Si:ch211-163l21.7

Overview
NameSi:ch211-163l21.7
Smed IDSMED30027818
Length (bp)700
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-163l21.7 (SMED30027818) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-163l21.7 (SMED30027818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-163l21.7 (SMED30027818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-163l21.7 (SMED30027818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027818SMESG000026490.1 SmedASXL_019201SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027818SMESG000026490.1 dd_Smed_v6_3833_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30027818SMESG000026490.1 OX_Smed_1.0.21621ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30027818SMESG000026490.1 dd_Smed_v4_3833_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-163l21.7 vs. Ensembl Human
Match: C1orf194 (chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:32331])

HSP 1 Score: 103.219 bits (256), Expect = 5.824e-27
Identity = 63/170 (37.06%), Postives = 94/170 (55.29%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKK-NFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPET---LYPEQC---GRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            RDPF     +ND ++ G L+  KK  +  PTHLAQ ++PW+RL    T++S+R +A  +DP  P D+LDF+L  LYN H+  FK++++I+   +T    Y  +    G  L     P+          +R     KKES  +++  I S HT  TN G+SRK DGG F++
Sbjct:    5 RDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPI-----TFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST 169          
BLAST of Si:ch211-163l21.7 vs. Ensembl Human
Match: C1orf194 (chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:32331])

HSP 1 Score: 89.3521 bits (220), Expect = 7.344e-22
Identity = 53/144 (36.81%), Postives = 80/144 (55.56%), Query Frame = 3
Query:  156 FSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPET---LYPEQC---GRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            +  PTHLAQ ++PW+RL    T++S+R +A  +DP  P D+LDF+L  LYN H+  FK++++I+   +T    Y  +    G  L     P+          +R     KKES  +++  I S HT  TN G+SRK DGG F++
Sbjct:   19 YKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPI-----TFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST 157          
BLAST of Si:ch211-163l21.7 vs. Ensembl Human
Match: C1orf194 (chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:32331])

HSP 1 Score: 54.299 bits (129), Expect = 5.421e-9
Identity = 37/107 (34.58%), Postives = 55/107 (51.40%), Query Frame = 3
Query:  267 PSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL---YPEQC---GRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            P D+LDF+L  LYN H+  FK++++I+   +T    Y  +    G  L     P+          +R     KKES  +++  I S HT  TN G+SRK DGG F++
Sbjct:   29 PKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPI-----TFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST 130          
BLAST of Si:ch211-163l21.7 vs. Ensembl Fly
Match: CG5435 (gene:FBgn0032431 transcript:FBtr0345613)

HSP 1 Score: 60.077 bits (144), Expect = 6.007e-11
Identity = 46/151 (30.46%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  162 KPTHLAQNEDPWNRLAYDGTLSSIRHEAT-QYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL----------YPEQCG------RVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVF 563
            KP     + +P+ RL Y  T++S+R     + +P  P D LDF L++ Y+     F D+   + Q ET             ++ G      RVL+N     ++++  L HPLRI    +K  P +VK      H Q  N GFSR+   G F
Sbjct:   39 KPGTWHGHLEPYQRLFYHQTMNSVRSSKRYRANPNIPKDTLDFSLQSRYDHTREAFPDKVDYVMQRETCRAISSWSAPGAAKEIGSQLKSFRVLRNTRFIRRKQEDVLGHPLRIGGCKEKIHPHSVKLICSGVHNQLVNNGFSRQTSDGNF 189          
BLAST of Si:ch211-163l21.7 vs. Ensembl Fly
Match: CG5435 (gene:FBgn0032431 transcript:FBtr0080387)

HSP 1 Score: 60.077 bits (144), Expect = 6.007e-11
Identity = 46/151 (30.46%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  162 KPTHLAQNEDPWNRLAYDGTLSSIRHEAT-QYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL----------YPEQCG------RVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVF 563
            KP     + +P+ RL Y  T++S+R     + +P  P D LDF L++ Y+     F D+   + Q ET             ++ G      RVL+N     ++++  L HPLRI    +K  P +VK      H Q  N GFSR+   G F
Sbjct:   39 KPGTWHGHLEPYQRLFYHQTMNSVRSSKRYRANPNIPKDTLDFSLQSRYDHTREAFPDKVDYVMQRETCRAISSWSAPGAAKEIGSQLKSFRVLRNTRFIRRKQEDVLGHPLRIGGCKEKIHPHSVKLICSGVHNQLVNNGFSRQTSDGNF 189          
BLAST of Si:ch211-163l21.7 vs. Ensembl Zebrafish
Match: si:ch211-163l21.7 (si:ch211-163l21.7 [Source:NCBI gene;Acc:567726])

HSP 1 Score: 121.709 bits (304), Expect = 2.202e-34
Identity = 65/163 (39.88%), Postives = 95/163 (58.28%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            RDPFP  ++END   TG  + QK +  KPTHLAQN++PW RL    T +S R     YD   P D+LD  LK  Y+ H  LF++++Q + Q ET+  +   +  K     V +   A N  +++   ++K S +++K  I SHHT  TNRG+SRK DGG +++
Sbjct:    5 RDPFPFPRYENDFTLTGRKEIQKLSDDKPTHLAQNDEPWRRLHNTTTEASSRRTVFHYDTTTPKDSLDIHLKAAYDHHLGLFQNKSQTVMQMETVGADNGTKKNKELEDSVCD---AENKGIKVWVDTQKASLYSIKGSIESHHTASTNRGYSRKHDGGFYST 164          
BLAST of Si:ch211-163l21.7 vs. Ensembl Xenopus
Match: naxd (NAD(P)HX dehydratase [Source:Xenbase;Acc:XB-GENE-982726])

HSP 1 Score: 138.658 bits (348), Expect = 8.294e-41
Identity = 74/164 (45.12%), Postives = 103/164 (62.80%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYK--PVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFT 566
            RDP+P  ++END  F G  + Q+    K  +L Q EDPW RL    TLSS R     YDP APSD+LDF LK+LY+ H+ L KD+N+ ++QPETL  E  GR+LKNR K  PV +E+    H ++   + ++ + +++   I SHH   TNRG+SRK DGG ++
Sbjct:    5 RDPYPFTRYENDDTFQGK-EIQRTTGRKSHNLPQKEDPWYRLNSTATLSSDRRAVYYYDPEAPSDSLDFTLKSLYDHHNGLLKDRNETLYQPETL-TESHGRILKNRVKEIPVSQEEI---HSVKQWVSPQRANMYSINGAIVSHHAAATNRGYSRKQDGGYYS 163          
BLAST of Si:ch211-163l21.7 vs. Ensembl Mouse
Match: 1700013F07Rik (RIKEN cDNA 1700013F07 gene [Source:MGI Symbol;Acc:MGI:1922754])

HSP 1 Score: 90.1225 bits (222), Expect = 4.525e-22
Identity = 60/174 (34.48%), Postives = 87/174 (50.00%), Query Frame = 3
Query:   93 PLEKFEN------DKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL---------YPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            P E F N      DK        +K  +  P HLAQ +DPW+RL+   T +S R   T +D   P D+LDF+L TLYN H+  FK++ +I+   ET+         +P +C         P+   +  + H +      KKES  +++  I S HT  TN G+SRK DGG F++
Sbjct:    4 PQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWSRLSSTPTATS-RSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGEC---FHAPSAPIT-SRTTIRHWIN----PKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST 168          
BLAST of Si:ch211-163l21.7 vs. UniProt/SwissProt
Match: sp|A8Y5T1|CA194_DANRE (Uncharacterized protein C1orf194 homolog OS=Danio rerio OX=7955 GN=si:ch211-163l21.7 PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.662e-33
Identity = 65/163 (39.88%), Postives = 95/163 (58.28%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            RDPFP  ++END   TG  + QK +  KPTHLAQN++PW RL    T +S R     YD   P D+LD  LK  Y+ H  LF++++Q + Q ET+  +   +  K     V +   A N  +++   ++K S +++K  I SHHT  TNRG+SRK DGG +++
Sbjct:    5 RDPFPFPRYENDFTLTGRKEIQKLSDDKPTHLAQNDEPWRRLHNTTTEASSRRTVFHYDTTTPKDSLDIHLKAAYDHHLGLFQNKSQTVMQMETVGADNGTKKNKELEDSVCD---AENKGIKVWVDTQKASLYSIKGSIESHHTASTNRGYSRKHDGGFYST 164          
BLAST of Si:ch211-163l21.7 vs. UniProt/SwissProt
Match: sp|Q5T5A4|CA194_HUMAN (Protein C1orf194 OS=Homo sapiens OX=9606 GN=C1orf194 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.797e-26
Identity = 63/170 (37.06%), Postives = 94/170 (55.29%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKK-NFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPET---LYPEQC---GRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            RDPF     +ND ++ G L+  KK  +  PTHLAQ ++PW+RL    T++S+R +A  +DP  P D+LDF+L  LYN H+  FK++++I+   +T    Y  +    G  L     P+          +R     KKES  +++  I S HT  TN G+SRK DGG F++
Sbjct:    5 RDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPI-----TFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST 169          
BLAST of Si:ch211-163l21.7 vs. UniProt/SwissProt
Match: sp|Q9DAD0|CA194_MOUSE (Protein C1orf194 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.165e-21
Identity = 60/174 (34.48%), Postives = 87/174 (50.00%), Query Frame = 3
Query:   93 PLEKFEN------DKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL---------YPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            P E F N      DK        +K  +  P HLAQ +DPW+RL+   T +S R   T +D   P D+LDF+L TLYN H+  FK++ +I+   ET+         +P +C         P+   +  + H +      KKES  +++  I S HT  TN G+SRK DGG F++
Sbjct:    4 PQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWSRLSSTPTATS-RSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGEC---FHAPSAPIT-SRTTIRHWIN----PKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST 168          
BLAST of Si:ch211-163l21.7 vs. TrEMBL
Match: A0A1I8GH79 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028779g1 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.718e-54
Identity = 89/168 (52.98%), Postives = 118/168 (70.24%), Query Frame = 3
Query:   66 MSTSLRDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            MST+ RDP+P  ++E+D+   G    +K  +SKPTHLAQ +DPW+RL    TL+S RH+A  YDP AP+D+LDF LKT Y+QH +LFK ++Q++ Q ET Y E  GRVLKNR + V++  P L HPLR  +  ++E   ++K  I  HHTQ TNRG+SRKPDGG FTS
Sbjct:    1 MSTAHRDPYPYPRYESDQTLAGLKPTEKATYSKPTHLAQQDDPWSRLNLSQTLTSTRHQAFYYDPQAPNDSLDFVLKTEYDQHRDLFKGKSQVLLQTETCYDEH-GRVLKNRIRQVQQVPPKLGHPLRQWQQPRREDVNSIKNAIEGHHTQATNRGYSRKPDGGHFTS 167          
BLAST of Si:ch211-163l21.7 vs. TrEMBL
Match: A0A1I8HAG6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028779g3 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.534e-53
Identity = 89/168 (52.98%), Postives = 116/168 (69.05%), Query Frame = 3
Query:   66 MSTSLRDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            MST+ RDP+P  ++E+D+   G    +K  +SKPTHLAQ +DPW+RL    TL+S RH+A  YDP AP+D+LDF LKT Y+QH  LFK +NQ++ Q ET   E  GRVLKNR + V++  P L HPLR  +  ++E   ++K  I  HHTQ TNRG+SRKPDGG FTS
Sbjct:    1 MSTAHRDPYPYPRYESDQTLAGLKPTEKATYSKPTHLAQQDDPWSRLNLSQTLTSTRHQAFYYDPQAPNDSLDFVLKTEYDQHRELFKGKNQVLLQTETCSDEH-GRVLKNRIRQVQQVPPKLGHPLRQWQQPRREDVNSIKNAIEGHHTQATNRGYSRKPDGGHFTS 167          
BLAST of Si:ch211-163l21.7 vs. TrEMBL
Match: A0A3S1BHU0 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_003639 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 3.799e-52
Identity = 88/165 (53.33%), Postives = 113/165 (68.48%), Query Frame = 3
Query:   75 SLRDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            S RDP+P  + +ND  F G    +   +S PTHLAQ + PW RL+   TLSS RHE   +DP+AP+D+LDF LK+ YNQH  L +++N++++QPET   +  GRVLKNR  PV E+K ALNHPL I   +KKE+  +VK  I SHHT+ TN GFSRKPDGG F S
Sbjct:    6 SSRDPYPFPQRQNDDNFMGKRDPEAICYSVPTHLAQRQQPWERLSCQHTLSSARHEVYHHDPIAPNDDLDFVLKSTYNQHEELLRNKNEVVYQPET-KGQHHGRVLKNRVIPVPEKKMALNHPLIITSQTKKENINSVKSAIESHHTETTNMGFSRKPDGGFFCS 169          
BLAST of Si:ch211-163l21.7 vs. TrEMBL
Match: A0A1S3JNJ5 (uncharacterized protein C1orf194 homolog OS=Lingula unguis OX=7574 GN=LOC106174790 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.061e-50
Identity = 89/163 (54.60%), Postives = 107/163 (65.64%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            RD +P  +FEND  F G     K  ++ PTHLAQ  DPW RL    TL+S R E   YDPLAP D+LDF LK+ YN H  LFK++N  ++QPET+  E  GRVLKNR K +K E   LNHPL I E +KKES  +VK  I  +HTQ TN G+SRKPDGG FT+
Sbjct:    5 RDCYPFPRFENDDQFVGQRSSLKLPYTLPTHLAQTFDPWRRLNSTATLTSARREVYYYDPLAPVDSLDFILKSQYNHHDELFKNRNHTLFQPETIGMEH-GRVLKNRVKVIKVEPKPLNHPLEIAEWTKKESIHSVKNAIDGNHTQTTNIGYSRKPDGGFFTT 166          
BLAST of Si:ch211-163l21.7 vs. TrEMBL
Match: A0A2C9JH05 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067389 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.189e-49
Identity = 86/179 (48.04%), Postives = 117/179 (65.36%), Query Frame = 3
Query:   75 SLRDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS*RNSEILTIFAKFN 611
            S R+P+P  +F+ND  F G  + +   +  PTHLAQ + PW+RL+   TLSS RHEA  +DP AP+D+LDF LK  YN H  L  ++N++++QPET + ++ GRVLKNR KP+ E+K  LNHPL I    KKE+  +VK  I SHH + TN+G+SRKPDGG F       +  +F  FN
Sbjct:    6 STRNPYPFPQFQNDDNFQGQREPEIICYPVPTHLAQRQLPWHRLSTHHTLSSARHEAYHFDPAAPNDDLDFVLKATYNHHEALLNNKNEVVFQPET-FTDEHGRVLKNRVKPLPEKKMPLNHPLIITGQEKKENLNSVKNAIASHHIETTNKGYSRKPDGGFFV------LKIVFIMFN 177          
BLAST of Si:ch211-163l21.7 vs. Ensembl Cavefish
Match: si:ch211-163l21.7 (uncharacterized protein C1orf194 homolog [Source:NCBI gene;Acc:103046376])

HSP 1 Score: 123.635 bits (309), Expect = 2.437e-35
Identity = 66/163 (40.49%), Postives = 98/163 (60.12%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            RDP+   ++END  FTG  + QK  F KPTHLAQN++PW+RL    T SS+R     +D  AP D+LD  L+++Y+ H++L  ++NQ + Q ETL        +  R K  + ++P    PLR+    +K S F+++  I S H   TNRG+SRK DGG +++
Sbjct:    5 RDPYQFPRYENDLNFTGIKESQKPPFKKPTHLAQNDEPWSRLNDTATFSSMRRSVLHHDEFAPKDSLDLHLRSVYDNHADLLLNKNQTVLQRETL--------MDRRGKHNESDEPE-KEPLRVWVNPQKASIFSIEGSIESPHKAATNRGYSRKHDGGFYSA 158          
BLAST of Si:ch211-163l21.7 vs. Ensembl Cavefish
Match: si:ch211-163l21.7 (uncharacterized protein C1orf194 homolog [Source:NCBI gene;Acc:103046376])

HSP 1 Score: 98.9821 bits (245), Expect = 2.055e-25
Identity = 54/140 (38.57%), Postives = 82/140 (58.57%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGI 500
            RDP+   ++END  FTG  + QK  F KPTHLAQN++PW+RL    T SS+R     +D  AP D+LD  L+++Y+ H++L  ++NQ + Q ETL        +  R K  + ++P    PLR+    +K S F+++  I
Sbjct:    5 RDPYQFPRYENDLNFTGIKESQKPPFKKPTHLAQNDEPWSRLNDTATFSSMRRSVLHHDEFAPKDSLDLHLRSVYDNHADLLLNKNQTVLQRETL--------MDRRGKHNESDEPE-KEPLRVWVNPQKASIFSIEGSI 135          
BLAST of Si:ch211-163l21.7 vs. Ensembl Cavefish
Match: ENSAMXT00000055353.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:2365608:2367882:1 gene:ENSAMXG00000030701.1 transcript:ENSAMXT00000055353.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 2.260e-7
Identity = 42/138 (30.43%), Postives = 63/138 (45.65%), Query Frame = 3
Query:  111 NDKAFTGALQEQKKN---FSKPTHLAQ----NEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL--YPEQCGRVLKNRYKPVK-------EEKPALNHPLRIVEASKKES 476
            +DK  T A +  K       KP   A      EDPW+RL+   T SS R      D   P D+LD KL ++Y+Q  +    +N+++ Q ETL   PE+       + +P +         KP + H L+ +  S+K S
Sbjct:    2 SDKGITYAFKRYKGEPSFLMKPIKYAVLQTPKEDPWSRLSETPTFSSKRRSVYSDD--NPIDSLDLKLTSVYDQSKDFLSSKNKVVLQSETLGIKPEELQEPEALQEEPCRLPRCTTGSVKPQMLHSLKSLSMSQKSS 137          
BLAST of Si:ch211-163l21.7 vs. Ensembl Nematostella
Match: EDO45338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT80])

HSP 1 Score: 107.071 bits (266), Expect = 3.050e-29
Identity = 66/166 (39.76%), Postives = 90/166 (54.22%), Query Frame = 3
Query:   81 RDPFPLEKFENDKAFTGALQEQ----KKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFT 566
            RDP+P  + +ND  FTG+  +Q     KN ++      N    +RL    TLSS R E   +DP AP D+LDF +K+ Y+ H+   +   + + QPET+   Q GRVLKNR  P   E      PL    A KKE+  ++   I SHH+  TN G+SRK DGG +T
Sbjct:    3 RDPYPFPRLQNDTDFTGSPAKQVGVTTKNHTRSKSAEGNA--HDRLYQTATLSSSRREVFYFDPQAPQDSLDFVIKSTYDNHNEFLRSAAETLVQPETIGLTQ-GRVLKNRPPPPDPEIDMYKLPLTRSTAIKKENINSINGAIESHHSAATNGGYSRKHDGGFYT 165          
BLAST of Si:ch211-163l21.7 vs. Planmine SMEST
Match: SMESG000026490.1 (SMESG000026490.1)

HSP 1 Score: 350.903 bits (899), Expect = 7.762e-125
Identity = 167/168 (99.40%), Postives = 167/168 (99.40%), Query Frame = 3
Query:   66 MSTSLRDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            MSTSLRDPFPLEKFENDKAFTG LQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS
Sbjct:    1 MSTSLRDPFPLEKFENDKAFTGVLQEQKKNFSKPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 168          
BLAST of Si:ch211-163l21.7 vs. Planmine SMEST
Match: SMESG000069016.1 (SMESG000069016.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.012e-31
Identity = 60/134 (44.78%), Postives = 80/134 (59.70%), Query Frame = 3
Query:  165 PTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFT 566
            P  L Q +DPWNRL    TL+S RH    +DPL P D+LDF LK  Y+ H + +K + +   Q E+ +    GR++KNR +P   + P   HPL I E+  KES  +VK  I   H+Q TN G+SR PDGG+FT
Sbjct:    9 PVILHQEKDPWNRLYNARTLTSTRHRYNYFDPLVPKDSLDFILKEEYDHHRDWWKTRAEERVQIES-FTGSHGRIMKNRIRPYNFKSPKTKHPLVIAESPVKESIHSVKNAIEGCHSQITNAGYSRMPDGGIFT 141          
BLAST of Si:ch211-163l21.7 vs. Planmine SMEST
Match: SMESG000065614.1 (SMESG000065614.1)

HSP 1 Score: 104.76 bits (260), Expect = 2.075e-28
Identity = 59/137 (43.07%), Postives = 81/137 (59.12%), Query Frame = 3
Query:  162 KPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRI-VEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 569
            +PT LAQN DP+NRL +  TL+S R      DPL P D LD  LK  Y+QH + +K++ +      TL  E  GR+ KN+   VK++ P L HPL+I     +KE+ F++K  I   H Q TN G+SRK DG +F +
Sbjct:    4 QPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTL-SESHGRIFKNKLTGVKKKLPKLIHPLKIRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 139          
The following BLAST results are available for this feature:
BLAST of Si:ch211-163l21.7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C1orf1945.824e-2737.06chromosome 1 open reading frame 194 [Source:HGNC S... [more]
C1orf1947.344e-2236.81chromosome 1 open reading frame 194 [Source:HGNC S... [more]
C1orf1945.421e-934.58chromosome 1 open reading frame 194 [Source:HGNC S... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG54356.007e-1130.46gene:FBgn0032431 transcript:FBtr0345613[more]
CG54356.007e-1130.46gene:FBgn0032431 transcript:FBtr0080387[more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-163l21.72.202e-3439.88si:ch211-163l21.7 [Source:NCBI gene;Acc:567726][more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naxd8.294e-4145.12NAD(P)HX dehydratase [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
1700013F07Rik4.525e-2234.48RIKEN cDNA 1700013F07 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A8Y5T1|CA194_DANRE1.662e-3339.88Uncharacterized protein C1orf194 homolog OS=Danio ... [more]
sp|Q5T5A4|CA194_HUMAN2.797e-2637.06Protein C1orf194 OS=Homo sapiens OX=9606 GN=C1orf1... [more]
sp|Q9DAD0|CA194_MOUSE3.165e-2134.48Protein C1orf194 homolog OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GH791.718e-5452.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HAG61.534e-5352.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S1BHU03.799e-5253.33Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3JNJ53.061e-5054.60uncharacterized protein C1orf194 homolog OS=Lingul... [more]
A0A2C9JH055.189e-4948.04Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-163l21.72.437e-3540.49uncharacterized protein C1orf194 homolog [Source:N... [more]
si:ch211-163l21.72.055e-2538.57uncharacterized protein C1orf194 homolog [Source:N... [more]
ENSAMXT00000055353.12.260e-730.43pep primary_assembly:Astyanax_mexicanus-2.0:13:236... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453383.050e-2939.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-163l21.7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-163l21.7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026490.17.762e-12599.40SMESG000026490.1[more]
SMESG000069016.11.012e-3144.78SMESG000069016.1[more]
SMESG000065614.12.075e-2843.07SMESG000065614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027818 ID=SMED30027818|Name=Si:ch211-163l21.7|organism=Schmidtea mediterranea sexual|type=transcript|length=700bp
AGTGATAGTTGCAGTTATTATCTTGAAAATATTAATAATTTAAAATAATT
AAGATATAATTCAAAATGAGCACATCACTAAGAGATCCATTTCCATTAGA
GAAATTTGAAAATGATAAGGCATTCACTGGAGCACTCCAAGAACAAAAAA
AGAATTTCTCAAAGCCGACACATTTAGCGCAAAATGAAGATCCATGGAAT
CGACTGGCATATGATGGAACCCTGTCAAGCATTCGTCATGAGGCAACTCA
ATATGATCCGTTAGCTCCATCTGACAATCTTGATTTCAAACTGAAAACAT
TATACAACCAACACTCGAATCTGTTCAAGGACCAGAATCAAATAATGTGG
CAACCAGAAACATTATATCCAGAACAGTGCGGTCGGGTTTTAAAGAATCG
ATACAAACCAGTCAAAGAGGAGAAGCCTGCTCTGAACCATCCATTGAGGA
TTGTTGAGGCATCCAAGAAGGAAAGTCCATTTAATGTGAAATGCGGAATA
CCAAGCCACCACACACAGGAAACTAACAGAGGATTTTCCAGGAAGCCTGA
TGGGGGAGTGTTCACCTCCTAAAGAAACAGTGAAATCCTGACAATTTTTG
CTAAATTTAACTAGAGATTTTCACACGAAATATCCTTTCCTAGCAATTTG
TTGTTGTGTTCGTACCTTTCTGTTCAAATATATTTCAATGTCAAAAAAAA
back to top

protein sequence of SMED30027818-orf-1

>SMED30027818-orf-1 ID=SMED30027818-orf-1|Name=SMED30027818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MSTSLRDPFPLEKFENDKAFTGALQEQKKNFSKPTHLAQNEDPWNRLAYD
GTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETL
YPEQCGRVLKNRYKPVKEEKPALNHPLRIVEASKKESPFNVKCGIPSHHT
QETNRGFSRKPDGGVFTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0051181cofactor transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR022179DUF3695
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022179Protein of unknown function DUF3695PFAMPF12494DUF3695coord: 30..127
e-value: 9.0E-26
score: 89.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..168