Histone-binding protein RBBP4

Overview
NameHistone-binding protein RBBP4
Smed IDSMED30027816
Length (bp)1611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-binding protein RBBP4 (SMED30027816) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-binding protein RBBP4 (SMED30027816) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-binding protein RBBP4 (SMED30027816) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-binding protein RBBP4 (SMED30027816) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027816

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027816SMESG000043499.1 SmedASXL_006042SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027816SMESG000043499.1 SmedASXL_006042SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30027816SMESG000043499.1 dd_Smed_v4_5104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027816SMESG000043499.1 dd_Smed_v4_5104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30027816SMESG000043499.1 dd_Smed_v4_5104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 293.508 bits (750), Expect = 1.162e-93
Identity = 166/421 (39.43%), Postives = 239/421 (56.77%), Query Frame = 2
Query:   92 MLNKEYVDES-EERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  D++ EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 407          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 292.352 bits (747), Expect = 4.154e-93
Identity = 166/422 (39.34%), Postives = 238/422 (56.40%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 290.426 bits (742), Expect = 1.456e-92
Identity = 165/417 (39.57%), Postives = 235/417 (56.35%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWK 1309
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ 403          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 284.263 bits (726), Expect = 5.172e-90
Identity = 159/421 (37.77%), Postives = 234/421 (55.58%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +          L+LG+ T  +++H+++A V++P++D        D D   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SH V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLH+  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+QIW+  E++
Sbjct:    1 MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATK---------TPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENI 407          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 282.337 bits (721), Expect = 8.265e-89
Identity = 157/419 (37.47%), Postives = 231/419 (55.13%), Query Frame = 2
Query:   95 LNKEYVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            L   + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +          L+LG+ T  +++H+++A V++P++D        D D   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SH V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLH+  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+QIW+  E++
Sbjct:   47 LRTVFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATK---------TPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENI 451          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 280.026 bits (715), Expect = 6.196e-89
Identity = 152/415 (36.63%), Postives = 236/415 (56.87%), Query Frame = 2
Query:  119 SEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR-NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED-DLDPD------TPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNC-INIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASI 1336
            SE+R+ ND+YK WKKN  FLYD+VMT+AL WPS + +WLP   + N      RL+LG+ T  +++H+L++ + +P++D   D        + +G F +  GK+E   RI H   + RAR+MPQKS IIAT S +  + I+D    S           A   D    PL +L G +     LSWN  + G +L A D++++  WD+  +           +F GH   V DV+W      VF S   D  + IWD+R+   S   H +  H   V  +A +P+S+F+ A+ S D TV LWD+RNL +KLHS  +++    + +  ++WSPH   +LA SG  + +++WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   V+ S + DNI+Q+W+  +++   +
Sbjct:    9 SEDRVANDEYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDVAKDNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHS-----------AVPRDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRT---STPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHR----DEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEV 404          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: rba-1 (Probable histone-binding protein rba-1 [Source:UniProtKB/Swiss-Prot;Acc:P90917])

HSP 1 Score: 184.496 bits (467), Expect = 1.355e-52
Identity = 123/410 (30.00%), Postives = 208/410 (50.73%), Query Frame = 2
Query:  143 DYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGS-TTDSDRSHVLLADVYL----PSEDDLDPDTP---FGTFKSG-LGKIELQKRIIHHNAITRARHMPQKSQIIATTS-NNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGD-PPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVAS 1333
            +++ WKKNV +LYD V+T  + WPS + +W+P   +  N      R++ G+ T    ++H++++   +    P  DD   D+    FG +  G   K + + +I H   + RAR+MP    IIA+   ++ + I+D        T   +E      DT  +P  +L G       +SW+ T  G LL AGD+  I  WD+  +            F GH+    DVS+ +    VF S   D  + +WD+R   +S+   +  GH   V  I  +PFS+++ A+ S D TV LWD+RN+  K+++L      +++ +  + +SPH   +LA SG+   + +WDI  + +      A+    PPE++F+H GH+  + DFSW+P+    I S+   N +Q+W+   S+V+S
Sbjct:   13 EHRIWKKNVPYLYDTVVTKEVEWPSLSVQWMPDVTKTENSDSSMHRMIHGTHTCGGVQNHLMISKFTITTDTPEFDDAKWDSEREEFGGYGEGSAAKWDTEIKINHPGEVHRARYMPHNPFIIASRGPSDDVYIFD-------YTKHPSEP----KDTKFRPQLRLKGHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINANQTISGQIVPQSKFKGHSSNAEDVSFHALHNFVFGSVGDDRKLNLWDLR---QSKPQLTAVGHTAEVNCITFNPFSEYILATGSVDKTVALWDMRNMRKKMYTL----KHHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISKIQDPSSSSAASSDSVPPEVIFIHAGHTGKVADFSWNPNRPWTICSSDEFNALQVWEVSNSLVSS 404          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153543:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.953e-16
Identity = 67/263 (25.48%), Postives = 115/263 (43.73%), Query Frame = 2
Query:  503 NIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVH-GHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTAND 1288
            NI D  N ++G++ E   E   I     +PLF  NG       L+W+  ++G L      K I LW +   G    +        GH  +V D++W  T   +  S S D +I +WD RS  +     +V   H+  V  I+ +     +  S  DDG + +W ++  +++     A    ++  ++++ W PH +     SG      +WDI    +    Q    G PP+L+FVH G +  + +  WH  +  +  +T+ D
Sbjct:  195 NITDALNYTHGMSGESKTEVQKI----DRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEGG---QWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRHENLI-VSGGDDGELKIWSLK--TIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADG---QTNIEGVPPQLMFVHMGQN-EVKEVHWHQQIPGLAINTSID 443          

HSP 2 Score: 56.225 bits (134), Expect = 3.379e-8
Identity = 44/174 (25.29%), Postives = 79/174 (45.40%), Query Frame = 2
Query:  791 WSTLPTVFLSSSTDCT-IGIWDIRSRNR-SRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            WS+L T  L++      I +W ++   + +  ++ + GHK  V  +A SP    + AS S DG++ LWD R+ + K   +   Q A+   ++ I W+ H  N++   G    + +W +  +   +          P  LF +  H++ IT   WHP       ++  D+   IW
Sbjct:  236 WSSLKTGDLATGDIIKKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRS-APKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQ----------PVALFKY--HNSPITSVDWHPHETTTFMASGEDDQTTIW 395          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153464:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.953e-16
Identity = 67/263 (25.48%), Postives = 115/263 (43.73%), Query Frame = 2
Query:  503 NIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVH-GHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTAND 1288
            NI D  N ++G++ E   E   I     +PLF  NG       L+W+  ++G L      K I LW +   G    +        GH  +V D++W  T   +  S S D +I +WD RS  +     +V   H+  V  I+ +     +  S  DDG + +W ++  +++     A    ++  ++++ W PH +     SG      +WDI    +    Q    G PP+L+FVH G +  + +  WH  +  +  +T+ D
Sbjct:  195 NITDALNYTHGMSGESKTEVQKI----DRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEGG---QWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRHENLI-VSGGDDGELKIWSLK--TIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADG---QTNIEGVPPQLMFVHMGQN-EVKEVHWHQQIPGLAINTSID 443          

HSP 2 Score: 56.225 bits (134), Expect = 3.379e-8
Identity = 44/174 (25.29%), Postives = 79/174 (45.40%), Query Frame = 2
Query:  791 WSTLPTVFLSSSTDCT-IGIWDIRSRNR-SRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            WS+L T  L++      I +W ++   + +  ++ + GHK  V  +A SP    + AS S DG++ LWD R+ + K   +   Q A+   ++ I W+ H  N++   G    + +W +  +   +          P  LF +  H++ IT   WHP       ++  D+   IW
Sbjct:  236 WSSLKTGDLATGDIIKKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRS-APKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQ----------PVALFKY--HNSPITSVDWHPHETTTFMASGEDDQTTIW 395          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153406:5155436:1 gene:WBGene00021899.1 transcript:Y54H5A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.953e-16
Identity = 67/263 (25.48%), Postives = 115/263 (43.73%), Query Frame = 2
Query:  503 NIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVH-GHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTAND 1288
            NI D  N ++G++ E   E   I     +PLF  NG       L+W+  ++G L      K I LW +   G    +        GH  +V D++W  T   +  S S D +I +WD RS  +     +V   H+  V  I+ +     +  S  DDG + +W ++  +++     A    ++  ++++ W PH +     SG      +WDI    +    Q    G PP+L+FVH G +  + +  WH  +  +  +T+ D
Sbjct:  195 NITDALNYTHGMSGESKTEVQKI----DRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEGG---QWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRHENLI-VSGGDDGELKIWSLK--TIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADG---QTNIEGVPPQLMFVHMGQN-EVKEVHWHQQIPGLAINTSID 443          

HSP 2 Score: 56.225 bits (134), Expect = 3.379e-8
Identity = 44/174 (25.29%), Postives = 79/174 (45.40%), Query Frame = 2
Query:  791 WSTLPTVFLSSSTDCT-IGIWDIRSRNR-SRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            WS+L T  L++      I +W ++   + +  ++ + GHK  V  +A SP    + AS S DG++ LWD R+ + K   +   Q A+   ++ I W+ H  N++   G    + +W +  +   +          P  LF +  H++ IT   WHP       ++  D+   IW
Sbjct:  236 WSSLKTGDLATGDIIKKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRS-APKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQ----------PVALFKY--HNSPITSVDWHPHETTTFMASGEDDQTTIW 395          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0301845)

HSP 1 Score: 296.975 bits (759), Expect = 2.848e-95
Identity = 162/416 (38.94%), Postives = 243/416 (58.41%), Query Frame = 2
Query:  107 YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSEDDL-------DPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIAT-TSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +      S  RL+LG+ T  +++H+L+A V LPSED         +    FG F S  GKIE++ +I H   + RAR+MPQ + +IAT T ++ + ++D     Y     + E     P    +P  +L G       LSWN   +G LL A D+ +I LWD+              +F GHT  V DV+W     ++F S + D  + IWD R+ N S+ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R +++WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   +I S + DNI+Q+W+  E+V
Sbjct:   11 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFD-----YTKHPSKPE-----PSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENV 411          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0083052)

HSP 1 Score: 296.975 bits (759), Expect = 3.097e-95
Identity = 162/416 (38.94%), Postives = 243/416 (58.41%), Query Frame = 2
Query:  107 YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSEDDL-------DPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIAT-TSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +      S  RL+LG+ T  +++H+L+A V LPSED         +    FG F S  GKIE++ +I H   + RAR+MPQ + +IAT T ++ + ++D     Y     + E     P    +P  +L G       LSWN   +G LL A D+ +I LWD+              +F GHT  V DV+W     ++F S + D  + IWD R+ N S+ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R +++WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   +I S + DNI+Q+W+  E+V
Sbjct:   12 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFD-----YTKHPSKPE-----PSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENV 412          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0335269)

HSP 1 Score: 97.0561 bits (240), Expect = 3.153e-21
Identity = 79/313 (25.24%), Postives = 135/313 (43.13%), Query Frame = 2
Query:  377 TFKSGLGKIELQKRIIHHNAIT---RARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVH-GHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDI----DVLHERERLQNATVGD--PPELLFVHGGHSAAITDFSWHPDVRNVIGSTAN 1285
            T +  L K ++   ++ H       RAR +       + +    +NI+D       +  E A+       +  +P+F   G       + W+ +  G L      + I +W  +  G   +++       GH+ +V D+ W     +V  S S D TI IWD R+  +     +    H+  V  I+ +    F+ AS  DDG + +WD+R    K     A    +++ ++ + WSP  + +LA  G    I LWD+    D+    +  QN  V +  PP+LLF+H G    I +  WHP +  V+ STA+
Sbjct:  142 TDREELKKPQMTCALVKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAV--ENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDG---TWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWNRNEPFI-ASGGDDGYLHIWDLRQFQSK--KPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQK-EIKELHWHPQLPGVLLSTAH 445          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0086043)

HSP 1 Score: 97.0561 bits (240), Expect = 3.153e-21
Identity = 79/313 (25.24%), Postives = 135/313 (43.13%), Query Frame = 2
Query:  377 TFKSGLGKIELQKRIIHHNAIT---RARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVH-GHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDI----DVLHERERLQNATVGD--PPELLFVHGGHSAAITDFSWHPDVRNVIGSTAN 1285
            T +  L K ++   ++ H       RAR +       + +    +NI+D       +  E A+       +  +P+F   G       + W+ +  G L      + I +W  +  G   +++       GH+ +V D+ W     +V  S S D TI IWD R+  +     +    H+  V  I+ +    F+ AS  DDG + +WD+R    K     A    +++ ++ + WSP  + +LA  G    I LWD+    D+    +  QN  V +  PP+LLF+H G    I +  WHP +  V+ STA+
Sbjct:  142 TDREELKKPQMTCALVKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAV--ENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVWTPVEDG---TWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWNRNEPFI-ASGGDDGYLHIWDLRQFQSK--KPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQK-EIKELHWHPQLPGVLLSTAH 445          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: Wdr24 (gene:FBgn0027518 transcript:FBtr0330297)

HSP 1 Score: 63.5438 bits (153), Expect = 3.429e-10
Identity = 60/219 (27.40%), Postives = 102/219 (46.58%), Query Frame = 2
Query:  632 LSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQN-----ATVGD---PPELLFVHGGHSAAITDFSWHP-DVR 1261
            ++W+  +S  L  A  N  + +WDL   G     Q    +++ H  T   V++ S+ P + +S S D TI  +DIRS    ++ ++   +   V  +  SP +Q +F++ S++GTV LWD+R     +   +A+       +    W P   N LA     + I +W++D    R  L++     A VG     PE  + H    A + D+S H  D+R
Sbjct:   71 VAWSTLDSNLLATAATNGVVSVWDLSKFG----RQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIKCFDIRS---DKSINTYFCNSESVRDVKFSPHTQNIFSAVSENGTVQLWDMRKWDKCMVQFTAHYGP----VYTCDWHP-TRNWLATGSRDKQIKVWNMD---GRPGLEHTIHTIAVVGRVKWRPERTY-HIASCALVVDYSVHVWDIR 273          

HSP 2 Score: 54.6842 bits (130), Expect = 1.799e-7
Identity = 39/180 (21.67%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  770 TVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIR-NLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            +  DV+W +    +  +++T+  + +WD+    R +     + H+    ++        +  S S DGT+  +DIR + S+  +        NSES+ ++++SPH  N+ +    +  + LWD+               D   + F    H   +    WHP  RN + + + D  I++W
Sbjct:   67 SANDVAWSTLDSNLLATAATNGVVSVWDLSKFGRQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIKCFDIRSDKSINTYF------CNSESVRDVKFSPHTQNIFSAVSENGTVQLWDMRKW------------DKCMVQFT--AHYGPVYTCDWHP-TRNWLATGSRDKQIKVW 225          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 301.212 bits (770), Expect = 8.063e-97
Identity = 168/422 (39.81%), Postives = 239/422 (56.64%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      V  RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 301.212 bits (770), Expect = 8.063e-97
Identity = 168/422 (39.81%), Postives = 239/422 (56.64%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      V  RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 297.745 bits (761), Expect = 1.982e-95
Identity = 168/421 (39.90%), Postives = 239/421 (56.77%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      V  RL+LG+ T  +++H+++A V +P++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 407          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:321726])

HSP 1 Score: 295.434 bits (755), Expect = 1.681e-94
Identity = 166/422 (39.34%), Postives = 238/422 (56.40%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SGCLL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: grwd1 (glutamate-rich WD repeat containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9844])

HSP 1 Score: 103.99 bits (258), Expect = 1.887e-23
Identity = 82/289 (28.37%), Postives = 129/289 (44.64%), Query Frame = 2
Query:  425 HHNAITRARHMPQKSQIIAT--TSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGD-PPELLFVHGGHSAAITDFSWHPDVRNVIGSTA 1282
            H+  I R R   +  Q +A   +    + I+D   +   + +  A       +    PLF   G  S    + W+    G ++     K+I +W+    G   +++     F  H+ +V D+ W  T  TVF S S D +I IWDIR+   S  S +   H   V  I+ +    F+  S  DDG + +WD+R         S  Q  +S  +++++WSP  S++ A SGA   I  WD+ V       Q   V   PP+LLF+H G    + +  WHP +  V+ STA
Sbjct:  160 HYGGINRVRVTQRGEQTLAAVWSEKGQVEIFDLRLQLEAVHNSTAMSAFIKQEKEATPLFSFAGHMSEGFAIDWSPKVPGRMVSGDCKKNIHVWEPQEGG---TWKIDQRPFSSHSKSVEDLQWSPTEATVFASCSVDQSIRIWDIRAPPNSMLSAN-EAHSSDVNVISWNRTEPFIL-SGGDDGLLKVWDLRQFQSGRPVASFKQ--HSAPVTSVQWSPVDSSVFAASGADDVISQWDLSVESCDMGGQAEDVKQLPPQLLFLHQGQK-EVKELHWHPQIPGVLISTA 440          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 291.582 bits (745), Expect = 8.036e-93
Identity = 165/419 (39.38%), Postives = 236/419 (56.32%), Query Frame = 2
Query:   95 LNKEYVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            L   + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:   10 LRSAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 414          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 292.352 bits (747), Expect = 9.235e-93
Identity = 165/420 (39.29%), Postives = 236/420 (56.19%), Query Frame = 2
Query:   92 MLNKEYVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M    + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:   33 MCAAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 438          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 290.426 bits (742), Expect = 1.814e-92
Identity = 163/417 (39.09%), Postives = 233/417 (55.88%), Query Frame = 2
Query:   92 MLNKEYVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPI 1315
            M    + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  +++    + +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+ +
Sbjct:    1 MCAAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHK----DEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMV 403          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 285.034 bits (728), Expect = 2.288e-90
Identity = 162/421 (38.48%), Postives = 234/421 (55.58%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M NKE + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R          L+LG+ T  +++H+++A V +P++D        D +   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+QIW+  E++
Sbjct:    1 MANKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATK---------TPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPKEGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENI 407          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 281.952 bits (720), Expect = 6.173e-89
Identity = 158/415 (38.07%), Postives = 230/415 (55.42%), Query Frame = 2
Query:  107 YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R          L+LG+ T  +++H+++A V +P++D        D +   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+QIW+  E++
Sbjct:   23 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATK---------TPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPKEGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENI 423          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp4 (retinoblastoma binding protein 4, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194912])

HSP 1 Score: 292.352 bits (747), Expect = 2.852e-93
Identity = 166/422 (39.34%), Postives = 238/422 (56.40%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 284.263 bits (726), Expect = 3.090e-90
Identity = 159/421 (37.77%), Postives = 234/421 (55.58%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +          L+LG+ T  +++H+++A V++P++D        D D   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SH V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLH+  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+QIW+  E++
Sbjct:    1 MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATK---------TPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENI 407          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 278.87 bits (712), Expect = 3.667e-88
Identity = 156/414 (37.68%), Postives = 230/414 (55.56%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +          L+LG+ T  +++H+++A V++P+ DD   D        G GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SH V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLH+  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+QIW+  E++
Sbjct:    1 MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPN-DDAQFDASHCDSDKG-GKIECEIKINHEGEVNRARYMPQNPHIIATK---------TPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENI 398          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 235.343 bits (599), Expect = 8.550e-72
Identity = 137/380 (36.05%), Postives = 202/380 (53.16%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELL 1201
            M +KE + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +          L+LG+ T  +++H+++A V++P++D        D D   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+              +F GH+  V DV+W     ++F S + D  + IWD RS   S+ SH V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLH+  ++++     +  + WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELL
Sbjct:    1 MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATK---------TPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD----EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELL 366          

HSP 2 Score: 56.225 bits (134), Expect = 5.842e-8
Identity = 46/190 (24.21%), Postives = 78/190 (41.05%), Query Frame = 2
Query:  752 FHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRS----RASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIR-NLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
              GH      +SW S L    LS+S D T+ +WDI +  +      A     GH   V  +A     + +F S +DD  + +WD R N + K   L    +A++  ++ + ++P+   +LA   A + + LWD+  L  +              L     H   I    W P    ++ S+  D  + +W
Sbjct:  172 LRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLV---DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLK--------------LHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVW 344          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 130.183 bits (326), Expect = 3.493e-34
Identity = 77/209 (36.84%), Postives = 109/209 (52.15%), Query Frame = 2
Query:  107 YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDL 706
            + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +          L+LG+ T  +++H+++A V++P++D        D D   FG F S  GKIE + +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+
Sbjct:   35 FEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATK---------TPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDI 234          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q7ZTY4|RBBP7_DANRE (Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 8.728e-95
Identity = 167/422 (39.57%), Postives = 237/422 (56.16%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      V  RL+LG+ T  +++H+++A   +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T        D         P     P  +L G       LSWN   SG LL A D+ +I LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASAQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLAFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q24572|CAF1_DROME (Probable histone-binding protein Caf1 OS=Drosophila melanogaster OX=7227 GN=Caf1 PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 3.104e-94
Identity = 162/416 (38.94%), Postives = 243/416 (58.41%), Query Frame = 2
Query:  107 YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSEDDL-------DPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIAT-TSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +      S  RL+LG+ T  +++H+L+A V LPSED         +    FG F S  GKIE++ +I H   + RAR+MPQ + +IAT T ++ + ++D     Y     + E     P    +P  +L G       LSWN   +G LL A D+ +I LWD+              +F GHT  V DV+W     ++F S + D  + IWD R+ N S+ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R +++WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   +I S + DNI+Q+W+  E+V
Sbjct:   12 FDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFD-----YTKHPSKPE-----PSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENV 412          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q6INH0|RBP4B_XENLA (Histone-binding protein RBBP4-B OS=Xenopus laevis OX=8355 GN=rbbp4-b PE=1 SV=3)

HSP 1 Score: 295.434 bits (755), Expect = 1.113e-93
Identity = 167/422 (39.57%), Postives = 241/422 (57.11%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT + +C  +         + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSCDVL---------VFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q5M7K4|RBBP4_XENTR (Histone-binding protein RBBP4 OS=Xenopus tropicalis OX=8364 GN=rbbp4 PE=2 SV=3)

HSP 1 Score: 292.352 bits (747), Expect = 1.831e-92
Identity = 167/422 (39.57%), Postives = 239/422 (56.64%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q60972|RBBP4_MOUSE (Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5)

HSP 1 Score: 292.352 bits (747), Expect = 1.995e-92
Identity = 166/422 (39.34%), Postives = 238/422 (56.40%), Query Frame = 2
Query:   92 MLNKE--YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE  + D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T +    + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: Q4T8N4 (Chromosome undetermined SCAF7762, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=RBBP7 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.824e-94
Identity = 171/420 (40.71%), Postives = 241/420 (57.38%), Query Frame = 2
Query:   92 MLNKEYVDES-EERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR-NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSE----DDLDPDTP---FGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M  KE  DE  E+RI+N++YK WKKN  FLYD+VMT+AL WPS T +WLP  IR  G     RL+LG+ T  +++H+++A V +P+E    D+L  D+    FG F S  GKIE++ +I H   + RAR+MPQ S IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ASH V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P    VI S + DNI+Q+W+  E++
Sbjct:    1 MAEKEVYDEGVEDRIINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDIIRIGGDYALHRLVLGTHTSDEQNHLVIARVQIPNENAECDNLHFDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNSCIIATK---------TPTSDVLVFDYTKHPPKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTVCLWDIGGGPKEGKVLDAKSIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHCVDAHSAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPVEPWVICSVSEDNIMQVWQMAENI 406          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: A0A4Z2BFI1 (WD_REPEATS_REGION domain-containing protein OS=Takifugu bimaculatus OX=433685 GN=fugu_002806 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 2.166e-94
Identity = 170/420 (40.48%), Postives = 242/420 (57.62%), Query Frame = 2
Query:   92 MLNKEYVDES-EERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR-NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSE----DDLDPDTP---FGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M  KE  DE  E+R++N++YK WKKN  FLYD+VMT+AL WPS T +WLP  IR  G     RL+LG+ T  +++H+++A V +P+E    D+L  D+    FG F S  GKIE++ +I H   + RAR+MPQ S IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ ++ LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ASH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P    VI S + DNI+Q+W+  E++
Sbjct:    1 MAEKEVYDEVVEDRVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDIIRIGGDYALHRLVLGTHTSDEQNHLVIARVQIPNENAEFDNLHFDSEKGEFGGFGSVSGKIEIELKINHEGEVNRARYMPQNSCIIATK---------TPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTVCLWDIGGGPKEGKLLDAKSIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHAVDAHSAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPVEPWVICSVSEDNIMQVWQMAENI 406          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: A0A3B5A152 (Retinoblastoma binding protein 4, like OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 6.217e-94
Identity = 167/422 (39.57%), Postives = 239/422 (56.64%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWNL  SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ASHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   +I S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGECSPDLRLKGHQKEGYGLSWNLNRSGNLLSASDDHTICLWDIGAGPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: A0A1I8A1B0 (WD_REPEATS_REGION domain-containing protein OS=Steinernema glaseri OX=37863 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.312e-93
Identity = 160/439 (36.45%), Postives = 252/439 (57.40%), Query Frame = 2
Query:  110 VDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRN--GTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTS-NNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAE 1393
             +++EER++N++YK WKKN  FLYDMVMT+AL WPS T +WLP   RN        RL+LG+ T  +++H+++A + LP++D        D++    FG F S  GKI+++ ++ H   + RAR+MPQ   ++AT S ++ + I+D        T          P +F  P  +L G +     LSWN   +G LL A D+ ++ LWD+     + +      +F GH   V DV+W     +VF S   DC + IWD R+ + ++ +H V  H   V  ++ +PFS+F+ A+ S D TV LWD+RNL +KLHS  +++    + +  ++WSPH   +LA SG  R +++WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   V+ S + DNI+QIW+  +++            N+   +PT AE
Sbjct:    2 AEDNEERLINEEYKIWKKNTPFLYDMVMTHALEWPSLTVQWLPDVQRNEGADYTTHRLILGTHTSDEQNHLVIAKLLLPNDDTQFDASKYDVEKGNEFGGFGSIAGKIDVEIKMNHEGEVNRARYMPQNPTLLATKSPSSEVYIFDYTKHPSNPT----------PGSFL-PQLRLRGHTKEGYGLSWNANNAGHLLSASDDMTVCLWDVQAATTNSNMLDAKTIFQGHKAVVEDVAWHVLHDSVFGSVGDDCKLMIWDTRNGSNTKPAHVVDAHTAEVNCLSFNPFSEFILATGSADKTVALWDLRNLKLKLHSFESHK----DEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNIMQIWQMADNIY-----------NEEDGDPTAAE 413          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: F1QT75 (Retinoblastoma-binding protein 4,-like OS=Danio rerio OX=7955 GN=rbb4l PE=1 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.804e-93
Identity = 168/422 (39.81%), Postives = 239/422 (56.64%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      V  RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:103023991])

HSP 1 Score: 298.516 bits (763), Expect = 8.252e-96
Identity = 165/422 (39.10%), Postives = 238/422 (56.40%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N ++ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGECSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGSPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTAKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:103039809])

HSP 1 Score: 293.123 bits (749), Expect = 1.048e-93
Identity = 163/410 (39.76%), Postives = 233/410 (56.83%), Query Frame = 2
Query:  122 EERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SGCLL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:   13 EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:103032799])

HSP 1 Score: 102.064 bits (253), Expect = 7.237e-23
Identity = 81/294 (27.55%), Postives = 133/294 (45.24%), Query Frame = 2
Query:  419 IIHHNAITRARHMPQKSQIIAT--TSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDV----LHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTA 1282
            + H+  I R R   +  Q +A   +    + I+D   +   + +          +    PLF  +G  +    + W+    G L+     K+I +W+    GVS  +Q     F  HT +V D+ W  T  TVF S S D +I +WDIR+   S  S +   H   V  I+ +    F+  S  DDG + +WD+R    K     A+   +S  ++++ W+P  S++ A +GA   +  WD+ V    + ER    N     PP+LLF+H G +  + +  WHP +   + STA
Sbjct:  160 VPHYGGINRVRVTRRGEQSLAAVWSEKGQVEIFDLRPQLEAVYNSSVMAAFIKQNKEITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPREGGVS--WQIDQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVN-EAHSSDVNVISWNRTEPFLL-SGGDDGLLKVWDLRQF--KSGRAVASFKQHSAPVTSVEWNPVDSSVFAAAGADDVVSQWDLSVESCDMGERA---NDVKDLPPQLLFLHQGQT-EVKELHWHPQLPGTLISTA 443          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: pex7 (peroxisomal biogenesis factor 7 [Source:NCBI gene;Acc:103024267])

HSP 1 Score: 55.0694 bits (131), Expect = 7.235e-8
Identity = 51/226 (22.57%), Postives = 97/226 (42.92%), Query Frame = 2
Query:  632 LSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTL-PTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            ++W+ +    L+  G + S+ +WD      + + +    +   HT  V  V W  T    + +S S D T  +WD     R ++  ++ GH+  + S   SP     FAS+S DGT+ +WD+++ S ++        A+   + +  W  +  N+L       ++ +WD+            TV  P   +     H+ AI    + P  + V+ S + D  ++ W
Sbjct:   65 VTWSESNEHVLVTGGGDGSLQIWD------TANPKGPIQVLKEHTQEVYSVDWSQTRGENLVVSGSWDHTAKVWD---PERFQSVCTLQGHEGVLYSTIWSPHISSCFASASGDGTLRVWDVKSGSCRM-----AIPAHKTEILSCDWCKYDQNILVTGSVDCSLCVWDL-----------RTVRQPVAQML---SHTYAIRRVKFSPFYKTVLASCSYDFTVRFW 262          

HSP 2 Score: 50.0618 bits (118), Expect = 2.724e-6
Identity = 41/179 (22.91%), Postives = 74/179 (41.34%), Query Frame = 2
Query:  572 PDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLA-CS 1105
            P+ F + +  L G   V     W+   S C   A  + ++ +WD+          S       H   +    W      + ++ S DC++ +WD+R+  +  A   +  H   +  +  SPF + V AS S D TV  WD     + L ++      +SE +  + ++ H+ N +  CS
Sbjct:  134 PERF-QSVCTLQGHEGVLYSTIWSPHISSCFASASGDGTLRVWDVKS-------GSCRMAIPAHKTEILSCDWCKYDQNILVTGSVDCSLCVWDLRTVRQPVAQ--MLSHTYAIRRVKFSPFYKTVLASCSYDFTVRFWDYSRSPMLLDAM----EHHSEFVCGLDFNLHIPNQVVDCS 298          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: wdr24 (WD repeat domain 24 [Source:NCBI gene;Acc:103027339])

HSP 1 Score: 55.4546 bits (132), Expect = 1.031e-7
Identity = 40/179 (22.35%), Postives = 75/179 (41.90%), Query Frame = 2
Query:  770 TVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            +  DV W      +  +++T+  +  W++    R++  H    HK  V  +   P    +  S S DG +  +D+R    K  S+S   +  SES+ ++++S       A S  +  + LWDI      ER+  A              H+  +    WHP+ R  + +   D ++++W
Sbjct:   70 SCADVMWHQMEENLLATAATNGAVVTWNLARPCRNKQEHLFTEHKRTVNKVCFHPTEVHMLLSGSQDGFMKCFDLR----KKESVSTF-SGQSESVRDVQFSMKDYFTFAASFENGNVQLWDIRRPDRYERMFTA--------------HTGPVFCCDWHPEDRGWLATGGRDKMVKVW 229          

HSP 2 Score: 52.373 bits (124), Expect = 9.290e-7
Identity = 51/225 (22.67%), Postives = 85/225 (37.78%), Query Frame = 2
Query:  638 WNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTAN--DNIIQIW 1306
            W+  E   L  A  N ++  W+L              LF  H  TV  V +  T   + LS S D  +  +D+R +    +  +  G    V  +  S    F FA+S ++G V LWDIR         +A+    +  +    W P     LA  G  + + +WD+     +E     T+              A++    W P+ R  + + +   D+ I +W
Sbjct:   76 WHQMEENLLATAATNGAVVTWNL----ARPCRNKQEHLFTEHKRTVNKVCFHPTEVHMLLSGSQDGFMKCFDLRKKE---SVSTFSGQSESVRDVQFSMKDYFTFAASFENGNVQLWDIRRPDRYERMFTAH----TGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTNRAKEIYCVQTI--------------ASVARVKWRPERRWHLATCSMMVDHNIYVW 275          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008002.1 (pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene:ENSPMAG00000007189.1 transcript:ENSPMAT00000008002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 291.582 bits (745), Expect = 7.849e-94
Identity = 167/423 (39.48%), Postives = 242/423 (57.21%), Query Frame = 2
Query:   92 MLNKEYV--DESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIAT-TSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE    D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S   KIE++ +I H   + RAR+MPQ   IIAT T  + + ++D   +   + D   E           P  +L G       LSWN   SG LL A D+ ++ LWD+ G            +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++   G PPELLFVHGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:    1 MADKEVAMDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVGTKIEVEIKINHEGEVNRARYMPQNPYIIATKTPTSEVLVFDY-TKHPSVPDPSGE---------CNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTVCLWDISGTPREGKVVEAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQAAEDVEDG-PPELLFVHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 71.2478 bits (173), Expect = 1.023e-13
Identity = 63/227 (27.75%), Postives = 107/227 (47.14%), Query Frame = 2
Query:  662 LLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW-----KPIESVV 1327
            L  AG +++I +W++  +G  D+Y  + G    HTG + D+ + +   T+F +SSTD T+G+WD  +  R +    + GH   V +   +     +  ++SDDGTV LWD R     +HS        S + ++       S+ +   G    I +WD+         QN       +L++   GH+ ++T  S  PD   ++ S A DN ++IW      P+E  V
Sbjct:   72 LASAGFDRTILMWNV--YGDCDNYAHLKG----HTGAILDIHYSTDGSTIF-TSSTDKTVGLWDSETGERIK---RLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKG-SVHSFQNTYQCLSVTFND------TSDQILSGGIDNVIKVWDLR--------QN-------KLIYTMKGHNDSVTGLSLSPDGSYLL-SNAMDNSVRIWDIRPFAPMERCV 265          

HSP 2 Score: 57.3806 bits (137), Expect = 3.536e-9
Identity = 51/216 (23.61%), Postives = 99/216 (45.83%), Query Frame = 2
Query:  671 AGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLS-----VKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQI 1303
            A D+ ++ LWD    G   S+Q+    +   + T  D S         LS   D  I +WD+R   +++  +++ GH   VT ++ SP   ++ +++ D+ +V +WDIR  +     VK+     N +   +++    WS H  + ++   A R +Y+WD                    +L+   GH+ ++ D ++HP+   ++ S AND  + +
Sbjct:  161 ASDDGTVKLWDTRKKGSVHSFQNT---YQCLSVTFNDTS------DQILSGGIDNVIKVWDLR---QNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDN-SVRIWDIRPFAPMERCVKI--FQGNVHNFEKNLLKCSWS-HDGSKVSAGSADRFVYIWDTT---------------SRRILYKLPGHAGSVNDVAFHPE-EPIVLSCANDKRLYL 344          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 61.2326 bits (147), Expect = 1.608e-10
Identity = 41/157 (26.11%), Postives = 72/157 (45.86%), Query Frame = 2
Query:  674 GDNKSI-GLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDID 1141
            G+N  + G WD        ++ S    + GH G V    W   +P+ F S+S D T+ +WD++S + +R    +  H+  V S     + Q +  S++ D  +  WD+RN+   + SL      +S ++  +R SP    +LA      ++  WD  
Sbjct:  124 GENLVVSGSWDHTARVWDPAFLSSLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAARI--VIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLRNIRQPVFSLL----GHSYAIRRVRCSPFQPTVLASCSYDFSVRFWDFQ 274          

HSP 2 Score: 50.447 bits (119), Expect = 4.764e-7
Identity = 35/140 (25.00%), Postives = 56/140 (40.00%), Query Frame = 2
Query:  578 TFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIR 997
             F   L +  G   V     W+     C   A  ++++ +WD+       S  +   +   H   V    W      + +S++ DC I  WD+R  N  +   S+ GH   +  +  SPF   V AS S D +V  WD +
Sbjct:  143 AFLSSLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDV------KSPHAARIVIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLR--NIRQPVFSLLGHSYAIRRVRCSPFQPTVLASCSYDFSVRFWDFQ 274          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: pwp1 (PWP1 homolog, endonuclein [Source:ZFIN;Acc:ZDB-GENE-040426-1049])

HSP 1 Score: 52.373 bits (124), Expect = 9.924e-8
Identity = 46/169 (27.22%), Postives = 76/169 (44.97%), Query Frame = 2
Query:  632 LSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDI 1138
            LSWN      L  A  + ++ LWDL+   V+ + +        HT     V W        +S S D ++ ++D RS +    SH +      V  +  + FS F F +S+DDG V   D R+    + +L A++    E+++ +  S  V   L  S A + + +WDI
Sbjct:   68 LSWNHNARNVLASASADHTVILWDLVQGKVATTLEQ-------HTDKAQTVEWHPFEAQTLISGSYDKSVVLYDCRSPSD---SHRMWRFSGEVERVTWNHFSPFHFLASTDDGFVYCLDARS-DKSVFTLQAHE----EAVTGLVLSSQVKGCLVTSSADKHVKVWDI 221          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: sec31b (SEC31 homolog B, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-060418-2])

HSP 1 Score: 49.2914 bits (116), Expect = 2.132e-6
Identity = 35/139 (25.18%), Postives = 63/139 (45.32%), Query Frame = 2
Query:  899 HKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDN---IIQIW 1306
            H  PV ++  +PF   + AS ++D  + +WD+ N    +   S +Q A  E +  + W+  V ++LA +  S    +WD+     R+      V D    +   G         +WHPDV   +  ++ D+   +IQ+W
Sbjct:  119 HTGPVRALDFNPFQANLLASGANDSEIYIWDLNNFGTPMTPGSKSQPA--EDVVCVAWNRQVQHILASASPSGKAVVWDL-----RKNEPIIKVSDHSNRMRCSG--------MAWHPDVATQLVVSSEDDRMPVIQMW 242          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: HAT2 (Subunit of the Hat1p-Hat2p histone acetyltransferase complex; required for high affinity binding of the complex to free histone H4, thereby enhancing Hat1p activity; similar to human RbAp46 and 48; has a role in telomeric silencing [Source:SGD;Acc:S000000782])

HSP 1 Score: 164.466 bits (415), Expect = 4.935e-46
Identity = 116/411 (28.22%), Postives = 207/411 (50.36%), Query Frame = 2
Query:  116 ESEERIL--NDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGS-TTDSDRSHVLLADVYLPSE--DDLDPDTPFGT-FKSGL----GKIELQKRIIHHNAITRARHMPQKSQIIATTSNN-CINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWK 1309
            E++E+ L  +++Y  WK NV  +YD V    L WPS T +WLP+ ++  +G  +K  L++G+ T+  + +++  A++ LP E   + DP    G  ++S L      I +  +  H   ITRAR+MPQ   I+AT +    + +Y   +RS G+               T    K NG++     LS++    G LL   D+ ++ LW++   G  D  + V      H+  + D  W +    +F + S D  + I D+R+ N +  +        P  ++A S  S  + A++  D  V L+D+RN+   LH +S +++A    ++N+ +S HV  ++  SG+   + +WD+  +   +   +A  G  PEL+ VH GH +++ DF  +P +  ++ S   +NI+Q+WK
Sbjct:    2 ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY---SRSEGLQS-------------TLKFHKDNGYA-----LSFSTLVKGRLLSGSDDHTVALWEVGSGG--DPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC---PQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA----VNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: MSI1 (Subunit of chromatin assembly factor I (CAF-1); chromatin assembly by CAF-1 affects multiple processes including silencing at telomeres, mating type loci, and rDNA; maintenance of kinetochore structure; deactivation of DNA damage checkpoint after DNA repair; chromatin dynamics during transcription; and repression of divergent noncoding transcription; Msi1p localizes to nucleus and cytoplasm and independently regulates the RAS/cAMP pathway via sequestration of Npr1p kinase [Source:SGD;Acc:S000000399])

HSP 1 Score: 117.472 bits (293), Expect = 4.350e-29
Identity = 112/432 (25.93%), Postives = 187/432 (43.29%), Query Frame = 2
Query:  134 LNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSH---------VLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHHNAI-------TRARHMPQKSQIIA-TTSNNCINIYD-TENRSYGITDEEAEEFATIPDTFTKPLFKLNG-FSSVNGI------------LSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGT-VTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRA-IYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVA 1330
            L + Y +WKKN   LYD + T +  WPS T ++ P    + T  + R+LL S T S +             L  +   S ++ D D     FK         K +++  +I        RAR++PQ   IIA  +S+  I I+D T++ S  I        + I   F   LF  +G    V  +            L+WNL +   LL +  N  + +WD+  +   +    +  +     GT V DV+W  T  ++F + +    + + D+R++ + +   +   H   V S   +  +  + AS+  +G + LWDIRN++     ++  ++  S  +S + WSP+   +LA +G     + LWD                   E +F HGGH   + D SW      ++ S ANDN + IWKP  ++V 
Sbjct:   19 LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDL--DTTSDEHRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDE--MEFKPENSTRFPSKHLVNDISIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQ------SKISHPFETKLFGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTK-KEKLQSNREKHDGGVNSCRFNYKNSLILASADSNGRLNLWDIRNMNKS--PIATMEHGTS--VSTLEWSPNFDTVLATAGQEDGLVKLWDTSC---------------EETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNLVG 420          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: RRB1 (Specific chaperone for ribosomal protein Rpl3p; binds to nascent Rpl3p during translation; essential gene [Source:SGD;Acc:S000004738])

HSP 1 Score: 79.337 bits (194), Expect = 3.555e-16
Identity = 96/423 (22.70%), Postives = 168/423 (39.72%), Query Frame = 2
Query:  176 LYDMVMTYALHWPSFTFEWLPSTI----RNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENR----SYGITDEE--------------------AEEFAT----IPDTFTKPLFKLNGFSSVNGI-LSWN-LTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLS---VKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGD------PPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPI 1315
            +Y+M+    + WP  T + +P T+    RN       +LL + T S R            E++L            L    L K ++  +          +  +     N  I + DT NR     + I+++E                    ++ F+T    IP +  +P+  +    +V G  L W+ L ++G LL +GD    G         S            +  ++ D+ W  T  TVF ++  D  I IWD RS+ + + + SV      V  I+ S    ++ AS  D+GT G+WD+R  +          A  + +  ++++I ++P   +++A       + LWD+ V  + E ++            PP+LLFVH      + D  WH  +   + ST  D  + +WK I
Sbjct:  117 VYEMLHNVNMPWPCLTLDVIPDTLGSERRN---YPQSILLTTATQSSRKK----------ENEL----------MVLALSNLAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALL-SGD--CSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSK-KHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQLLFVHW--QKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTI 509          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: SEC31 (Component of the Sec13p-Sec31p complex of the COPII vesicle coat; COPII coat is required for vesicle formation in ER to Golgi transport; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000002354])

HSP 1 Score: 50.8322 bits (120), Expect = 4.154e-7
Identity = 60/254 (23.62%), Postives = 108/254 (42.52%), Query Frame = 2
Query:  587 KPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGL--FHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHS--VHGHKM----PVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLH-SLSANQNANSESMSNIRWSPHVSNMLACSGAS---RAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKP 1312
            KP+  L   S  N  L W+   +  + GA DN S+ L+       +++  ++N +  F  H+ +V  V + +    V  S   +  I IWD+     S ++++    G  M     V S+A +     VFAS+       +WD++     +H S ++  +   + +S + W P  S  +A +  S    +I +WD         L+NA       L  ++ GH   I    W     +++ S+  DN + +W P
Sbjct:   54 KPIASLQVDSKFND-LDWS-HNNKIIAGALDNGSLELY-----STNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWD---------LRNANT----PLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNP 287          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: WTM1 (Transcriptional modulator; involved in regulation of meiosis, silencing, and expression of RNR genes; required for nuclear localization of the ribonucleotide reductase small subunit Rnr2p and Rnr4p; contains WD repeats [Source:SGD;Acc:S000005756])

HSP 1 Score: 49.6766 bits (117), Expect = 6.685e-7
Identity = 46/201 (22.89%), Postives = 80/201 (39.80%), Query Frame = 2
Query:  809 VFLSSSTDCTIGIWDIRSRNRS--RASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQN--------------ANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPE----------LLFVHGGHS-------AAITDFSWHPDVRNVIGSTANDNIIQIWKP 1312
            +F S S D  +  WD R+ ++         +G    +TS   S  S  +F +    G + LWD R        L+  QN              A  +S+ ++++S   S+     G +  IY W+ D    +    +     PP+          L F+H G S             +WHP + N++G+  +D+++ I+KP
Sbjct:  236 IFASCSDDNILRFWDTRTSDKPIWVLGEPKNGK---LTSFDCSQVSNNLFVTGFSTGIIKLWDARAAEAATTDLTYRQNGEDPIQNEIANFYHAGGDSVVDVQFSATSSSEFFTVGGTGNIYHWNTDYSLSKYNPDDTIA--PPQDATEESQTKSLRFLHKGGSRRSPKQIGRRNTAAWHPVIENLVGTVDDDSLVSIYKP 431          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO42058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K4])

HSP 1 Score: 281.567 bits (719), Expect = 6.832e-90
Identity = 156/409 (38.14%), Postives = 239/409 (58.44%), Query Frame = 2
Query:  131 ILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGL--FHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            ++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   +      S  RL+LG+ T  +++HV++A V LP+++        D D   FG F S  GKI+++ +I H   + RAR MPQ   IIAT          T +    + D         P+    P  +L G +     LSWN   +G LL A D+ +I LWD+   G+S   ++V+ +  F GH+  V DVSW     ++F S + D  + IWD R  N ++A+H+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  +++    + +  ++WSPH   +LA SG  R +++WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   V+ S + DNI+Q+W+  E++
Sbjct:    1 MINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTKPEGKDYSVHRLILGTHTSDEQNHVVIASVQLPNDEAQFDASHYDNDKGEFGGFASVSGKIDIEIKINHEGEVNRARFMPQNPCIIATK---------TPSADVLVFDYTKHPSKPDPNGECSPDLRLKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDI-SSGISKEQKTVDAMRIFTGHSAVVEDVSWHLLHESLFGSVADDHKLMIWDTRQTNSNKAAHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHK----DEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMAENI 394          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO34980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS9])

HSP 1 Score: 103.605 bits (257), Expect = 5.860e-24
Identity = 81/291 (27.84%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  425 HHNAITRARH--MPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNAT---VGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTA 1282
            H+  + R RH  +P +  + + +    ++I+D E +   I   +    ++ P   + PLF  +G +S    + W+    G LL      ++ LW+    G   S+      F+ HT +V DV W      VF S S D TI IWD R+        S + H   V  I+ +    F+  S  DDG + +WD+R L  +   ++  +++    ++++ W P   ++ A S A   I LWD+ V  ER+         +  PP+LLF+H G    I +  WHP +  V+ STA
Sbjct:  127 HNGGVNRIRHGHIPNRHIVASWSERGSVHIWDVEAQ---IIASDNPGSSSQPRE-SSPLFTFSGHASEGFAMDWSRNTHGRLLTGDCKHNVHLWNPQEGG---SWHVDQRPFNAHTDSVEDVQWSPNENNVFASCSVDKTIRIWDARAMPSKACMISTNAHDADVNVISWNRNEPFI-VSGGDDGILKVWDLRQLQKQGQPVALFKHSTG-PITSVEWHPTDGSVFAASSADNQITLWDLAV--ERDEAAEGPGRHLDVPPQLLFIHMGQK-DIKELHWHPQLPGVLISTA 405          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO45890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV3])

HSP 1 Score: 72.7886 bits (177), Expect = 9.888e-14
Identity = 46/169 (27.22%), Postives = 78/169 (46.15%), Query Frame = 2
Query:  632 LSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDI 1138
            + W+  E   L  A  N ++ +W+L  + ++   Q +  +F+ H  TV  + +     T+ LS S D T+  +DIR ++      S HG    +  I  SPF    FA++ D+G V LWD+R      H   A+       +  + W P   N +A  G  + + +WD+
Sbjct:   61 VQWHPVEDHILATAAGNGAVVIWNL--NKITKQKQEL--VFYEHKRTVNRIKFHPQDTTLLLSGSQDGTMNCFDIRKQS---VLFSAHGKSESIRDIEFSPFDGKQFATACDNGNVQLWDMRRTDTYYHQFMAHNGP----VFTLDWHPEDRNWIATGGRDKCVKVWDV 218          

HSP 2 Score: 61.2326 bits (147), Expect = 4.974e-10
Identity = 41/182 (22.53%), Postives = 75/182 (41.21%), Query Frame = 2
Query:  770 TVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDI---DVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            ++TDV W      +  +++ +  + IW++    + +     + HK  V  I   P    +  S S DGT+  +DIR  SV   +     +  SES+ +I +SP      A +  +  + LWD+   D  + +                    H+  +    WHP+ RN I +   D  +++W
Sbjct:   57 SITDVQWHPVEDHILATAAGNGAVVIWNLNKITKQKQELVFYEHKRTVNRIKFHPQDTTLLLSGSQDGTMNCFDIRKQSVLFSA-----HGKSESIRDIEFSPFDGKQFATACDNGNVQLWDMRRTDTYYHQ-----------------FMAHNGPVFTLDWHPEDRNWIATGGRDKCVKVW 216          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO38818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBS0])

HSP 1 Score: 61.6178 bits (148), Expect = 2.116e-10
Identity = 45/162 (27.78%), Postives = 70/162 (43.21%), Query Frame = 2
Query:  650 ESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWD 1135
            E   +L A  + +I LWD L   +         +F GH   V    W   +P  F S+S D  IGIWD+    R +    +  H+  V +   + + Q +  S S D  +  WD+RN +  + S  A+  A    +  ++ SPH  N++A       I  WD
Sbjct:  116 EQDFVLSASWDHTIRLWDPLRTEIP-----TVAMFTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDMACPGRPQ--QLIRAHEGEVLTCDWAKYDQHLVVSGSVDTLIKGWDVRNTNAPVFSFKAHPYA----VRRLKCSPHQGNIIASCSYDFTIKTWD 266          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO48733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIL3])

HSP 1 Score: 60.077 bits (144), Expect = 7.310e-10
Identity = 47/191 (24.61%), Postives = 82/191 (42.93%), Query Frame = 2
Query:  851 DIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPE---LLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWK-PIESVVASICGAATGPSNQSVSNPTVAEPELLHQ 1411
            D   + R     S++G  +PVT++   PF      S++ DGT+  WD+ N S   H  S ++  N   +S + +S H   + A +G  R + ++D D +  +     +   +P     ++   GGH   +    +HP   NV  +   D  ++IW   ++ V+ SI G         +    V     LHQ
Sbjct:   60 DTGKKRRPLKHGSLYG--LPVTTVKFFPFKDDRLMSTTSDGTITCWDLDNWS---HMKSVDEPHN--EISTLDFS-HDGKIFATAGKDRKVRVYDSDTMQIKLTFAGSEATEPARDVSMIVPEGGHGKKVFGLRFHPFDDNVFLTGGWDRCLKIWDVRVDHVIRSIHGPYICGDGIDICQDEVMTSSWLHQ 242          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 297.745 bits (761), Expect = 4.821e-95
Identity = 166/422 (39.34%), Postives = 237/422 (56.16%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ASHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P    +I S + DNI+Q+W+  E++
Sbjct:   38 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIGAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQMAENI 445          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:101155071])

HSP 1 Score: 293.123 bits (749), Expect = 1.008e-93
Identity = 163/410 (39.76%), Postives = 233/410 (56.83%), Query Frame = 2
Query:  122 EERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIRNGTVVKS--RLLLGSTTDSDRSHVLLADVYLPSED------DLDPDT-PFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESV 1324
            EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R      S  RL+LG+ T  +++H+++A V LP++D        D +   FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SGCLL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ SH+V  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELLF+HGGH+A I+DFSW+P+   VI S + DNI+Q+W+  E++
Sbjct:   13 EERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENI 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 285.419 bits (729), Expect = 4.348e-90
Identity = 167/454 (36.78%), Postives = 239/454 (52.64%), Query Frame = 2
Query:   92 MLNKE-YVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED--------DLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELL--------------------------FVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICG 1342
            M +KE Y D  EER++N++YK WKKN  FLYD+VMT+AL WPS T +WLP   R         RL+LG+ T  +++H+++A V +P++D        D +    FG F S  GKIE++ +I H   + RAR+MPQ   IIAT          T      + D         P     P  +L G       LSWN   SG LL A D+ +I LWD+              +F GHT  V DVSW     ++F S + D  + IWD RS N S+ASHSV  H   V  ++ +P+S+F+ A+ S D TV LWD+RNL +KLHS  ++++     +  ++WSPH   +LA SG  R + +WD+  + E +  ++A  G PPELL                          F+HGGH+A I+DFSW+P    +I S + DNI+Q+W+ + +  A+  G
Sbjct:   38 MADKEVYDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATK---------TPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIGAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKD----EIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDG-PPELLVGPLASRLVGGLLKVLMWSFPVVLHQFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQMVSAAAAAFTG 477          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:101163517])

HSP 1 Score: 108.997 bits (271), Expect = 3.187e-25
Identity = 87/291 (29.90%), Postives = 129/291 (44.33%), Query Frame = 2
Query:  425 HHNAITRAR--HMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRAS-HSVHGHKMPVTSIAGS-PFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGD-PPELLFVHGGHSAAITDFSWHPDVRNVIGSTA 1282
            H+  + R R     Q+S     +    + I+D   +   +    A           KPLF  +G  S    + W+    G L+     K+I +W+    G   ++Q     F  H+ +V D+ W  T  TVF S S D +I +WDIR+   S  S    H   + V S   S PF      S  DDG + +WD+R    K     AN   +S  ++++ WSP  S++ A SGA   I  WD+ V       +   + D PP+LLF+H G S  I +  WHP +  V+ STA
Sbjct:  154 HYGGVNRVRVTQCGQQSLAAVWSEKGQVEIFDLRPQLEAVHSSAAMSAFLQQQKEAKPLFSFSGHMSEGFAIDWSPKAPGRLVSGDCKKNIHVWEPREGG--SAWQIDQRPFSSHSKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVDGAHASDINVISWNRSEPF----LLSGGDDGLLKVWDLRQF--KTGRAVANFKQHSAPITSVEWSPADSSVFAASGADDVISQWDLSVESSDVGARVEGLKDLPPQLLFLHQGQS-EIKEIHWHPQIPGVMISTA 435          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 59.6918 bits (143), Expect = 2.715e-9
Identity = 54/215 (25.12%), Postives = 101/215 (46.98%), Query Frame = 2
Query:  662 LLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIW 1306
            L  +G ++ I LW++ G    ++Y ++ G    H+G V ++ + +T  ++  S+STD T+GIWD  +  R +    + GH   V +   +     +  + SDDGT+ LWDIR     +H+        + + ++       S+ +   G    I +WD+         QN       +L++   GHS ++T  S   +   ++ S + DN ++IW
Sbjct:   71 LASSGFDRLIFLWNVFGE--CENYATLKG----HSGAVMELHY-NTDGSLLFSASTDKTVGIWDSETGERIK---RLKGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRK-KAAIHTFQNTYQVLAVTFND------TSDQILSGGIDNDIKVWDLR--------QN-------KLIYNMHGHSDSVTGLSLSSEGSYLL-SNSMDNTVRIW 252          

HSP 2 Score: 53.9138 bits (128), Expect = 2.219e-7
Identity = 62/290 (21.38%), Postives = 114/290 (39.31%), Query Frame = 2
Query:  548 EAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSR--------------------------------------NRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVK---LHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNI 1294
            E E +AT           L G S     L +N T+   L  A  +K++G+WD      S++ + +  L  GHT  V         P +  + S D TI +WDIR +                                       +++  +++HGH   VT ++ S    ++ ++S D+ TV +WD+R  + K   +     N +   +++    WS   S + A S A R +Y+WD                    +L+   GH+ ++ +  +HP+   V+  +++  +
Sbjct:   88 ECENYAT-----------LKGHSGAVMELHYN-TDGSLLFSASTDKTVGIWD------SETGERIKRL-KGHTSFVNTCYPARRGPQLVCTGSDDGTIKLWDIRKKAAIHTFQNTYQVLAVTFNDTSDQILSGGIDNDIKVWDLRQNKLIYNMHGHSDSVTGLSLSSEGSYLLSNSMDN-TVRIWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSTDGSKIAAGS-ADRFVYIWDT---------------TSRRILYKLPGHAGSVNEVVFHPEEPVVLSGSSDKRL 341          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000043499.1 (SMESG000043499.1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 400/409 (97.80%), Postives = 403/409 (98.53%), Query Frame = 2
Query:  185 MVMTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELLHQ 1411
            MVMTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIH+NAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGT+GLWDIRNLSVKLHSLS    ANSESMSNIRWSPHVSN+LACS ASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELL Q
Sbjct:    1 MVMTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHNNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTIGLWDIRNLSVKLHSLS----ANSESMSNIRWSPHVSNILACSEASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELLRQ 405          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000043499.1 (SMESG000043499.1)

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 398/407 (97.79%), Postives = 401/407 (98.53%), Query Frame = 2
Query:  191 MTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELLHQ 1411
            MTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIH+NAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGT+GLWDIRNLSVKLHSLS    ANSESMSNIRWSPHVSN+LACS ASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELL Q
Sbjct:    1 MTYALHWPSFTFEWLPSTIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSGLGKIELQKRIIHNNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTIGLWDIRNLSVKLHSLS----ANSESMSNIRWSPHVSNILACSEASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELLRQ 403          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000062893.1 (SMESG000062893.1)

HSP 1 Score: 245.358 bits (625), Expect = 1.871e-75
Identity = 152/406 (37.44%), Postives = 219/406 (53.94%), Query Frame = 2
Query:  128 RILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSED-DLDP---DTP---FGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDLLGHGVSDSYQS-VNGL--FHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWK 1309
            RI+N+DYK WK++  FLYD +M + L WPS T +WLP+  R  +      RL+LG+ T  +++H+L+A + +P++  + D    DT    +G F    GK+E+   I H   + RAR+MPQ    +AT +       D    +Y I    A  F        KP  +L G       LSWN  ++G +L A D+K+I +WD    G S S    +N L  F GH   V DV+W      VF S + D  + IWDIRS N S+    V  H   V  IA +PF+Q +  + S D TV +WD+RNL +KLHS  A+Q    + +  ++WSPH   + A SG  R +++WD   +   E+ +   V  PPELLF+H GH+A I+DFSW+      I S A DNI+Q+W+
Sbjct:   19 RIINEDYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTA----DVLIFNYAI--HPARPFGME----VKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQ----DEIFQVQWSPHNETIFASSGTDRRLHIWDCSKI-GLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQ 409          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 204.142 bits (518), Expect = 5.117e-60
Identity = 125/405 (30.86%), Postives = 210/405 (51.85%), Query Frame = 2
Query:  143 DYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSE--------DDLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDL-LGHGVSDSYQSVNGL--FHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIE 1318
            DY  WKKN  FLYD+VMT+ L WPS T +W+P   R  +      R+++G+  + ++ ++L+A V +P+E         D + D  FG +       ++  +I H   I RAR++PQ   +IAT S+N  N+Y  +   +    +++ +         KP   L G S     LSWN+  +G LL +  + +I LWD+       + ++ +N L  + GH G+V DV W      +F S   D  + IWD   R  S+ +  V  H   V ++  +PFS+++ A+ S+D T+GLWD+RN+   L  L  ++     S+  ++WS H   +LA  G+   ++LWD+     ++   +       EL F+H GH + + DF+W+ +   ++ S + DNI+Q+W+P E
Sbjct:   15 DYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDE-FGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNG-NVYLFDYTRHPSKPDQSGK--------CKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWD---RRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEG----SIGQLQWSLHKETILASGGSDNKVHLWDL-----KKTGTSKEKNYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 397          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 187.963 bits (476), Expect = 3.271e-54
Identity = 122/405 (30.12%), Postives = 202/405 (49.88%), Query Frame = 2
Query:  143 DYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPSTIR--NGTVVKSRLLLGSTTDSDRSHVLLADVYLPSE--------DDLDPDTPFGTFKSGLGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGITDEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSIGLWDL-LGHGVSDSYQSVNGL--FHGHTGTVTDVSWWSTLPTVFLSSSTDCTIGIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWDIRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDIDVLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDNIIQIWKPIE 1318
            DY  WKKN  FLYD+VMT+ L WPS T +W+P   R  +      R+++G+  + ++ ++L+A V +P+E         D + D  FG +       ++  +I H   I RAR++PQ   +IAT S+N  N+Y  +   +    +++ +         KP   L G S     LSWN+  +G LL +  + +I LWD+       + ++ +N L  + GH G+V DV W      +F S   D  + IWD R  N                     PFS+++ A+ S+D T+GLWD+RN+   L  L  ++     S+  ++WS H   +LA  G+   ++LWD+     ++   +       EL F+H GH + + DF+W+ +   ++ S + DNI+Q+W+P E
Sbjct:   15 DYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDE-FGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNG-NVYLFDYTRHPSKPDQSGK--------CKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWD-RHFN---------------------PFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEG----SIGQLQWSLHKETILASGGSDNKVHLWDL-----KKTGTSKEKNYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 378          
The following BLAST results are available for this feature:
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBBP41.162e-9339.43RB binding protein 4, chromatin remodeling factor ... [more]
RBBP44.154e-9339.34RB binding protein 4, chromatin remodeling factor ... [more]
RBBP41.456e-9239.57RB binding protein 4, chromatin remodeling factor ... [more]
RBBP75.172e-9037.77RB binding protein 7, chromatin remodeling factor ... [more]
RBBP78.265e-8937.47RB binding protein 7, chromatin remodeling factor ... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-536.196e-8936.63Probable histone-binding protein lin-53 [Source:U... [more]
rba-11.355e-5230.00Probable histone-binding protein rba-1 [Source:Un... [more]
Y54H5A.11.953e-1625.48pep chromosome:WBcel235:III:5153543:5155465:1 gene... [more]
Y54H5A.11.953e-1625.48pep chromosome:WBcel235:III:5153464:5155465:1 gene... [more]
Y54H5A.11.953e-1625.48pep chromosome:WBcel235:III:5153406:5155436:1 gene... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Caf1-552.848e-9538.94gene:FBgn0263979 transcript:FBtr0301845[more]
Caf1-553.097e-9538.94gene:FBgn0263979 transcript:FBtr0083052[more]
l(2)098513.153e-2125.24gene:FBgn0022288 transcript:FBtr0335269[more]
l(2)098513.153e-2125.24gene:FBgn0022288 transcript:FBtr0086043[more]
Wdr243.429e-1027.40gene:FBgn0027518 transcript:FBtr0330297[more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbb4l8.063e-9739.81retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l8.063e-9739.81retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l1.982e-9539.90retinoblastoma binding protein 4, like [Source:NCB... [more]
rbbp41.681e-9439.34retinoblastoma binding protein 4 [Source:NCBI gene... [more]
grwd11.887e-2328.37glutamate-rich WD repeat containing 1 [Source:ZFIN... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp48.036e-9339.38retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp49.235e-9339.29retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp41.814e-9239.09retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp72.288e-9038.48retinoblastoma binding protein 7 [Source:NCBI gene... [more]
rbbp76.173e-8938.07retinoblastoma binding protein 7 [Source:NCBI gene... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbbp42.852e-9339.34retinoblastoma binding protein 4, chromatin remode... [more]
Rbbp73.090e-9037.77retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp73.667e-8837.68retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp78.550e-7236.05retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp73.493e-3436.84retinoblastoma binding protein 7, chromatin remode... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZTY4|RBBP7_DANRE8.728e-9539.57Histone-binding protein RBBP7 OS=Danio rerio OX=79... [more]
sp|Q24572|CAF1_DROME3.104e-9438.94Probable histone-binding protein Caf1 OS=Drosophil... [more]
sp|Q6INH0|RBP4B_XENLA1.113e-9339.57Histone-binding protein RBBP4-B OS=Xenopus laevis ... [more]
sp|Q5M7K4|RBBP4_XENTR1.831e-9239.57Histone-binding protein RBBP4 OS=Xenopus tropicali... [more]
sp|Q60972|RBBP4_MOUSE1.995e-9239.34Histone-binding protein RBBP4 OS=Mus musculus OX=1... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q4T8N41.824e-9440.71Chromosome undetermined SCAF7762, whole genome sho... [more]
A0A4Z2BFI12.166e-9440.48WD_REPEATS_REGION domain-containing protein OS=Tak... [more]
A0A3B5A1526.217e-9439.57Retinoblastoma binding protein 4, like OS=Stegaste... [more]
A0A1I8A1B01.312e-9336.45WD_REPEATS_REGION domain-containing protein OS=Ste... [more]
F1QT751.804e-9339.81Retinoblastoma-binding protein 4,-like OS=Danio re... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbb4l8.252e-9639.10histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbbp41.048e-9339.76RB binding protein 4, chromatin remodeling factor ... [more]
grwd17.237e-2327.55glutamate rich WD repeat containing 1 [Source:NCBI... [more]
pex77.235e-822.57peroxisomal biogenesis factor 7 [Source:NCBI gene;... [more]
wdr241.031e-722.35WD repeat domain 24 [Source:NCBI gene;Acc:10302733... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008002.17.849e-9439.48pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene... [more]
snrnp401.023e-1327.75small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
pex71.608e-1026.11peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
pwp19.924e-827.22PWP1 homolog, endonuclein [Source:ZFIN;Acc:ZDB-GEN... [more]
sec31b2.132e-625.18SEC31 homolog B, COPII coat complex component [Sou... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HAT24.935e-4628.22Subunit of the Hat1p-Hat2p histone acetyltransfera... [more]
MSI14.350e-2925.93Subunit of chromatin assembly factor I (CAF-1); ch... [more]
RRB13.555e-1622.70Specific chaperone for ribosomal protein Rpl3p; bi... [more]
SEC314.154e-723.62Component of the Sec13p-Sec31p complex of the COPI... [more]
WTM16.685e-722.89Transcriptional modulator; involved in regulation ... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420586.832e-9038.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349805.860e-2427.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458909.888e-1427.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388182.116e-1027.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487337.310e-1024.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbb4l4.821e-9539.34histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbbp41.008e-9339.76RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l4.348e-9036.78histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
grwd13.187e-2529.90glutamate rich WD repeat containing 1 [Source:NCBI... [more]
snrnp402.715e-925.12small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043499.10.000e+097.80SMESG000043499.1[more]
SMESG000043499.10.000e+097.79SMESG000043499.1[more]
SMESG000062893.11.871e-7537.44SMESG000062893.1[more]
SMESG000007931.15.117e-6030.86SMESG000007931.1[more]
SMESG000007931.13.271e-5430.12SMESG000007931.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027816 ID=SMED30027816|Name=Histone-binding protein RBBP4|organism=Schmidtea mediterranea sexual|type=transcript|length=1611bp
ATTCCATATTTGTAAATAAGTTATTAGTAAAGACTTCATCGTTTCATCAA
AATAAATCACAAAAATTATTTGTTTTAATATTTAAATAAAAATGTTGAAC
AAAGAGTATGTAGATGAATCAGAAGAACGAATTTTAAATGATGATTACAA
AAATTGGAAAAAAAATGTTTCTTTTTTGTATGATATGGTAATGACTTACG
CTTTGCATTGGCCTAGCTTTACTTTTGAGTGGCTCCCCAGTACTATAAGA
AACGGAACAGTAGTTAAATCTCGTTTATTACTCGGTTCAACCACTGATTC
TGATAGAAGTCATGTGTTACTTGCGGATGTGTATTTGCCAAGTGAAGATG
ATTTAGATCCTGACACGCCATTTGGGACATTTAAATCCGGACTAGGAAAA
ATTGAATTGCAAAAGCGAATTATTCATCACAATGCTATTACTAGGGCTCG
GCATATGCCACAGAAATCACAGATTATTGCCACTACATCCAATAATTGTA
TCAATATTTATGATACTGAAAACAGGTCGTATGGAATTACCGATGAAGAA
GCTGAAGAATTTGCAACTATACCAGACACATTTACTAAACCGTTATTCAA
ATTAAATGGATTTTCGTCAGTTAATGGAATTTTGTCATGGAACCTCACTG
AATCCGGGTGTTTATTGGGGGCTGGAGATAATAAATCTATCGGATTGTGG
GATTTACTGGGACACGGAGTATCGGATAGTTATCAAAGTGTAAATGGATT
GTTTCACGGTCACACTGGAACTGTAACCGATGTATCCTGGTGGTCAACGC
TACCGACGGTATTTCTATCATCTTCAACCGACTGTACTATCGGGATCTGG
GATATCCGTAGCCGCAATCGATCACGAGCCAGTCATTCCGTCCACGGTCA
CAAAATGCCCGTCACATCGATCGCCGGATCTCCGTTCTCTCAATTCGTGT
TTGCCTCATCTAGTGACGACGGCACTGTCGGTTTGTGGGACATCAGAAAT
CTATCAGTGAAATTGCATTCATTATCCGCCAATCAGAACGCCAACAGTGA
GTCAATGTCAAATATCCGTTGGTCGCCGCATGTGTCTAATATGCTGGCGT
GCAGTGGGGCATCGCGGGCAATTTATCTCTGGGATATCGATGTCCTACAT
GAACGGGAACGGCTGCAGAATGCCACAGTTGGGGACCCGCCGGAACTCCT
GTTCGTGCACGGCGGCCATTCCGCAGCTATCACCGATTTCAGCTGGCATC
CCGATGTGAGAAATGTCATCGGCAGTACAGCCAATGATAACATCATTCAG
ATCTGGAAACCGATTGAAAGCGTTGTTGCATCGATTTGCGGTGCCGCAAC
CGGTCCATCCAATCAGTCAGTCAGCAATCCAACTGTAGCTGAACCTGAGC
TGCTGCACCAATGATTTGTTAAGGAATTCTTATTGGTTGACCAATGAGAA
AGCGAGGATGATTTATATTTAAATAAATTGATTTTGTATTCTTGACTGGT
TTATTATATTTTTTAATTATATACAAACGAAGGCTACTAACAGTAAGACT
AATCTTGCGTGTATATTGATATTTCCAGGACCGCTGCACAATACCCCCGT
CGTTCCCGTAG
back to top

protein sequence of SMED30027816-orf-1

>SMED30027816-orf-1 ID=SMED30027816-orf-1|Name=SMED30027816-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=441bp
MLNKEYVDESEERILNDDYKNWKKNVSFLYDMVMTYALHWPSFTFEWLPS
TIRNGTVVKSRLLLGSTTDSDRSHVLLADVYLPSEDDLDPDTPFGTFKSG
LGKIELQKRIIHHNAITRARHMPQKSQIIATTSNNCINIYDTENRSYGIT
DEEAEEFATIPDTFTKPLFKLNGFSSVNGILSWNLTESGCLLGAGDNKSI
GLWDLLGHGVSDSYQSVNGLFHGHTGTVTDVSWWSTLPTVFLSSSTDCTI
GIWDIRSRNRSRASHSVHGHKMPVTSIAGSPFSQFVFASSSDDGTVGLWD
IRNLSVKLHSLSANQNANSESMSNIRWSPHVSNMLACSGASRAIYLWDID
VLHERERLQNATVGDPPELLFVHGGHSAAITDFSWHPDVRNVIGSTANDN
IIQIWKPIESVVASICGAATGPSNQSVSNPTVAEPELLHQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR022052Histone-bd_RBBP4_N
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0035098ESC/E(Z) complex
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0016569covalent chromatin modification
GO:0031101fin regeneration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 287..301
score: 39.37
coord: 241..255
score: 35.69
coord: 191..205
score: 26.76
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 362..402
e-value: 2.2E-4
score: 30.6
coord: 304..344
e-value: 1.3
score: 16.2
coord: 214..254
e-value: 4.8E-4
score: 29.4
coord: 164..204
e-value: 51.0
score: 6.2
coord: 103..141
e-value: 11.0
score: 10.5
coord: 260..300
e-value: 1.5E-5
score: 34.4
IPR001680WD40 repeatPFAMPF00400WD40coord: 366..402
e-value: 0.014
score: 16.2
coord: 264..300
e-value: 5.7E-6
score: 27.0
coord: 221..254
e-value: 0.037
score: 14.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 267..303
score: 11.478
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 369..402
score: 10.408
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 221..263
score: 12.28
IPR022052Histone-binding protein RBBP4, N-terminalPFAMPF12265CAF1C_H4-bdcoord: 17..83
e-value: 6.7E-18
score: 64.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3..411
e-value: 4.7E-93
score: 314.5
NoneNo IPR availablePANTHERPTHR22850WD40 REPEAT FAMILYcoord: 9..407
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 221..411
score: 26.103
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 105..402