%), Query Frame = -1
Query: 1974 IAYASRSLKLHEKNNSN---IEKETLALVYGIAT-FRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYLTELQN*QRRD-------SQLKQFFEQAISVKKKD---------------------------------------WKQIESENGKYIIHDGILKCLKNNEELTIVL-EKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPL 2699
            IAYASR LK  E+N  N   ++ E LAL + +   FR+YLLG   +V+TD+NP+ +L   +  A +  RW   L  +D++IK+R+G++N NADA+SR  N       AE  +  +   S+   +LQ  Q +         QL   F Q  + + +D                                       WK +   +G  +++  +L      E   ++L E     +L Q H     GH    +TL+ L+ + +WP + ++V  WC++C+ C   K+       PL
Sbjct:  645 IAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAKLGAMEQ-RWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHS----SAE--VGNMAPGSSLPRDLQQVQVQPVLAHCEMEQLMPVFPQRTTAEVQDLQVSDPVLASVLPFWRDKRYPNYSEREGLSKVALTLLRQWKNLAEVDG--LVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHH--GHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAKDNSRSHSAPL 926          

HSP 2 Score: 78.5666 bits (192), Expect = 1.314e-49
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = -2
Query: 2714 FLGLTSYYRKFIKDFSHIVHPLNVLL-------KKNNKFT-----WSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGG 2968
            FLG  SYYR+F++ F+ +  PL+ L+        +  K +     W+   Q  FD LK+KLT++P+L   DFT PF+L  DAS+  LGAVL Q+ GG
Sbjct:  544 FLGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKLTSAPVLAYADFTLPFILEVDASHNGLGAVLSQEQGG 640          

HSP 3 Score: 64.6994 bits (156), Expect = 1.314e-49
Identity = 38/108 (35.19%), Postives = 58/108 (53.70%), Query Frame = -1
Query: 2970 FGLT*APANFQRGMN--FVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR 3287
            FGL  AP  FQR M   F  +     L+Y++ I++FS+   EHL+ +  V  RL+  KL++K  KC   + EV Y+G     +G+ T+P  I+ V  +  P    E+R
Sbjct:  437 FGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERL--VLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELR 542          
BLAST of Thymidine phosphorylase vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 1.578e-49
Identity = 166/555 (29.91%), Postives = 252/555 (45.41%), Query Frame = -1
Query: 1911 FGLT*APANFQRGMNFVLRGI-WH-TLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVRISWFDQLL*KIY*RLFAYRSSIKRITKEKQQIYME-QKSARCV*YTKEKIDNLTYITV-------SRFYKTVHAND*CQ*CCIGSGVG---SKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSR-------------------------IQNEDKDIVKAEDTIFAV------------------------IKASNYLT------------ELQN*QRRDSQLKQFFE--------------QAISVKKK----DWKQIESENG----KYIIHDGILKCLKNNEELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPLKXXXXXXXXXXXXXMDIIGPL 3287
            FGL  APA FQR M+ VL G+ W   LVY++ II+      + ++ +E VF RL+ A LK+KP KC L + +V Y+G     +G+ T+P+ I+KV+ +PIP+N  EVR   F  L    Y R  A  ++I R   E  + Y     +  C    +E  + LT   +               A+D         GVG   S+    ++ V+AY SR L   E+N     +E LA+V   + FRQYLLGR F++ TDH+ ++WL + +    +L RW   L EYDF++  R GK++ NADA+SR                         +Q E  DIV AE TI  V                        +   N  +            ELQ  Q+ DS +   F                ++S   K     WK++  +NG    K+   DG +   +     T++ + +R+ ++   H+G +GGH  A +TL RLK +Y+W  +  +V  +C++C  C  R       + P+       APM   A+D++GPL
Sbjct:  956 FGLCNAPATFQRLMDRVLAGLQWEACLVYLDDIIVLGCNSNQMMERLEQVFTRLRQANLKLKPSKCRLFQEQVAYLGHVVSAQGISTDPQKIQKVQDWPIPKNISEVR--QFVGLA-SYYRRFVADFATIARPLHELTKKYARFDWTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASD--------WGVGAVLSQVQGGEERVLAYGSRRLTTTEQNYCTTRRELLAVVEFTSHFRQYLLGRSFVLRTDHSSLRWLTRLKEPEGQLARWLEKLAEYDFQVLHRPGKVHQNADALSRRPCRELCACKLPDPSTDSNTSQDKQVQCEFDDIV-AETTISVVRPVGVAMIDQHDGNDAAVDPQRTLVGVDNTTSAPVPVFSGWTHEELQAAQKADSDMAPVFAFRQQGDDRPPWAEIASLSPATKAYWAQWKRLFFKNGVLMRKFYCKDGKMLFAQ-----TLLPKTYRHTVMQHLHEGPIGGHFGAERTLGRLKTRYYWYNMRDDVTLFCQTCASCACRARPKKTPQAPMG-SVRVGAPMERIAVDVMGPL 1492          

HSP 2 Score: 89.7373 bits (221), Expect = 2.953e-17
Identity = 42/88 (47.73%), Postives = 61/88 (69.32%), Query Frame = -2
Query: 2708 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2971
            +F+GL SYYR+F+ DF+ I  PL+ L KK  +F W+   Q+AF+ LK++LT++PIL  P  +   +L TDAS+  +GAVL Q  GGE+
Sbjct: 1064 QFVGLASYYRRFVADFATIARPLHELTKKYARFDWTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASDWGVGAVLSQVQGGEE 1151          
BLAST of Thymidine phosphorylase vs. Planmine SMEST
Match: SMESG000008845.1 (SMESG000008845.1)

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 447/448 (99.78%), Postives = 447/448 (99.78%), Query Frame = 1
Query: 3838 MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITKIEFLKSAITVKPEKILSEIRVKK 5181
            MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKN SNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITKIEFLKSAITVKPEKILSEIRVKK
Sbjct:    1 MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKLKGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHILAPILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILEDSGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRALLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGYCIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNLSNEEIAKKIDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKKPHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELICKEGDFIERGKPWAKVYHENDLEITKIEFLKSAITVKPEKILSEIRVKK 448          
BLAST of Thymidine phosphorylase vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.464e-117
Identity = 229/421 (54.39%), Postives = 282/421 (66.98%), Query Frame = -1
Query: 2055 FGLT*APANFQRGMNFVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR-----ISWFDQLL*KIY*RLFAYRSSIKRITKEKQ-QIYMEQKSARCV*YTKEKIDNLTYITVSRFYKTVHAND*CQ*CCIGSGVGSKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRI--QNEDK-DIVKAEDTIFAVIKASNYLTELQN*QRRDSQLKQFFEQAISVKKK-DWKQIESENGKYIIHDGILKCLKNNEELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIE 3287
            FGLT APA FQR MNFVLR I H LVYI+ +IIFSN F EHLKDVETVF+RL  AKLKIKP KCE GKSEVVYVG      GLQ NP+N++K++ YPIP+N D+VR      S++ + +     + F++ + +  +  +KQ Q    +         KE +     +    F               G+ +G +    KDHVIAYASR+LK HEKN S IEKETLALVYGIATFRQYL+GRKF+V T HNP+QWLMKH  SASKLIRWSIALQEYDF+IK+RTGK N NAD +SRI   NE K + +   +TIF  IK +N L ELQ  Q  D +L Q  + A+++KK+ DWK +  E  KYIIHDG+LKC+KN   L +V   H+  L++ YHDGALGG+LSARKTLSRLK KY+W  IE
Sbjct: 1998 FGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFI-----KSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALVYGIATFRQYLVGRKFVVLTYHNPLQWLMKHWDSASKLIRWSIALQEYDFEIKYRTGKSNGNADTLSRIPVNNERKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVADEKHKYIIHDGLLKCVKNENLLIVVPTNHQTTLMLIYHDGALGGYLSARKTLSRLKQKYYWDTIE 2413          

HSP 2 Score: 121.709 bits (304), Expect = 3.547e-27
Identity = 58/88 (65.91%), Postives = 67/88 (76.14%), Query Frame = -2
Query: 2708 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2971
            +FLGL SYYRKFIK FSH+   LNVLLKK  +  W K QQ+AF+ LK+ L   PILRCP+F  PF+LMTDASN A GAVLGQ+V GEK
Sbjct: 2104 QFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEK 2191          
BLAST of Thymidine phosphorylase vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 352.829 bits (904), Expect = 8.993e-98
Identity = 226/483 (46.79%), Postives = 282/483 (58.39%), Query Frame = -1
Query: 1908 FGLT*APANFQRGMNFVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR-----ISWFDQLL*KIY*RLFAYRSSIKRITKEKQQIYMEQKSA-----------------RCV*YTKEKIDNLTYITVSRFYKTVHAND*CQ*CCIGSGVGSKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRIQNEDKDIVKAEDTIFAVIKASNYLTELQN*QRRDSQLKQFFEQAISVKKK-DWKQIESENGKYIIHDGILKCLKNNEELTIVLEKHRNALLMQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNTCDKIKVPLKXXXXXXXXXXXXXMDIIGPLP 3287
            FGLT APA FQRGMNFVLR I H LVYI+ IIIFSN F EHLKDVETVF+RL  A LKIKP KCE GKSEVVYVG      GLQ NP+N+KK++ YPIP+N D+VR      S++ + +     + F++ +    +  +KQ  +   KS                  RC  +   +I  +     S F              +G+ +G +    KDHVIAYASR+LK HEKN S IEKETLAL YGIAT  ++  G     Y   NP+        + SK                    ++N N                  +TIF  IK +N L ELQ  Q  D +L Q  + A+++KK+ DWK +  E  KYIIHDG+LKC+KN   L +VL KHR  L++ YHDGALGGHLSARKTLSRLK KY+W  IE +V+ WC +C+VC+TR+NT  KIKVPLKPMPVP APM +TAMDI+GPLP
Sbjct: 3507 FGLTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSNTFKEHLKDVETVFRRLLKANLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVKKIKEYPIPENVDQVRQFLGLASYYRKFI-----KSFSHVAQPLNVLLKKQTQFKWGKSQQEAFKLLKKSLIKKPILRCPNF---RIPFILMTDASNF-------------ALGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALAYGIATQIKWKCG-----YAIENPVN-------NESK------------------NNEMNYN------------------NTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVVDEKHKYIIHDGLLKCIKNENLLIVVLTKHRTTLMLIYHDGALGGHLSARKTLSRLKQKYYWDTIESDVRQWCHTCEVCLTRRNTGKKIKVPLKPMPVPGAPMEITAMDIVGPLP 3920          

HSP 2 Score: 126.331 bits (316), Expect = 1.540e-28
Identity = 62/88 (70.45%), Postives = 70/88 (79.55%), Query Frame = -2
Query: 2708 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2971
            +FLGL SYYRKFIK FSH+  PLNVLLKK  +F W K+QQ+AF  LKK L   PILRCP+F  PF+LMTDASN ALGAVLGQ+V GEK
Sbjct: 3613 QFLGLASYYRKFIKSFSHVAQPLNVLLKKQTQFKWGKSQQEAFKLLKKSLIKKPILRCPNFRIPFILMTDASNFALGAVLGQQVEGEK 3700          
BLAST of Thymidine phosphorylase vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 342.813 bits (878), Expect = 6.827e-95
Identity = 197/372 (52.96%), Postives = 242/372 (65.05%), Query Frame = -1
Query: 2202 FGLT*APANFQRGMNFVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR-----ISWFDQLL*KIY*RLFAYRSSIKRITKEKQ-QIYMEQKSARCV*YTKEKIDNLTYITVSRFYKTVHAND*CQ*CCIGSGVGSKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRI--QNEDK-DIVKAEDTIFAVIKASNYLTELQN*QRRDSQLKQFFEQAISVKKK-DWKQIESENGKYIIHDGILKCL 3287
            FGLT APA FQR MNFVLR I H LVYI+ +IIFSN F EHLKDVETVF+RL  AKLKIKP KCE GKSEVVYVG      GLQ NP+N++K++ YPIP+N D+VR      S++ + +     + F++ + +  +  +KQ Q    +         KE +     +    F               G+ +G +    KDHVIAYASR+LK HEKN S IEKETLALVYGIATFRQYL+GRKF+V T HNP+QWLMKH  SASKLIRWSIALQEYDF+IK+RTGK N NAD +SRI   NE K + +   +TIF  IK +N L ELQ  Q  D +L Q  + A+++KK+ DWK +  E  KYIIHD   K L
Sbjct: 1998 FGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFI-----KSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALVYGIATFRQYLVGRKFVVLTYHNPLQWLMKHWDSASKLIRWSIALQEYDFEIKYRTGKSNGNADTLSRIPVNNERKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVADEKHKYIIHDEPAKGL 2364          

HSP 2 Score: 121.709 bits (304), Expect = 3.967e-27
Identity = 58/88 (65.91%), Postives = 67/88 (76.14%), Query Frame = -2
Query: 2708 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2971
            +FLGL SYYRKFIK FSH+   LNVLLKK  +  W K QQ+AF+ LK+ L   PILRCP+F  PF+LMTDASN A GAVLGQ+V GEK
Sbjct: 2104 QFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEK 2191          
BLAST of Thymidine phosphorylase vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 342.813 bits (878), Expect = 7.340e-95
Identity = 197/372 (52.96%), Postives = 242/372 (65.05%), Query Frame = -1
Query: 2202 FGLT*APANFQRGMNFVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLKCELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVR-----ISWFDQLL*KIY*RLFAYRSSIKRITKEKQ-QIYMEQKSARCV*YTKEKIDNLTYITVSRFYKTVHAND*CQ*CCIGSGVGSKGWR*KDHVIAYASRSLKLHEKNNSNIEKETLALVYGIATFRQYLLGRKFIVYTDHNPIQWLMKHRYSASKLIRWSIALQEYDFKIKFRTGKLNANADAMSRI--QNEDK-DIVKAEDTIFAVIKASNYLTELQN*QRRDSQLKQFFEQAISVKKK-DWKQIESENGKYIIHDGILKCL 3287
            FGLT APA FQR MNFVLR I H LVYI+ +IIFSN F EHLKDVETVF+RL  AKLKIKP KCE GKSEVVYVG      GLQ NP+N++K++ YPIP+N D+VR      S++ + +     + F++ + +  +  +KQ Q    +         KE +     +    F               G+ +G +    KDHVIAYASR+LK HEKN S IEKETLALVYGIATFRQYL+GRKF+V T HNP+QWLMKH  SASKLIRWSIALQEYDF+IK+RTGK N NAD +SRI   NE K + +   +TIF  IK +N L ELQ  Q  D +L Q  + A+++KK+ DWK +  E  KYIIHD   K L
Sbjct: 1988 FGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFI-----KSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEKDHVIAYASRTLKPHEKNYSTIEKETLALVYGIATFRQYLVGRKFVVLTYHNPLQWLMKHWDSASKLIRWSIALQEYDFEIKYRTGKSNGNADTLSRIPVNNERKNNEMNYNNTIFMAIKTANNLQELQKDQENDDELNQLRKHAVTIKKESDWKHVADEKHKYIIHDEPAKGL 2354          

HSP 2 Score: 121.709 bits (304), Expect = 3.832e-27
Identity = 58/88 (65.91%), Postives = 67/88 (76.14%), Query Frame = -2
Query: 2708 EFLGLTSYYRKFIKDFSHIVHPLNVLLKKNNKFTWSKNQQDAFDTLKKKLTTSPILRCPDFTKPFMLMTDASNVALGAVLGQKVGGEK 2971
            +FLGL SYYRKFIK FSH+   LNVLLKK  +  W K QQ+AF+ LK+ L   PILRCP+F  PF+LMTDASN A GAVLGQ+V GEK
Sbjct: 2094 QFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILMTDASNFAFGAVLGQQVEGEK 2181          
The following BLAST results are available for this feature:
BLAST of Thymidine phosphorylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYMP4.870e-9842.21thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
TYMP5.280e-9741.97thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
TYMP5.280e-9741.97thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
TYMP5.280e-9741.97thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
TYMP5.280e-9741.97thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tymp1.574e-3455.12thymidine phosphorylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
tymp1.574e-3455.12thymidine phosphorylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
CR749164.11.630e-2939.78pep chromosome:GRCz11:21:30355767:30361679:1 gene:... [more]
CR855320.15.282e-2825.62pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
BX571665.12.016e-2724.24pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGC1157169.358e-10542.36thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
MGC1157169.870e-10342.13thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
MGC1157161.288e-10242.13thymidine phosphorylase [Source:HGNC Symbol;Acc:HG... [more]
ENSXETT00000006041.15.225e-3937.96pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000011934.11.634e-3639.80pep primary_assembly:Xenopus_tropicalis_v9.1:3:519... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tymp1.514e-9341.06thymidine phosphorylase [Source:MGI Symbol;Acc:MGI... [more]
Nynrin6.442e-733.33NYN domain and retroviral integrase containing [So... [more]
Nynrin6.442e-733.33NYN domain and retroviral integrase containing [So... [more]
Rtl14.548e-635.14retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl14.548e-635.14retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Thymidine phosphorylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19971|TYPH_HUMAN2.536e-9641.97Thymidine phosphorylase OS=Homo sapiens OX=9606 GN... [more]
sp|Q5FVR2|TYPH_RAT1.688e-9340.82Thymidine phosphorylase OS=Rattus norvegicus OX=10... [more]
sp|Q99N42|TYPH_MOUSE1.059e-9241.06Thymidine phosphorylase OS=Mus musculus OX=10090 G... [more]
sp|P39142|PDP_BACSU4.000e-8439.66Pyrimidine-nucleoside phosphorylase OS=Bacillus su... [more]
sp|Q8NVF6|PDP_STAAW6.163e-8438.48Pyrimidine-nucleoside phosphorylase OS=Staphylococ... [more]
back to top
BLAST of Thymidine phosphorylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y3942.389e-10240.99Thymidine phosphorylase OS=Echinococcus multilocul... [more]
A0A0R3UIX03.830e-10243.21Thymidine phosphorylase OS=Mesocestoides corti OX=... [more]
A0A5G3K6M91.469e-10142.36Thymidine phosphorylase OS=Xenopus tropicalis OX=8... [more]
A0A1L8GZP99.522e-10144.11Thymidine phosphorylase OS=Xenopus laevis OX=8355 ... [more]
A0A5N5LGT06.630e-10042.58Uncharacterized protein OS=Pangasianodon hypophtha... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052546.12.418e-5926.62pep primary_assembly:Astyanax_mexicanus-2.0:2:1303... [more]
ENSAMXT00000034038.12.416e-5525.33pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000048059.12.057e-5428.57pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051531.12.347e-5227.99pep primary_assembly:Astyanax_mexicanus-2.0:16:234... [more]
ENSAMXT00000041345.13.375e-5031.03pep primary_assembly:Astyanax_mexicanus-2.0:25:323... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tymp2.127e-4155.97thymidine phosphorylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000008840.13.412e-1233.63pep scaffold:Pmarinus_7.0:GL476434:297925:301626:1... [more]
ENSPMAT00000004123.14.551e-624.67pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 ... [more]
ENSPMAT00000004121.15.198e-624.82pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 ... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436983.142e-9639.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thymidine phosphorylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYMP8.248e-8338.08thymidine phosphorylase [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000041674.11.697e-5127.30pep primary_assembly:ASM223467v1:5:30088905:300929... [more]
ENSORLT00000032171.13.974e-5026.96pep primary_assembly:ASM223467v1:18:2114932:211795... [more]
ENSORLT00000032005.11.314e-4927.30pep primary_assembly:ASM223467v1:7:31190450:311944... [more]
ENSORLT00000040305.11.578e-4929.91pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
back to top
BLAST of Thymidine phosphorylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008845.10.000e+099.78SMESG000008845.1[more]
SMESG000057446.11.464e-11754.39SMESG000057446.1[more]
SMESG000080881.18.993e-9846.79SMESG000080881.1[more]
SMESG000057446.16.827e-9552.96SMESG000057446.1[more]
SMESG000057446.17.340e-9552.96SMESG000057446.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027834 ID=SMED30027834|Name=Thymidine phosphorylase|organism=Schmidtea mediterranea sexual|type=transcript|length=5243bp
CAAAAAATTTGAAAATATTAAAATAATTTATACATTATTATACTTTAAAT
TTAAATATTTTACATCCTAATTTTTATTCTTTGTTATGTTAAAGTGAAAA
AAACTACAACTTAATTTTATAATTCAGGAATTTTTTATTTATTCAAATGT
TGATCTTATGTTAACTAATTTCGGACAATCACTATCAAGTACGTGGTACA
AGTCACAAGTGACTGCGAATGTGTTCTAGGATGTGGATTGCCAGCCACAG
GTCAGTTTTTTTCCTAGACTGCTAATGTCGTGTCAATTTCATGGGTTCAT
GAACTACCATAAAATGGTTCATATGTAACCCAATTCTGGTTTCTTCAAAA
ATTATGAAATTCAATTATAGTTCGAGTAAATTTTGGAAATATTCTGATAC
CAATGTCCCGGGATTAAAATTGTCAGAATACCGGGATTTCGGTACTAACT
TTCTATAAAATATTTATTATAGAATTTTAAATGTTTTAAATAGAAAATAT
TTGAATTTGAAATATCGATTTGTTTTTAAGAACGAAATAATATAGATTTG
CTTGATAGAAAAAATATTTTGATTAAGTTAACTTTAAAAAATGACTTCAG
ATTTTTTTAAAAAAACTGAAGCCGACAATTTTATTGCAGCTTATAGCATT
CTGCTGGTCCAGAACACGAAAGGCGTCAATGTGTTTTAAACGAATCAGTT
TTACAGCACGAAAACCTATCACCAAGATAACTCAAATATATAACAAGGTA
AAAAATATATATAAAACAAAATACAAATCAAATTATTCACAAAAATGCAT
CATAAATAGCATGAAATGTACATAAGAATTACATGAAAACAGAAATGTTT
GACTAAAATTAAGCAGATTTATTCAAATTCATTGTAAATGAAAAATATCA
AATCAAAATAAAAAAGATTTAATTAGAAAAATTCTAATTATAAAACAATC
CACAAATTTACCGAATAAAATAAAATTTTAAGAAAAATATTAATATAGCA
AACCTAAGTTTTATTAATTTGTAGTTGCATCAATTTTTTGGGTCAACACC
GAAGGTGTAAAGGAATTGTTAAAATCACACATCAAGTAAAACACAAAATA
AAAAGAACAAAAATAAATAAAATTAAAACAGAAAACATAAATTTCAACAA
CATCATAATATGCGAAAATAAAATCATTTAAACAGGTTTGAAAGCTCTGG
AATAAAATATTTAAGAAAGTAACTGATAAAGTTACATGAAATGATATTTA
TAGAAAAATTGCAGAGGAAAATAAATATAAAAATGGGGAAAAATTATTGT
GAGATTCATCCCAAAATATCGTCTGAAATCCCATTATAATTAGAAAAATA
AAAAGTAGAGACAGCATCTCACATAAAAATAAAATAGTAAAGGAAAAATG
AGAATATAGGAGCAAAATCAAAATAAATTAAAATATTAGAAAATTTTGAT
GAAATATTTAATGAGTGATTTTATCATAATGCGATAATGAAATTTCAGAA
ATTTCCTGATAGGAAAAACTTAGAAAAAATCAGTGAAGAATATAGACTAG
AAATGAGGATAATAACGAAATTTGGGCTAAAAACTAAAATTTCGAATTGG
TTTTAAAGCATTAAAATATACACCTTGAAAATAAATACCGCTCCTGATTT
CAATAATTTTAGCCGTTATTTGACAAATTTGCACTTTGAAAAAGCTCCAA
TACAAGGACCAAGTAATCTACAGAAAATTTTCATTTACTTAACAGAACTA
CGGAAGCTCAACATTAGAAGAAATAAACAATGCACTAAAGAACGACTTTT
AAAAACAATCGAAAGATTGATACAGCAAGATTCAATTTACCGAACAACAT
TGAGGATTTTTGATCAAATTTGAGAAGGTCTATATCAGGGGTGGGCAAAC
TGATTACTGGTAATGGTCCAATAATATCCATTGCTGTCATCGCCATCGGT
GCTGTTGGAACTGGCATCGGTTTTAAAGGTACTTTTATTTTGTCACAAGT
ATTCTTTCGTGTAATGCATACTTTACAACTTTTACACCAATCTTTTACAT
TTTGTTCTATTGCTGGCCAATGATATTTTAGTTTTAATCTAGATAAGGTT
TTTCTTGCAGATAAATGCCCTCCTAAAGCCCCATCATGGTACTGCATTAA
CAATGCATTTCTATGTTTTTCTAGGACTATAGTTAATTCCTCGTTATTTT
TTAAGCATTTTAATATTCCATCGTGAATAATATACTTGCCATTCTCACTT
TCAATTTGCTTCCAGTCTTTCTTTTTTACTGATATCGCTTGCTCGAAAAA
CTGTTTCAATTGGCTGTCACGCCTTTGCTAGTTCTGTAATTCAGTTAAAT
AATTGGATGCTTTAATTACCGCAAATATTGTATCTTCTGCCTTTACAATA
TCTTTGTCTTCATTTTGGATTCTTGACATTGCATCGGCATTGGCGTTCAA
TTTACCTGTTCGAAATTTTATTTTGAAATCGTATTCCTGAAGTGCAATTG
ACCATCGAATTAGCTTACTAGCCGAATATCGGTGCTTCATTAACCATTGA
ATGGGATTATGGTCCGTATATACAATAAATTTTCTACCTAACAAATATTG
TCTAAATGTAGCAATTCCATATACTAATGCCAAGGTTTCTTTTTCGATAT
TTGAATTGTTTTTCTCGTGTAGTTTTAGAGACCTACTTGCATATGCTATT
ACATGATCTTTTCACCGCCAACCTTTTGACCCAACACCGCTCCCAATGCA
ACATTACTGGCATCAGTCATTAGCATGAACGGTTTTGTAAAATCTGGACA
CCGTAATATAGGTGAGGTTGTCAATTTTTTCTTTAGTGTATCAAACGCAT
CTTGCTGATTTTTGCTCCATGTAAATTTGTTGTTTTTCTTTAGTAATACG
TTTAATGGATGAACGATATGCGAAAAGTCTTTAATAAATTTTCTATAATA
ACTGGTCAAACCAAGAAATTCTTACTTCATCCGTATTTTGTGGAATTGGA
TACGCTTCAACTTTCTTAATATTTTTGGGATTAGTTTGTAAACCCTCCGT
GATATTATGTGAACCAACATATACAACTTCAGACTTTCCCAATTCACATT
TTAATGGTTTTATTTTTAATTTGGCACTCTTTAACCGTTGGAACACTGTT
TCAACATCCTTGAGATGTTCGCAAAATTCATTTGAGAATATGATTATGCC
ATTGATGTATACCAGTGTATGCCAAATACCTCTTAGTACGAAATTCATAC
CTCTTTGAAAATTGGCTGGGGCTCATGTTAAACCAAAAATGTAAAACACT
AAATTCGTCCAAAGCTAAATCAGCGTAAACCTCAACAATTTGTTAGGATT
TCTGATAGACTACTTCTTTTTTAAAACGCTTTTGTTACTTTTCTCAACTT
TATTAAATTTGTTTCATTCATAGTCATTCGAAAACCCATAAAACATTCCA
TTCTATTCAATTACTTACTGTAATGAGATACCATGACAAATTTTAACAGT
GATAAGAATCAAATACCATAAGTTTTCGGATTTCTTGATATAATTTCGTC
ACTTCCGTTAATTCATTGTCAAATATTGTGATTGGTTGGATGTGAAAATT
CTATTTTTAAAAACCATTCAATTTGCAACTAGACTTATACAAAAACATTT
TCAGTATTACACCAAGCGAAGGTCATTGATAAATAACAAATGAGTGTGTT
CAAACTACGTTTAAACTGAATTTTATTTATCATTGTCAGATCGCGTGATA
ACATCAGATTTGTATAACATCCTTTGTAAGTAAGTATAAATGTGAAACTT
GTAGTTGTGAAAATCTCATTTTATATTTTTCACAAGAATGGCTTCACATA
ATGTTGTCAGAATTATAGAAAATAAGTCTAAAGGTCTGTTGCTAAGTTCC
GAAGAAATCGATTATTTTGTGAAATGCGTTTCCAAAAATGAAATCGATGA
AGCTCAGATAGGAGCATTTTTGATGGCTATAAAATTGAAGGGAATGAATG
GTCAAGAAACAGCGAATTTGACAAAATCCATGGCAGATTACAGTGAAAAA
TTTAATTGGTCTCAATATGACTGGTACGATAAAGTAGTTGACAAACACAG
TACTGGCGGAGTCGGTGATAAAATCAGTCATATATTAGCTCCGATTTTAT
CGGCTTGTGGTTTAAAGATGCCGATGATAAGTGGTAGGGGGCTCGGTATC
ACTGGAGGGACTATAGATAAACTGGAGGCAATTAAAGGATTCTTCCCTCT
AGATGACTTGCAAGCAATGCCGGGCATTTTAGAAGATTCGGGGTTTTTCA
TTACTGGTCAGACCAACTCAATGGTTCCGGTTGATAAACGCCTTTATGCT
ATTCGAGATGTAACAGCGACCGTTGACTCTATTCCTTTGATAACTGCTTC
AATTCTTTCTAAGAAAAAAATTGAAGACATTCGCGCTTTATTAATGGATG
TGAAATTCGGTGAAGGAACTTTTATGAAAACTGAAGAAGAAGCAGTCGCT
TTAGCTGAATCAATGATAGAAACTGGAAAATCTTTAGATATGGATATTGT
ATGTTTAATTGATGATATGAACTCACCCCTTGGTTACTGTATTGGTAATG
CTTTAGAAATTGCCGAAGTCCTTAGAGCTTTACACGGAGAAATGTCTCCA
GATATAAAAGAAATTATTCATATTATGGCTCATCAACTTTTAAAGTTCGT
TAATAAAAACTCAAGCAATGAAGAAATAGCGAAAAAAATTGATGAAGCAA
TTTCAAGTGGTAAAGCTTTGGAAAGCTTTAAAAAGATGCTTAAGTCACAA
GGAGTAAAAGAACTTTTAGCAGATAGTCTTTGTGTTCGTAAAATATTACC
AATTGCAAGCTACATGGAACTATTATGTGATAAAAAACCCCATGTCACTG
AAATACCTTCTGACTGTGCCGGGTTTGTCACAGCAATTAATGCAGAAAAA
GTTGGAATAATTACTCGAGATTTAGGAGGAGGAAGAGTAAGAAAAGAGGA
TAAATTGAATTATGGGGTTGGTGTAGAATTGATTTGTAAAGAAGGGGATT
TCATAGAACGAGGAAAACCATGGGCCAAAGTTTACCATGAAAATGATTTG
GAAATTACCAAGATAGAATTTTTAAAGTCTGCAATTACAGTTAAACCCGA
GAAGATTTTGTCAGAAATCCGAGTGAAAAAATATTGCATTCACTTAAATA
AATTATCTGTTTTTACTTTTAATATAAATTGATAGACCTGAAA
back to top

protein sequence of SMED30027834-orf-1

>SMED30027834-orf-1 ID=SMED30027834-orf-1|Name=SMED30027834-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MQYHDGALGGHLSARKTLSRLKLKYHWPAIEQNVKDWCKSCKVCITRKNT
CDKIKVPLKPMPVPTAPMAMTAMDIIGPLPVISLPTPDIDLLKFDQKSSM
LFGKLNLAVSIFRLFLKVVL*
back to top

protein sequence of SMED30027834-orf-2

>SMED30027834-orf-2 ID=SMED30027834-orf-2|Name=SMED30027834-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MNFVLRGIWHTLVYINGIIIFSNEFCEHLKDVETVFQRLKSAKLKIKPLK
CELGKSEVVYVGSHNITEGLQTNPKNIKKVEAYPIPQNTDEVRISWFDQL
L*
back to top

protein sequence of SMED30027834-orf-3

>SMED30027834-orf-3 ID=SMED30027834-orf-3|Name=SMED30027834-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MASHNVVRIIENKSKGLLLSSEEIDYFVKCVSKNEIDEAQIGAFLMAIKL
KGMNGQETANLTKSMADYSEKFNWSQYDWYDKVVDKHSTGGVGDKISHIL
APILSACGLKMPMISGRGLGITGGTIDKLEAIKGFFPLDDLQAMPGILED
SGFFITGQTNSMVPVDKRLYAIRDVTATVDSIPLITASILSKKKIEDIRA
LLMDVKFGEGTFMKTEEEAVALAESMIETGKSLDMDIVCLIDDMNSPLGY
CIGNALEIAEVLRALHGEMSPDIKEIIHIMAHQLLKFVNKNSSNEEIAKK
IDEAISSGKALESFKKMLKSQGVKELLADSLCVRKILPIASYMELLCDKK
PHVTEIPSDCAGFVTAINAEKVGIITRDLGGGRVRKEDKLNYGVGVELIC
KEGDFIERGKPWAKVYHENDLEITKIEFLKSAITVKPEKILSEIRVKKYC
IHLNKLSVFTFNIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030374PABS
IPR015416Znf_H2C2_histone_UAS-bd
IPR000477RT_dom
IPR013102PYNP_C
IPR000312Glycosyl_Trfase_fam3
IPR000053Thymidine/pyrmidine_PPase
IPR017459Glycosyl_Trfase_fam3_N_dom
IPR017872Pyrmidine_PPase_CS
Vocabulary: biological process
TermDefinition
GO:0006213pyrimidine nucleoside metabolic process
GO:0008152metabolic process
GO:0006206pyrimidine nucleobase metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016763transferase activity, transferring pentosyl groups
GO:0016757transferase activity, transferring glycosyl groups
GO:0004645phosphorylase activity
GO:0009032thymidine phosphorylase activity
GO:0016154pyrimidine-nucleoside phosphorylase activity
GO:0016740transferase activity