Protein regulator of cytokinesis 1

Overview
NameProtein regulator of cytokinesis 1
Smed IDSMED30027830
Length (bp)2364
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein regulator of cytokinesis 1 (SMED30027830) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein regulator of cytokinesis 1 (SMED30027830) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein regulator of cytokinesis 1 (SMED30027830) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein regulator of cytokinesis 1 (SMED30027830) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027830

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30027830h1SMcG0013609 dd_Smed_v4_1852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027830h1SMcG0013609 dd_Smed_v4_1852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027830h1SMcG0013609 dd_Smed_v4_1852_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 82.0333 bits (201), Expect = 1.047e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  341 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 431          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 82.0333 bits (201), Expect = 1.047e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  341 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 431          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 81.6481 bits (200), Expect = 1.347e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 81.6481 bits (200), Expect = 1.347e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 81.6481 bits (200), Expect = 1.347e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: toe-4 (Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEMBL;Acc:Q9XUM8])

HSP 1 Score: 67.0106 bits (162), Expect = 2.682e-11
Identity = 32/79 (40.51%), Postives = 46/79 (58.23%), Query Frame = 2
Query: 1925 GITRQELDT--IPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
            G ++ E+DT  IPT    K + +       +D+D C +CL  F   E I+ LRC+H FH  C+ KWL IN+ CP+CR +
Sbjct:  405 GASKVEIDTFTIPTVYAKKTDGE-------EDEDTCTVCLSSFEDGESIQKLRCNHVFHPECIYKWLDINKRCPMCREE 476          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: C01G6.4 (pep chromosome:WBcel235:II:9271265:9273042:-1 gene:WBGene00007226.1 transcript:C01G6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01G6.4)

HSP 1 Score: 56.6102 bits (135), Expect = 5.159e-9
Identity = 31/80 (38.75%), Postives = 39/80 (48.75%), Query Frame = 2
Query: 1907 IDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLC 2146
            +D+ K    R  L+ IP   F     DM         + C IC+ DF P E IR L C H FH  CV++WL  + TCP C
Sbjct:   66 LDEAKKNRIRGLLEQIPADVF---RGDMT-------SNECAICMIDFEPGERIRFLPCMHSFHQECVDEWLMKSFTCPSC 135          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: plr-1 (Probable E3 ubiquitin-protein ligase plr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2B7])

HSP 1 Score: 58.151 bits (139), Expect = 1.641e-8
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 2
Query: 2015 KDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
            ++RC+ICLE++     +R+L C H+FH  CV+ WL   R CPLC+ D
Sbjct:  314 QERCVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFD 360          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: C18B12.4 (pep chromosome:WBcel235:X:15036662:15040602:-1 gene:WBGene00007666.1 transcript:C18B12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C18B12.4)

HSP 1 Score: 56.6102 bits (135), Expect = 4.614e-8
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 2
Query: 1919 KPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWL-KINRTCPLCRSDAG 2161
            K  ++++ L  IP +K+             DD D C ICLE F   E +R L C H FH  C++ WL +  + CPLC+   G
Sbjct:  222 KRRLSKRNLKKIPVKKY----------RLGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRKIG 293          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: H10E21.5 (pep chromosome:WBcel235:III:20531:23962:-1 gene:WBGene00019185.1 transcript:H10E21.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H10E21.5)

HSP 1 Score: 55.0694 bits (131), Expect = 1.338e-7
Identity = 24/74 (32.43%), Postives = 41/74 (55.41%), Query Frame = 2
Query: 1934 RQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
            R+ L  IPT             +T + +  C +CL+ +   ++IR+L C H +H  C++ WL  +RTCP+C++D
Sbjct:  204 RKALTRIPTMTITPG-------MTQELQSDCAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKND 270          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082118)

HSP 1 Score: 88.5817 bits (218), Expect = 1.232e-17
Identity = 37/85 (43.53%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 1907 IDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            + + KP G+TR E+D +P+ KF       N +V + D+  C++C+ DF   +++R+L CSH+FH+ CV+KWL+ NRTCP+CR +A
Sbjct: 1044 LGEAKPRGLTRNEIDQLPSYKF-------NPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNA 1121          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082116)

HSP 1 Score: 87.8113 bits (216), Expect = 1.906e-17
Identity = 37/85 (43.53%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 1907 IDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            + + KP G+TR E+D +P+ KF       N +V + D+  C++C+ DF   +++R+L CSH+FH+ CV+KWL+ NRTCP+CR +A
Sbjct:  739 LGEAKPRGLTRNEIDQLPSYKF-------NPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNA 816          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082117)

HSP 1 Score: 87.8113 bits (216), Expect = 1.906e-17
Identity = 37/85 (43.53%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 1907 IDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            + + KP G+TR E+D +P+ KF       N +V + D+  C++C+ DF   +++R+L CSH+FH+ CV+KWL+ NRTCP+CR +A
Sbjct:  739 LGEAKPRGLTRNEIDQLPSYKF-------NPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNA 816          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: gzl (gene:FBgn0037442 transcript:FBtr0081721)

HSP 1 Score: 66.2402 bits (160), Expect = 6.852e-11
Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 2
Query: 1943 LDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKIN-RTCPLCR 2149
            L  +P  ++ KNN +  Y       D C+ICLEDF+ D+ +R+L CSH +H+ C++ WL  N R CP+C+
Sbjct:  215 LKKLPVLRYTKNNANNKY-------DTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICK 277          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: gzl (gene:FBgn0037442 transcript:FBtr0081722)

HSP 1 Score: 66.2402 bits (160), Expect = 6.852e-11
Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 2
Query: 1943 LDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKIN-RTCPLCR 2149
            L  +P  ++ KNN +  Y       D C+ICLEDF+ D+ +R+L CSH +H+ C++ WL  N R CP+C+
Sbjct:  215 LKKLPVLRYTKNNANNKY-------DTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICK 277          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:767686])

HSP 1 Score: 79.337 bits (194), Expect = 4.539e-15
Identity = 34/101 (33.66%), Postives = 62/101 (61.39%), Query Frame = 2
Query: 1862 ITVSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAG 2161
            + +  Y   L+    + + KP G+T+ +++ +P+ +F   N+         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA 
Sbjct:  332 VEMENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNLENHQ-------SEQTLCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADAS 425          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 80.1073 bits (196), Expect = 5.076e-15
Identity = 30/78 (38.46%), Postives = 55/78 (70.51%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  595 GLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 665          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 79.337 bits (194), Expect = 5.149e-15
Identity = 30/78 (38.46%), Postives = 55/78 (70.51%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  393 GLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 463          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 80.1073 bits (196), Expect = 5.299e-15
Identity = 30/78 (38.46%), Postives = 55/78 (70.51%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  583 GLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 653          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:767686])

HSP 1 Score: 79.337 bits (194), Expect = 5.509e-15
Identity = 30/79 (37.97%), Postives = 53/79 (67.09%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAG 2161
            G+T+ +++ +P+ +F   N+         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA 
Sbjct:  370 GLTKADIEQLPSYRFNLENHQ-------SEQTLCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADAS 441          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 81.6481 bits (200), Expect = 1.012e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 82.0333 bits (201), Expect = 1.396e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  409 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 499          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 82.0333 bits (201), Expect = 1.466e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  415 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 505          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 81.2629 bits (199), Expect = 1.851e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  385 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 475          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 81.6481 bits (200), Expect = 2.290e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  626 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 716          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 78.9518 bits (193), Expect = 6.870e-15
Identity = 35/98 (35.71%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 78.9518 bits (193), Expect = 6.870e-15
Identity = 35/98 (35.71%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 78.9518 bits (193), Expect = 6.870e-15
Identity = 35/98 (35.71%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  334 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 78.5666 bits (192), Expect = 8.910e-15
Identity = 35/98 (35.71%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  366 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 456          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf44 (ring finger protein 44 [Source:MGI Symbol;Acc:MGI:2145310])

HSP 1 Score: 77.7962 bits (190), Expect = 8.939e-15
Identity = 29/78 (37.18%), Postives = 54/78 (69.23%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  +++         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  272 GLTKADIEQLPSYRFNPDSHQ-------SEQTLCVVCFSDFEVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 342          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q9H0F5|RNF38_HUMAN (E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens OX=9606 GN=RNF38 PE=1 SV=4)

HSP 1 Score: 81.6481 bits (200), Expect = 9.157e-15
Identity = 36/98 (36.73%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  417 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 507          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q08CG8|RNF44_DANRE (RING finger protein 44 OS=Danio rerio OX=7955 GN=rnf44 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.159e-14
Identity = 30/79 (37.97%), Postives = 53/79 (67.09%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAG 2161
            G+T+ +++ +P+ +F   N+         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA 
Sbjct:  370 GLTKADIEQLPSYRFNLENHQ-------SEQTLCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADAS 441          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q7L0R7|RNF44_HUMAN (RING finger protein 44 OS=Homo sapiens OX=9606 GN=RNF44 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.640e-14
Identity = 29/78 (37.18%), Postives = 54/78 (69.23%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  +++         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  354 GLTKADIEQLPSYRFNPDSHQ-------SEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q8BI21|RNF38_MOUSE (E3 ubiquitin-protein ligase RNF38 OS=Mus musculus OX=10090 GN=Rnf38 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.978e-14
Identity = 35/98 (35.71%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  +N+         ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  420 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 510          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q4V7B8|RNF44_RAT (RING finger protein 44 OS=Rattus norvegicus OX=10116 GN=Rnf44 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.664e-14
Identity = 29/78 (37.18%), Postives = 54/78 (69.23%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  +++         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  272 GLTKADIEQLPSYRFNPDSHQ-------SEQTLCVVCFSDFEVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 342          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A2H1C4B4 (Zinc finger, C3HC4 type OS=Fasciola hepatica OX=6192 GN=D915_10763 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 6.634e-18
Identity = 39/87 (44.83%), Postives = 60/87 (68.97%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNN---------DMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T  ELD++P R + K+N          D   K ++ +++RCMICL+D++  +++R +RC H+FH+ CV+KWLK  RTCPLCR+DA
Sbjct:  487 GLTAGELDSLPVRSYTKSNTVGSNAEQTIDGLSKSSEVEEERCMICLDDYLDKDVLRTMRCRHEFHAKCVDKWLKTKRTCPLCRADA 573          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A504YG59 (RING-type domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_09872 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.235e-17
Identity = 44/102 (43.14%), Postives = 66/102 (64.71%), Query Frame = 2
Query: 1886 TLDHLP--LIDQPKPGITRQELDTIPTRKFIKNNN---------DMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            TL HL   L    + G+T  ELD++P R + K+N          D   K ++ +++RCMICL+D++  +++R +RC H+FH+ CV+KWLK  RTCPLCR+DA
Sbjct:  897 TLYHLAVQLASNTRRGLTAGELDSLPVRSYTKSNTVGSNAEQTIDGLSKSSEVEEERCMICLDDYLDKDVLRTMRCRHEFHAKCVDKWLKTKRTCPLCRADA 998          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A4E0RZ54 (RING-type domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_007055 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.513e-17
Identity = 44/102 (43.14%), Postives = 66/102 (64.71%), Query Frame = 2
Query: 1886 TLDHLP--LIDQPKPGITRQELDTIPTRKFIKNNN---------DMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            TL HL   L    + G+T  ELD++P R + K+N          D   K ++ +++RCMICL+D++  +++R +RC H+FH+ CV+KWLK  RTCPLCR+DA
Sbjct: 1040 TLYHLAVQLASNTRRGLTAGELDSLPVRSYTKSNTVGSNAEQTIDGLSKSSEVEEERCMICLDDYLDKDVLRTMRCRHEFHAKCVDKWLKTKRTCPLCRADA 1141          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A4S2L6D8 (RING-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009738 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.593e-17
Identity = 40/87 (45.98%), Postives = 59/87 (67.82%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKF---------IKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T++ELDT+P R +         ++N  D       + +DRCMICL+D+ P +++R +RC H+FH+ CV+KWLK  RTCPLCR+DA
Sbjct: 1157 GLTKEELDTLPVRSYGQIHEAPTQLENTKD----CVAETEDRCMICLDDYEPKDLLRAMRCRHEFHAKCVDKWLKTKRTCPLCRADA 1239          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: H2KUM4 (RING finger protein 38 OS=Clonorchis sinensis OX=79923 GN=CLF_109547 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.307e-16
Identity = 38/83 (45.78%), Postives = 56/83 (67.47%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIK-----NNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T++ELDT+P R + K       ++       +  DRCMICL+D+   +++R +RC H+FH+ CV+KWLK  RTCPLCR+DA
Sbjct: 1146 GLTKEELDTLPVRSYGKIHEAPTQHENTKDCVAETDDRCMICLDDYESKDLLRAMRCRHEFHAKCVDKWLKTKRTCPLCRADA 1228          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:103037379])

HSP 1 Score: 80.1073 bits (196), Expect = 2.371e-15
Identity = 30/78 (38.46%), Postives = 53/78 (67.95%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F   N+         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  352 GLTKADIEQLPSYRFNSENHQ-------SEQTLCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADA 422          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 79.337 bits (194), Expect = 6.988e-15
Identity = 35/98 (35.71%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 1868 VSRYLPTLDHLPLIDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            V  Y   L+    + + KP G+T+ +++ +P+ +F  +N+          +  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  567 VENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNH----------QSECVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 654          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf128a (ring finger protein 128 [Source:NCBI gene;Acc:103044386])

HSP 1 Score: 67.781 bits (164), Expect = 1.359e-11
Identity = 25/53 (47.17%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 1997 KVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
            K T  D D C +C+E + P +++ +L CSH FH +CVE WL  +RTCP+C+ D
Sbjct:  242 KETGPDADSCAVCIETYKPGDVLSVLTCSHFFHKVCVEPWLLEHRTCPMCKCD 294          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf150a (ring finger protein 150 [Source:NCBI gene;Acc:103037093])

HSP 1 Score: 63.929 bits (154), Expect = 2.773e-10
Identity = 30/82 (36.59%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1904 LIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCR 2149
            L D  K  I++ ++ TI  RK          K T+ + D C +C+E + P++++R+L C H FH  CV+ WL+ +RTCP+C+
Sbjct:  239 LGDAAKKAISKLQVRTI--RK--------GDKETESEFDNCAVCIETYKPNDVVRILPCRHVFHKNCVDPWLQDHRTCPMCK 310          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf150a (ring finger protein 150 [Source:NCBI gene;Acc:103037093])

HSP 1 Score: 63.929 bits (154), Expect = 2.966e-10
Identity = 30/82 (36.59%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1904 LIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCR 2149
            L D  K  I++ ++ TI  RK          K T+ + D C +C+E + P++++R+L C H FH  CV+ WL+ +RTCP+C+
Sbjct:  239 LGDAAKKAISKLQVRTI--RK--------GDKETESEFDNCAVCIETYKPNDVVRILPCRHVFHKNCVDPWLQDHRTCPMCK 310          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: rnf111 (ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-070808-2])

HSP 1 Score: 68.5514 bits (166), Expect = 3.985e-12
Identity = 25/71 (35.21%), Postives = 42/71 (59.15%), Query Frame = 2
Query: 1943 LDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
            ++   +RK ++   D      D+++++C ICL     +E +R L C H FH +CV++WL  N+ CP+CR D
Sbjct:  821 VNNTKSRKSLEKEGDDEGGADDENEEKCTICLSVLEEEEDVRRLPCMHLFHQVCVDQWLTTNKKCPICRVD 891          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: rnf150a (ring finger protein 150a [Source:ZFIN;Acc:ZDB-GENE-060213-1])

HSP 1 Score: 63.5438 bits (153), Expect = 6.156e-11
Identity = 24/73 (32.88%), Postives = 44/73 (60.27%), Query Frame = 2
Query: 1931 TRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCR 2149
             ++ +  +P +   K + +     T+ D D C +C+E + P++++R+L C H FH  CV+ WL  +RTCP+C+
Sbjct:  263 AKKAMTKLPLKTIKKGDQE-----TEPDFDNCAVCIEGYKPNDVVRILPCKHLFHKACVDPWLLDHRTCPMCK 330          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003771.1 (pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:ENSPMAG00000003449.1 transcript:ENSPMAT00000003771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.163e-8
Identity = 22/48 (45.83%), Postives = 30/48 (62.50%), Query Frame = 2
Query: 2009 DDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINR-TCPLCR 2149
            D  D C ICLE++   E +R+L C+H FH  CV+ WL   R  CP+C+
Sbjct:    2 DSYDVCAICLEEYEEGERLRVLPCAHAFHCKCVDPWLTQQRKNCPVCK 49          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: si:ch1073-392o20.1 (ring finger protein 122 [Source:HGNC Symbol;Acc:HGNC:21147])

HSP 1 Score: 49.6766 bits (117), Expect = 2.777e-8
Identity = 18/41 (43.90%), Postives = 25/41 (60.98%), Query Frame = 2
Query: 2024 CMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLC 2146
            C +CLEDF   + + +  C H FH  C+ KWL+I   CP+C
Sbjct:   17 CAVCLEDFREKDELAVCPCKHAFHRKCLVKWLEIRNACPMC 57          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003380.1 (pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 gene:ENSPMAG00000003092.1 transcript:ENSPMAT00000003380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.178e-7
Identity = 21/59 (35.59%), Postives = 33/59 (55.93%), Query Frame = 2
Query: 1970 IKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLC 2146
            IK     N+    D  + C +CLEDF   + + +  C H FH  C+ +WL+I ++CP+C
Sbjct:   19 IKKGKARNF----DCYETCAVCLEDFTLKDKLGICPCRHAFHRKCLVRWLEIRKSCPMC 73          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO49283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH29])

HSP 1 Score: 67.0106 bits (162), Expect = 1.089e-13
Identity = 29/77 (37.66%), Postives = 48/77 (62.34%), Query Frame = 2
Query: 1907 IDQPKP-GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRT 2134
            I + KP G+TR E+D +PT +    +   N      D  RC++CL DF   +++R L C H++H+ C++KWLK+++T
Sbjct:   16 IGEAKPKGLTRAEIDQLPTYRVTAESKKQN------DDARCVVCLVDFEEKQLVRTLPCLHEYHTRCIDKWLKVHKT 86          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO49300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH66])

HSP 1 Score: 60.077 bits (144), Expect = 1.094e-10
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 2
Query: 1937 QELDTIPT--RKFIKNNNDMNYKV-----TDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCR 2149
            QE   + T  R F K    +NYK      +    D C ICLEDF+  E + M +C H +H+ C+ KWL++  +CP+C+
Sbjct:   48 QEQGNVGTQRRSFPKGLKKVNYKKKWLAKSKLKSDMCTICLEDFINKEEVNMCKCGHAYHNKCIMKWLEVRNSCPICQ 125          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO31118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV5])

HSP 1 Score: 57.7658 bits (138), Expect = 1.553e-10
Identity = 24/67 (35.82%), Postives = 43/67 (64.18%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKI 2125
            G++++ +D IP+ +F  +N DM+          C++C+ D+   E +R L C+HDFHS C+++WLK+
Sbjct:   36 GLSKEVIDRIPSFRFSASNKDMS-------NGSCVVCMMDYTNREKLRKLPCNHDFHSKCIDRWLKV 95          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO41758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3E3])

HSP 1 Score: 60.077 bits (144), Expect = 7.620e-10
Identity = 23/73 (31.51%), Postives = 45/73 (61.64%), Query Frame = 2
Query: 1931 TRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCR 2149
             ++ +  +PTR   K+         +++ D C +CL+ +   E+IR+L C+H++H +C++ WL  +RTCP+C+
Sbjct:  203 AKKAIAKLPTRTVKKDE--------EEEIDSCPVCLDGYKSGEVIRILPCNHEYHKLCIDPWLVEHRTCPMCK 267          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO40583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T4])

HSP 1 Score: 49.6766 bits (117), Expect = 3.582e-7
Identity = 21/52 (40.38%), Postives = 29/52 (55.77%), Query Frame = 2
Query: 1991 NYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLC 2146
             Y  +   K  C+IC+ DFM  + IR L C H +H  C++ WL  + TCP C
Sbjct:   75 EYDGSKGKKRECVICMYDFMVGDPIRFLPCMHIYHKDCIDDWLVRSFTCPSC 126          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: ENSORLT00000004098.2 (E3 ubiquitin-protein ligase RNF38 [Source:NCBI gene;Acc:101163418])

HSP 1 Score: 83.1889 bits (204), Expect = 4.078e-16
Identity = 31/78 (39.74%), Postives = 54/78 (69.23%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  NN+         ++  C++C+ DF   +++R+L CSH+FH  CV+KWL+ NRTCP+CR+DA
Sbjct:  564 GLTKGDIEQLPSYRFNPNNHQ-------SEQTLCVVCMSDFESRQLLRVLPCSHEFHGKCVDKWLRANRTCPICRADA 634          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: rnf38 (E3 ubiquitin-protein ligase RNF38 [Source:NCBI gene;Acc:101171057])

HSP 1 Score: 82.8037 bits (203), Expect = 7.357e-16
Identity = 31/78 (39.74%), Postives = 54/78 (69.23%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F  NN          ++  C++C+ DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  634 GLTKADIEQLPSYRFNPNNRQ-------SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 704          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:101159595])

HSP 1 Score: 77.411 bits (189), Expect = 1.655e-14
Identity = 30/78 (38.46%), Postives = 53/78 (67.95%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            G+T+ +++ +P+ +F   N+         ++  C++C  DF   +++R+L C+H+FH+ CV+KWLK NRTCP+CR+DA
Sbjct:  362 GLTKADIEQLPSYRFNSENHL-------SEQTLCVVCFSDFECRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADA 432          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: si:ch211-59o9.10 (uncharacterized LOC101160975 [Source:NCBI gene;Acc:101160975])

HSP 1 Score: 65.855 bits (159), Expect = 8.758e-11
Identity = 29/76 (38.16%), Postives = 44/76 (57.89%), Query Frame = 2
Query: 1928 ITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
            ++R+E+   PT+KF       N +        C IC  D+   E +RML C HD+H  C+++WLK N TCP+CR++
Sbjct:  362 LSRREIQRFPTKKFHSAKTAGNTQ--------CQICFCDYNDGEKLRMLPCFHDYHVQCIDRWLKDNTTCPICRAN 429          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: ENSORLT00000017784.2 (tetratricopeptide repeat domain 3 [Source:NCBI gene;Acc:101161328])

HSP 1 Score: 64.6994 bits (156), Expect = 3.343e-10
Identity = 27/52 (51.92%), Postives = 35/52 (67.31%), Query Frame = 2
Query: 2015 KDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTN 2170
            +D C+IC ED  PDE   +L C H FH+ C++ WLK  RTCP CR+ A LT+
Sbjct: 1556 EDPCIICHEDMNPDETA-VLECRHSFHTECIKSWLKEQRTCPTCRTHALLTD 1606          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000059381.1 (SMESG000059381.1)

HSP 1 Score: 1117.45 bits (2889), Expect = 0.000e+0
Identity = 606/608 (99.67%), Postives = 606/608 (99.67%), Query Frame = 2
Query:  356 MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFHPSSLDKNKLINSNFESNWKRRREHHHKTGGFISINSFHSTNLNSVSQRRHSDFDRMTRSSCEIRRQNHSFSDTDRGDHGDPFYRRNGLCSAYQQIPIVDDNQNVXXXXXXXXXXXXXXXLTTLHQISPSSQQHQFIPAKEALINTNVTTHINVQSPQIGRXXXXXXXXXXXTSVHEXXXXXXXXXXXXIRRRHRTCDQPQSYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRSFGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLPTIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFXXXXXXXXXXXXXXXXGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLVQDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSISPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTNHKQ 2179
            MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFHPSSLDKNKLINSNFESNWKRRREHHHKTGGFISINS HSTNLNSVSQRRHSDFDRMTRSSCEIRRQN SFSDTDRGDHGDPFYRRNGLCSAYQQIPIVDDNQNVRRTPPIITHPRPRIHLTTLHQISPSSQQHQFIPAKEALINTNVTTHINVQSPQIGRNNNSCNSINICTSVHENSNNFHNQSQQNIRRRHRTCDQPQSYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRSFGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLPTIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFSVATSTASLITLAAVSGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLVQDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSISPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTNHKQ
Sbjct:    1 MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFHPSSLDKNKLINSNFESNWKRRREHHHKTGGFISINSLHSTNLNSVSQRRHSDFDRMTRSSCEIRRQNRSFSDTDRGDHGDPFYRRNGLCSAYQQIPIVDDNQNVRRTPPIITHPRPRIHLTTLHQISPSSQQHQFIPAKEALINTNVTTHINVQSPQIGRNNNSCNSINICTSVHENSNNFHNQSQQNIRRRHRTCDQPQSYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRSFGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLPTIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFSVATSTASLITLAAVSGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLVQDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSISPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTNHKQ 608          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000059381.1 (SMESG000059381.1)

HSP 1 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 602/608 (99.01%), Postives = 602/608 (99.01%), Query Frame = 2
Query:  356 MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFHPSSLDKNKLINSNFESNWKRRREHHHKTGGFISINSFHSTNLNSVSQRRHSDFDRMTRSSCEIRRQNHSFSDTDRGDHGDPFYRRNGLCSAYQQIPIVDDNQNVXXXXXXXXXXXXXXXLTTLHQISPSSQQHQFIPAKEALINTNVTTHINVQSPQIGRXXXXXXXXXXXTSVHEXXXXXXXXXXXXIRRRHRTCDQPQSYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRSFGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLPTIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFXXXXXXXXXXXXXXXXGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLVQDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSISPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTNHKQ 2179
            MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFHPSSLDKNKLINSNFESNWKRRREHHHKTGGFISINS HSTNLNSVSQRRHSDFDRMTRSSCEIRRQN SFSDTDRGDHGDPFYRRN    AYQQIPIVDDNQNVRRTPPIITHPRPRIHLTTLHQISPSSQQHQFIPAKEALINTNVTTHINVQSPQIGRNNNSCNSINICTSVHENSNNFHNQSQQNIRRRHRTCDQPQSYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRSFGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLPTIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFSVATSTASLITLAAVSGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLVQDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSISPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTNHKQ
Sbjct:    1 MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFHPSSLDKNKLINSNFESNWKRRREHHHKTGGFISINSLHSTNLNSVSQRRHSDFDRMTRSSCEIRRQNRSFSDTDRGDHGDPFYRRN----AYQQIPIVDDNQNVRRTPPIITHPRPRIHLTTLHQISPSSQQHQFIPAKEALINTNVTTHINVQSPQIGRNNNSCNSINICTSVHENSNNFHNQSQQNIRRRHRTCDQPQSYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRSFGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLPTIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFSVATSTASLITLAAVSGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLVQDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSISPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGLTNHKQ 604          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000010278.1 (SMESG000010278.1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.374e-21
Identity = 47/105 (44.76%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 1880 LPTLDHLPL-IDQPKPGITRQELDTIPTRKFI--------KNNNDMNYKVTDDDKD---RCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 2158
            + TL HL    +Q K GITR+ELD +PT ++         ++ N ++   T + K+   +C++CLEDF   + IR L+C H+FH+ C++KWLKINRTCPLCR+DA
Sbjct:  410 IDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 514          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000016770.1 (SMESG000016770.1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.045e-17
Identity = 38/81 (46.91%), Postives = 57/81 (70.37%), Query Frame = 2
Query: 1925 GITRQELDTIPTRKFIKNNNDMNYKVTD-DDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDAGL 2164
            GI   EL  +P   +    ND+N   TD + +D+CM+CLE+F+ ++ +R L CSH +H +CV+KWL++NRTCP+CR+DA L
Sbjct:  681 GINPSELAQLPCHYY---KNDLNASNTDLERQDKCMVCLEEFLENDHLRTLSCSHQYHVMCVDKWLRMNRTCPMCRADATL 758          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000028227.1 (SMESG000028227.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.094e-10
Identity = 26/75 (34.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query: 1931 TRQELDTIPTRKFIKNNNDMNYKVTDDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD 2155
             ++ L+ IP +    ++ +++Y     D D+C IC++++   E IR+L C H FH IC++ WL   R+CP+C+ D
Sbjct:  238 AKKALNKIPVKILSSDDKEVSY-----DYDQCAICIDNYQVGETIRILPCKHIFHKICIDSWLIEQRSCPMCKVD 307          
The following BLAST results are available for this feature:
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF381.047e-1536.73ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF381.047e-1536.73ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF381.347e-1536.73ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF381.347e-1536.73ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF381.347e-1536.73ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
toe-42.682e-1140.51Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEM... [more]
C01G6.45.159e-938.75pep chromosome:WBcel235:II:9271265:9273042:-1 gene... [more]
plr-11.641e-846.81Probable E3 ubiquitin-protein ligase plr-1 [Sourc... [more]
C18B12.44.614e-835.37pep chromosome:WBcel235:X:15036662:15040602:-1 gen... [more]
H10E21.51.338e-732.43pep chromosome:WBcel235:III:20531:23962:-1 gene:WB... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mura1.232e-1743.53gene:FBgn0037705 transcript:FBtr0082118[more]
mura1.906e-1743.53gene:FBgn0037705 transcript:FBtr0082116[more]
mura1.906e-1743.53gene:FBgn0037705 transcript:FBtr0082117[more]
gzl6.852e-1141.43gene:FBgn0037442 transcript:FBtr0081721[more]
gzl6.852e-1141.43gene:FBgn0037442 transcript:FBtr0081722[more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf444.539e-1533.66ring finger protein 44 [Source:NCBI gene;Acc:76768... [more]
rnf385.076e-1538.46ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf385.149e-1538.46ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf385.299e-1538.46ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf445.509e-1537.97ring finger protein 44 [Source:NCBI gene;Acc:76768... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf381.012e-1536.73ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
rnf381.396e-1536.73ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
rnf381.466e-1536.73ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
rnf381.851e-1536.73ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
rnf382.290e-1536.73ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf386.870e-1535.71ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf386.870e-1535.71ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf386.870e-1535.71ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf388.910e-1535.71ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf448.939e-1537.18ring finger protein 44 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H0F5|RNF38_HUMAN9.157e-1536.73E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens ... [more]
sp|Q08CG8|RNF44_DANRE4.159e-1437.97RING finger protein 44 OS=Danio rerio OX=7955 GN=r... [more]
sp|Q7L0R7|RNF44_HUMAN5.640e-1437.18RING finger protein 44 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8BI21|RNF38_MOUSE5.978e-1435.71E3 ubiquitin-protein ligase RNF38 OS=Mus musculus ... [more]
sp|Q4V7B8|RNF44_RAT6.664e-1437.18RING finger protein 44 OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1C4B46.634e-1844.83Zinc finger, C3HC4 type OS=Fasciola hepatica OX=61... [more]
A0A504YG591.235e-1743.14RING-type domain-containing protein OS=Fasciola gi... [more]
A0A4E0RZ541.513e-1743.14RING-type domain-containing protein OS=Fasciola he... [more]
A0A4S2L6D81.593e-1745.98RING-type domain-containing protein OS=Opisthorchi... [more]
H2KUM41.307e-1645.78RING finger protein 38 OS=Clonorchis sinensis OX=7... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf442.371e-1538.46ring finger protein 44 [Source:NCBI gene;Acc:10303... [more]
rnf386.988e-1535.71ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf128a1.359e-1147.17ring finger protein 128 [Source:NCBI gene;Acc:1030... [more]
rnf150a2.773e-1036.59ring finger protein 150 [Source:NCBI gene;Acc:1030... [more]
rnf150a2.966e-1036.59ring finger protein 150 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1113.985e-1235.21ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf150a6.156e-1132.88ring finger protein 150a [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000003771.12.163e-845.83pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:... [more]
si:ch1073-392o20.12.777e-843.90ring finger protein 122 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000003380.11.178e-735.59pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 ge... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492831.089e-1337.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493001.094e-1037.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311181.553e-1035.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417587.620e-1031.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405833.582e-740.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000004098.24.078e-1639.74E3 ubiquitin-protein ligase RNF38 [Source:NCBI gen... [more]
rnf387.357e-1639.74E3 ubiquitin-protein ligase RNF38 [Source:NCBI gen... [more]
rnf441.655e-1438.46ring finger protein 44 [Source:NCBI gene;Acc:10115... [more]
si:ch211-59o9.108.758e-1138.16uncharacterized LOC101160975 [Source:NCBI gene;Acc... [more]
ENSORLT00000017784.23.343e-1051.92tetratricopeptide repeat domain 3 [Source:NCBI gen... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059381.10.000e+099.67SMESG000059381.1[more]
SMESG000059381.10.000e+099.01SMESG000059381.1[more]
SMESG000010278.11.374e-2144.76SMESG000010278.1[more]
SMESG000016770.11.045e-1746.91SMESG000016770.1[more]
SMESG000028227.11.094e-1034.67SMESG000028227.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027830 ID=SMED30027830|Name=Protein regulator of cytokinesis 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2364bp
GTTTAATGTAAATTCTAAATTTCATTGGATTTTTGGAAGAGCTATAAATA
CATGCGTGTTGTATGCGTGTTGTATGACCTCAATACTGGTAGATAGAAAT
TGTGTCTCAATTTCAAGGTCATAAGAGAAGACAAATAACAGTCGAAAGAG
TAGATAAACATACAAAAGTAGTTAGAAAATTATATGTGTGCATAGCTAAA
GAATGCAAGTCATTTCAAATCAATAAATAACAATTGTTAAGCTATATCTA
GGTTACAAGCATTTAAAGTGATTTATAAAAACTGATTTGTAGAGGCATGA
AGTTTATAATAAATCTTTGAATTTATGTTTTGGATGTTTTATCGCCTTAA
ATGGTATGTTGGAATCGTCTGTTGTTTCAAATAAAATAAACATTGGACCA
CCTTTTATTAACAATAGCAACATAAGATTAAAATTAGAAAATTGGATAGG
ATCAGATAAATCAACTAATCTCACAAGAAATAGCTCAAATAGAAAACGAT
TCCACCCATCTTCTTTAGATAAAAATAAACTAATCAACTCAAATTTTGAA
AGTAATTGGAAACGTAGAAGAGAACATCATCATAAAACTGGTGGATTTAT
TTCTATAAATTCTTTTCATTCCACAAACTTAAACAGTGTTAGTCAAAGAC
GACATTCTGATTTTGATAGAATGACAAGATCAAGTTGCGAAATAAGGCGA
CAGAATCACAGCTTTTCTGATACCGACAGAGGTGATCATGGAGACCCATT
TTATAGACGAAATGGTTTATGTTCAGCTTATCAACAAATACCCATTGTTG
ATGATAATCAAAATGTTCGCAGAACACCACCAATAATCACTCATCCGAGA
CCGCGCATCCATTTGACCACATTGCATCAGATATCACCATCTTCTCAGCA
GCACCAATTTATTCCAGCCAAAGAGGCCTTGATAAACACCAATGTGACGA
CTCATATTAATGTCCAATCGCCCCAGATTGGTAGAAATAATAATTCATGC
AACTCTATTAATATCTGCACATCAGTACATGAAAACAGTAACAATTTTCA
TAACCAATCTCAACAAAATATCAGAAGGCGTCATCGTACATGTGATCAAC
CTCAATCTTATCAACTTAATTCAACCACACAAACTCCATTCGTTACACCA
AGAACAGTTAATAATGTCTCTTCTCAATCAGCTCTAGCTGCTTGCAGCAT
TCCAAATCGTACTATATGTCACAACTCCACTTCATTTCCTTCTGTTACTC
GCTCATTTGGCCAGAACTCCAATCAGCTCAGATTTACAACGTATCCACTG
ACTGCCTATACTCCTCAGCAACCATCTATATTTTCTCGTCATTCTCTACC
GACAAATAGCATTCATACTCACAATTCAGCCTTTTGTTCTGCCGTCCAGT
TACCAACAATTATCGGTGATGTGTTCACCTCAGCACCTTGTCATCAATGT
GCTATTATTGCAAGTTCTGGTTTAAATGCATTCTCAAACTTGTCTTCAAT
GCTACAGTTTTCAGTTGCAACATCAACAGCTAGTCTCATTACTTTAGCTG
CTGTTTCAGGAGACCGAGTTCACGGCTCTAGGCTTAGTTATGTACCAGTT
CACACCGTAAATCATTGGCACAATCATCATCCGTATTTACCTGCCGCATG
GAGTTACAACGATCTAACATCAATTTTACAGAATCCCACCGCGAGAAACC
TGGTCCAGGATCAATTGGCTCAACGAATGTTATCGGGGTCGGCAAATGTA
GGTGTACAACTTGTAATGCTTGCTCCATCGTCAGTAGTTGGATCAAGCAA
TGATCATTCACAACTCAGACATCACATTTATCCATTACCACGAACCGATT
CTATTTCCCCGATCACAGTATCTCGTTATCTGCCTACTCTTGACCATTTG
CCATTGATCGATCAACCGAAACCAGGAATAACCCGACAAGAACTTGATAC
GATTCCAACAAGAAAATTCATAAAAAACAACAATGATATGAATTATAAAG
TTACTGATGATGATAAAGATCGCTGTATGATTTGTCTAGAAGATTTCATG
CCTGATGAGATCATCCGTATGTTGAGATGTTCACATGATTTTCATTCTAT
TTGCGTTGAAAAGTGGTTGAAAATTAATCGCACTTGTCCACTTTGCCGTT
CCGACGCAGGCTTGACTAATCACAAACAGTAACAACACGATATTAGCGAA
AGTAGATATCAGAATTATTATTAATTAGCTTTAGTTGTTCTGTGTGTTGA
CTGATCTTATATTAGTGCATGCACTTGGTGCTCGTATTATCATATTTTAT
ACTTTCTCTTTTATTAATTTTTATTAGTGGCCAACTGCTATTGTTTTAAT
GTGCACTTGCAATG
back to top

protein sequence of SMED30027830-orf-1

>SMED30027830-orf-1 ID=SMED30027830-orf-1|Name=SMED30027830-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=609bp
MLESSVVSNKINIGPPFINNSNIRLKLENWIGSDKSTNLTRNSSNRKRFH
PSSLDKNKLINSNFESNWKRRREHHHKTGGFISINSFHSTNLNSVSQRRH
SDFDRMTRSSCEIRRQNHSFSDTDRGDHGDPFYRRNGLCSAYQQIPIVDD
NQNVRRTPPIITHPRPRIHLTTLHQISPSSQQHQFIPAKEALINTNVTTH
INVQSPQIGRNNNSCNSINICTSVHENSNNFHNQSQQNIRRRHRTCDQPQ
SYQLNSTTQTPFVTPRTVNNVSSQSALAACSIPNRTICHNSTSFPSVTRS
FGQNSNQLRFTTYPLTAYTPQQPSIFSRHSLPTNSIHTHNSAFCSAVQLP
TIIGDVFTSAPCHQCAIIASSGLNAFSNLSSMLQFSVATSTASLITLAAV
SGDRVHGSRLSYVPVHTVNHWHNHHPYLPAAWSYNDLTSILQNPTARNLV
QDQLAQRMLSGSANVGVQLVMLAPSSVVGSSNDHSQLRHHIYPLPRTDSI
SPITVSRYLPTLDHLPLIDQPKPGITRQELDTIPTRKFIKNNNDMNYKVT
DDDKDRCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSD
AGLTNHKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
GO:0001578microtubule bundle formation
GO:0032465regulation of cytokinesis
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 557..597
e-value: 1.4E-6
score: 37.9
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 556..598
e-value: 8.1E-12
score: 45.3
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 557..598
score: 12.873
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 525..604
e-value: 2.2E-19
score: 70.4
NoneNo IPR availablePANTHERPTHR46171FAMILY NOT NAMEDcoord: 524..601
NoneNo IPR availableCDDcd16454RING-H2_PA-TM-RINGcoord: 557..598
e-value: 3.15651E-16
score: 70.4085
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 549..601