SMED30027788

Overview
NameSMED30027788
Smed IDSMED30027788
Length (bp)1820
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027788 (SMED30027788) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027788 (SMED30027788) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027788 (SMED30027788) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027788 (SMED30027788) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30027788 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.012235:12948..14772 +9019
v31.013561:8316..10135 -8969
Homology
BLAST of SMED30027788 vs. Ensembl Celegans
Match: pap-1 (Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9U2P3])

HSP 1 Score: 53.9138 bits (128), Expect = 2.962e-7
Identity = 75/300 (25.00%), Postives = 123/300 (41.00%), Query Frame = 1
Query:  214 RKIFEWMKGFLKDIELNSE--NMYFYLFPVGS--ITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQE---TLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQ----QKSSNVIGYLYAFFRHYAELNWSTQTI--NIGNEK-FIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFI 1071
            R + EW+K        N E  N    LF  GS  +  H S  D   D +  +P  I  +  + S    LN + N   +  +    +PV++L  S    D L   L  +     + + D     +NLL  +D +S+ +LN  R    + + L  L    +E   TL  +K WA    IY  S   F  G + AI++A     CQ       S ++  ++  F  +    W    +   + N++  I  + E+V       T +  ++ I+TPA P+QN   N+ + +   I +   EA  I
Sbjct:   62 RLVKEWVKNVTAMKIPNGEGVNAGGKLFTFGSYRLGVHSSGAD--IDTLAVVPRHIDRSDFFTSFKEMLNNDPNVTELHGVEEAFVPVMKLKYSGVELDILFARLALKEVPDTQELSD-----DNLLRNLDQESVRSLNGCR----VAEQLLKLVPRQKEFCVTLRAIKLWAKNHGIYSNSMG-FFGGITWAILVA---RACQLYPNASPSRLVHRMFFIFSTWT---WPHPVVLNEMNNDRNDIPTLCELVWDPRRKNTDRFHVMPIITPAFPEQNSTHNVTRSTATVIKNEICEALEI 343          
BLAST of SMED30027788 vs. Ensembl Celegans
Match: pap-1 (Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9U2P3])

HSP 1 Score: 53.9138 bits (128), Expect = 2.962e-7
Identity = 75/300 (25.00%), Postives = 123/300 (41.00%), Query Frame = 1
Query:  214 RKIFEWMKGFLKDIELNSE--NMYFYLFPVGS--ITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQE---TLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQ----QKSSNVIGYLYAFFRHYAELNWSTQTI--NIGNEK-FIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFI 1071
            R + EW+K        N E  N    LF  GS  +  H S  D   D +  +P  I  +  + S    LN + N   +  +    +PV++L  S    D L   L  +     + + D     +NLL  +D +S+ +LN  R    + + L  L    +E   TL  +K WA    IY  S   F  G + AI++A     CQ       S ++  ++  F  +    W    +   + N++  I  + E+V       T +  ++ I+TPA P+QN   N+ + +   I +   EA  I
Sbjct:   62 RLVKEWVKNVTAMKIPNGEGVNAGGKLFTFGSYRLGVHSSGAD--IDTLAVVPRHIDRSDFFTSFKEMLNNDPNVTELHGVEEAFVPVMKLKYSGVELDILFARLALKEVPDTQELSD-----DNLLRNLDQESVRSLNGCR----VAEQLLKLVPRQKEFCVTLRAIKLWAKNHGIYSNSMG-FFGGITWAILVA---RACQLYPNASPSRLVHRMFFIFSTWT---WPHPVVLNEMNNDRNDIPTLCELVWDPRRKNTDRFHVMPIITPAFPEQNSTHNVTRSTATVIKNEICEALEI 343          
BLAST of SMED30027788 vs. Ensembl Celegans
Match: T15H9.6 (pep chromosome:WBcel235:II:9607533:9609396:-1 gene:WBGene00011791.1 transcript:T15H9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15H9.6)

HSP 1 Score: 50.447 bits (119), Expect = 3.451e-6
Identity = 72/285 (25.26%), Postives = 117/285 (41.05%), Query Frame = 1
Query:  271 NMYFYLFPVGS--ITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQE---TLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQ----QKSSNVIGYLYAFFRHYAELNWSTQT----INIGNEKFIDNVREIV---KRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILE 1077
            N    L P GS  +  H S  D   D ++  P  I  +  + S    L KN     +  +    +P++ L  S    D L   L  +       I D     ++LL+ +D +S+ +LN  R    + + L  L    +    TL  +K WA    IY  S   F  G + AI++A I   CQ       S +I  ++  F  +   NW        IN  +   +  + ++V   +RN     H   ++ I+TPA PQQN   N+++ S+  I    ++A  I +
Sbjct:   85 NAGGKLIPFGSYRLGVHSSGAD--IDSIVVAPRHITRSDFFNSFKDILAKNPEVTELCAVEKAFVPIMTLKYSGVDIDILFARLALKSVPEDLNILD-----DSLLKNLDEESVRSLNGCR----VAEQLLKLVPHQKNFCITLRAIKLWAKNHGIYSNSMG-FFGGITWAILVARI---CQLYPNAAPSRLIQKVFFIFSTW---NWPAPVLLDYINC-DRTDLAQLNQLVWDPRRNHADRYH---LMPIITPAFPQQNSTHNVSRSSMKVIQDEMKKALIICD 347          
BLAST of SMED30027788 vs. UniProt/SwissProt
Match: sp|Q51D88|PAP_ENTHI (Poly(A) polymerase OS=Entamoeba histolytica OX=5759 GN=16.t00038 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.493e-11
Identity = 86/338 (25.44%), Postives = 142/338 (42.01%), Query Frame = 1
Query:  157 QEEYFPLN---ENGTAALSYTVRKIFEWMK-------GFLKDIELNSENMYFYLFPVGSITYHKSYPDNPKDFVLCL--PGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLG----DLFSIYQETL-FHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIG-NEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILEN------NDWKFL 1098
            + + +P+    E    A+S     I +W K       G   D ++ +  +Y Y    GS  Y  +   N  D   C+     I  +  Y+ L   L  N + + +  + S+  P L +   N  FD  L F  + Y  S     D+ N  EN+L+ MD     A+N +RN+ +I  ++     + F +   T+    KK  I+  +Y      FLNG S+ I++A +  +  Q  +  +  L  FF+ Y+  +W    + +G N+ F D  +E              ++ ILTPA P +N A +I K SL+ I    +    I+        NDW  L
Sbjct:   11 KNDMYPMGDQVEKKRKAISKMTEYIQQWGKKIYIESAGVADDTDVKAATIYVY----GS--YRLNVYGNNSDIDACIVSNSTITRDDFYDGLYAELLNNPDVKELKQIPSKRSPHLSMIYLNIEFD--LNFSRTAYT-SLPDNLDILN--ENILKNMDELDTRAINGVRNTDIIDAFVPNHSEEAFRVMVRTIKLWTKKRGIYGYVYC-----FLNGISIEILVAQVISENYQLDN--VRLLEKFFQVYSSWDWLRTPVMLGTNDDFNDKKKE-------------GVIQILTPASPSENAAFSITKFSLEMIKRELKRGQEIVHEFSSEGVNDWAKL 317          
BLAST of SMED30027788 vs. TrEMBL
Match: A0A1W0WT02 (Poly(A) polymerase gamma OS=Hypsibius dujardini OX=232323 GN=BV898_07700 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.139e-10
Identity = 70/260 (26.92%), Postives = 117/260 (45.00%), Query Frame = 1
Query:  298 GSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRS---IPVLELTISNNSFDFLLCFLPSQ-YCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSS-NVIGYLYAFFRHYAELNWSTQTINIGNEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREA 1062
            GS       PD+  D VL  P  ++    + + V  L+   +F+++ N+       +PV++LT      D     L  Q Y  S++   D     + LL  MD KS  +LN  R    I  Y+ ++  I++ TL  +K+WA  +LIY  S   +L G S AI++A   H C  + S  V G ++ FF  +A  +W         +           +      +++ ++ I+TP  P QN + NI + + + +V  FRE 
Sbjct:  186 GSYGLGVCGPDSDLDVVLVAPCYVRREDFFSTFV--LHLRSHFEMITNVEPVEGAFVPVVKLTCDGVDVDLTFARLDKQLYVPSEEDGEDSLLVDDALL-GMDDKSTRSLNGWRVCRFIVKYVPNV-QIFRLTLMVVKEWAKARLIYSNSYC-YLGGVSWAILVA---HACHNRPSKTVFGQVHNFFTAFAAWDWKEPVCIAPLQLPSCQCFPSAPKFDPVALYEHHLMPIMTPCYPYQNSSFNITRTTFNCVVTAFREG 437          
BLAST of SMED30027788 vs. TrEMBL
Match: K2HQM4 (Poly(A) polymerase, putative OS=Entamoeba nuttalli (strain P19) OX=1076696 GN=ENU1_172570 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.258e-9
Identity = 87/338 (25.74%), Postives = 142/338 (42.01%), Query Frame = 1
Query:  157 QEEYFPLN---ENGTAALSYTVRKIFEWMK-------GFLKDIELNSENMYFYLFPVGSITYHKSYPDNPKDFVLCL--PGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLG----DLFSIYQETL-FHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIG-NEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILEN------NDWKFL 1098
            + + +P+    E    A+S     I +W K       G   D ++ +  +Y Y    GS  Y  +   N  D   C+     I  +  Y+ L   L  N + + +  + S+  P L +   N  FD  L F  + Y  S     D+ N  EN+L+ MD     A+N +RN+ +I  ++     + F +   T+    KK  I+  +Y      FLNG S+ I++A +  +  Q  +  +  L  FF+ Y+  +W    + +G N+ F D  +E              I+ ILTPA P +N A +I K SL+ I    +    I+        NDW  L
Sbjct:   11 KNDMYPMGDQVEKKRKAISKMTEYIQQWGKKIYIESAGVADDTDVKAATIYVY----GS--YRLNVYGNNSDIDACIVSNSTITRDDFYDGLYAELLNNPDVKELKQIPSKRSPHLSMIYLNIEFD--LNFSRTAYT-SLPDNLDILN--ENILKNMDELDTRAINGVRNTDIIDAFVPNHSEEAFRVMVRTIKLWTKKRGIYGYVYC-----FLNGISIEILVAQVISENYQLDN--VRLLEKFFQVYSSWDWLRTPVMLGTNDDFNDKKKE-------------GIIQILTPASPSENAAFSITKFSLEMIKRELKRGQEIVHEFSSEGVNDWAKL 317          
BLAST of SMED30027788 vs. TrEMBL
Match: M7WDW2 (Poly(A) polymerase OS=Entamoeba histolytica HM-3:IMSS OX=885315 GN=KM1_264350 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.425e-9
Identity = 86/338 (25.44%), Postives = 142/338 (42.01%), Query Frame = 1
Query:  157 QEEYFPLN---ENGTAALSYTVRKIFEWMK-------GFLKDIELNSENMYFYLFPVGSITYHKSYPDNPKDFVLCL--PGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLG----DLFSIYQETL-FHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIG-NEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILEN------NDWKFL 1098
            + + +P+    E    A+S     I +W K       G   D ++ +  +Y Y    GS  Y  +   N  D   C+     I  +  Y+ L   L  N + + +  + S+  P L +   N  FD  L F  + Y  S     D+ N  EN+L+ MD     A+N +RN+ +I  ++     + F +   T+    KK  I+  +Y      FLNG S+ I++A +  +  Q  +  +  L  FF+ Y+  +W    + +G N+ F D  +E              ++ ILTPA P +N A +I K SL+ I    +    I+        NDW  L
Sbjct:   11 KNDMYPMGDQVEKKRKAISKMTEYIQQWGKKIYIESAGVADDTDVKAATIYVY----GS--YRLNVYGNNSDIDACIVSNSTITRDDFYDGLYAELLNNPDVKELKQIPSKRSPHLSMIYLNIEFD--LNFSRTAYT-SLPDNLDILN--ENILKNMDELDTRAINGVRNTDIIDAFVPNHSEEAFRVMVRTIKLWTKKRGIYGYVYC-----FLNGISIEILVAQVISENYQLDN--VRLLEKFFQVYSSWDWLRTPVMLGTNDDFNDKKKE-------------GVIQILTPASPSENAAFSITKFSLEMIKRELKRGQEIVHEFSSEGVNDWAKL 317          
BLAST of SMED30027788 vs. TrEMBL
Match: M2SDB9 (Poly(A) polymerase, putative OS=Entamoeba histolytica KU27 OX=885311 GN=EHI5A_207940 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.425e-9
Identity = 86/338 (25.44%), Postives = 142/338 (42.01%), Query Frame = 1
Query:  157 QEEYFPLN---ENGTAALSYTVRKIFEWMK-------GFLKDIELNSENMYFYLFPVGSITYHKSYPDNPKDFVLCL--PGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLG----DLFSIYQETL-FHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIG-NEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILEN------NDWKFL 1098
            + + +P+    E    A+S     I +W K       G   D ++ +  +Y Y    GS  Y  +   N  D   C+     I  +  Y+ L   L  N + + +  + S+  P L +   N  FD  L F  + Y  S     D+ N  EN+L+ MD     A+N +RN+ +I  ++     + F +   T+    KK  I+  +Y      FLNG S+ I++A +  +  Q  +  +  L  FF+ Y+  +W    + +G N+ F D  +E              ++ ILTPA P +N A +I K SL+ I    +    I+        NDW  L
Sbjct:   11 KNDMYPMGDQVEKKRKAISKMTEYIQQWGKKIYIESAGVADDTDVKAATIYVY----GS--YRLNVYGNNSDIDACIVSNSTITRDDFYDGLYAELLNNPDVKELKQIPSKRSPHLSMIYLNIEFD--LNFSRTAYT-SLPDNLDILN--ENILKNMDELDTRAINGVRNTDIIDAFVPNHSEEAFRVMVRTIKLWTKKRGIYGYVYC-----FLNGISIEILVAQVISENYQLDN--VRLLEKFFQVYSSWDWLRTPVMLGTNDDFNDKKKE-------------GVIQILTPASPSENAAFSITKFSLEMIKRELKRGQEIVHEFSSEGVNDWAKL 317          
BLAST of SMED30027788 vs. TrEMBL
Match: A0A175JE12 (Poly polymerase putative OS=Entamoeba histolytica OX=5759 GN=CL6EHI_012040 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.425e-9
Identity = 86/338 (25.44%), Postives = 142/338 (42.01%), Query Frame = 1
Query:  157 QEEYFPLN---ENGTAALSYTVRKIFEWMK-------GFLKDIELNSENMYFYLFPVGSITYHKSYPDNPKDFVLCL--PGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLG----DLFSIYQETL-FHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIG-NEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILEN------NDWKFL 1098
            + + +P+    E    A+S     I +W K       G   D ++ +  +Y Y    GS  Y  +   N  D   C+     I  +  Y+ L   L  N + + +  + S+  P L +   N  FD  L F  + Y  S     D+ N  EN+L+ MD     A+N +RN+ +I  ++     + F +   T+    KK  I+  +Y      FLNG S+ I++A +  +  Q  +  +  L  FF+ Y+  +W    + +G N+ F D  +E              ++ ILTPA P +N A +I K SL+ I    +    I+        NDW  L
Sbjct:   11 KNDMYPMGDQVEKKRKAISKMTEYIQQWGKKIYIESAGVADDTDVKAATIYVY----GS--YRLNVYGNNSDIDACIVSNSTITRDDFYDGLYAELLNNPDVKELKQIPSKRSPHLSMIYLNIEFD--LNFSRTAYT-SLPDNLDILN--ENILKNMDELDTRAINGVRNTDIIDAFVPNHSEEAFRVMVRTIKLWTKKRGIYGYVYC-----FLNGISIEILVAQVISENYQLDN--VRLLEKFFQVYSSWDWLRTPVMLGTNDDFNDKKKE-------------GVIQILTPASPSENAAFSITKFSLEMIKRELKRGQEIVHEFSSEGVNDWAKL 317          
BLAST of SMED30027788 vs. Ensembl Cavefish
Match: papola (poly(A) polymerase alpha [Source:NCBI gene;Acc:103028065])

HSP 1 Score: 50.0618 bits (118), Expect = 6.453e-6
Identity = 58/223 (26.01%), Postives = 102/223 (45.74%), Query Frame = 1
Query:  457 IPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYL-YAFFRHYAELNWSTQTINIGNEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYF----ILENN-DWKFLIDS 1107
            +PV++L+      D L   L  Q         DLR+  + LL+ +D + I +LN  R +  I   + ++ + ++ TL  +K WA    IY  +   FL G S A+++A     CQ   + V   L + FF  +++  W    +    E    N+   V       + +  ++ I+TPA PQQN   N++  + + +V  F++       IL+N  DW  L ++
Sbjct:  155 VPVIKLSFDGIEIDILFARLALQTIPEN---LDLRD--DGLLKNLDIRCIRSLNGCRVTDEILHLVPNIEN-FRLTLRAIKLWAKRHNIY-SNILGFLGGVSWAMLVA---RTCQLYPNAVASTLVHKFFLVFSKWEWPNPVLLKQPEDC--NLNLPVWDPRVTPSDRYHLMPIITPAYPQQNSTYNVSVSTRNIMVEEFKQGLAITDEILQNKADWSKLFEA 365          
BLAST of SMED30027788 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005362.1 (pep scaffold:Pmarinus_7.0:GL481270:231683:246917:-1 gene:ENSPMAG00000004864.1 transcript:ENSPMAT00000005362.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.363e-6
Identity = 63/302 (20.86%), Postives = 116/302 (38.41%), Query Frame = 1
Query:  181 ENGTAALSYTVRKIFEWMKGFLKDIELNS---ENMYFYLFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASI--FHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIGNEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFI 1071
            E   A L      +  W++ F +  +L+    EN+   +   GS        D   D +   P  +     + S    L +      +  +    +P++         D L   L  Q    K    DLRN  +N+L  +D + I +LN  R +  I   + ++   ++  L  +K WA    +Y  +   FL G S ++++A I   + C   S+     L+ FF  +++  W    + +   +F   +   V       T +  ++ I+TP+ PQQN   N+   S   +    R    +
Sbjct:   61 EQRLAVLGKLNHMVNRWVRDFAEAKDLSPSIIENISAKICTFGSFRLGVHNKDADIDALCVAPQHVDRTDFFTSFCELLKETNGVTSIRAVEDAFVPLIRFKFDGIEIDLLFARLNMQSIPKK---LDLRN--DNILRNLDIRCIRSLNGCRVTDEILHLVPNV-ETFRLALHAVKLWAKHHGLY-SNILGFLGGVSWSMLVARICQLYPCATAST----LLHKFFLVFSQWEWPKPVL-LKQPEF-SRLNLPVWDPRVNPTDRCHLMPIITPSYPQQNSTYNVTVSSRAIVTAALRPGLVV 349          
BLAST of SMED30027788 vs. Planmine SMEST
Match: SMESG000015274.1 (SMESG000015274.1)

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 470/474 (99.16%), Postives = 471/474 (99.37%), Query Frame = 1
Query:  121 MNAHSDHVCIVEQEEYFPLNENGTAALSYTVRKIFEWMKGFLKDIELNSENMYFYLFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWSTQTINIGNEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILENNDWKFLIDSYLMNSLTLLDFVHYAKSIKSAELPQIVLLSITEEKSLDNGAVFVEFEELIKLKLKTDCCHETVLHCPLVIRNVIVDSTEXXXXXXXXXXHYVLFNFNSQIQLSKSNIIRIADKDLPFGIKYSVETVQFDDYRIISLNFDSMEKVV 1542
            MNAHSDHVCIVEQEEYFPLNENGTAALSYTVRKIFEWMKGFLKDIELNSEN+YFYLFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSS VIGYLYAFFRHYAELNWSTQTINIGNEKFIDNVREI KRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILENNDWKFLIDSYLMNSLTLLDFVHYA SIKSAELPQIVLLSITEEKSLDNGAVFVEFEELIKLKLKTDCCHETVLHCPLVIRNVIVDSTERRQQRQRRNRHYVLFNFNSQIQLSKSNIIRIADKDLPFGIKYSVETVQFDDYRIISLNFDSMEKVV
Sbjct:    1 MNAHSDHVCIVEQEEYFPLNENGTAALSYTVRKIFEWMKGFLKDIELNSENIYFYLFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQQKSSTVIGYLYAFFRHYAELNWSTQTINIGNEKFIDNVREIAKRNSYFLTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILENNDWKFLIDSYLMNSLTLLDFVHYAISIKSAELPQIVLLSITEEKSLDNGAVFVEFEELIKLKLKTDCCHETVLHCPLVIRNVIVDSTERRQQRQRRNRHYVLFNFNSQIQLSKSNIIRIADKDLPFGIKYSVETVQFDDYRIISLNFDSMEKVV 474          
BLAST of SMED30027788 vs. Planmine SMEST
Match: SMESG000072012.1 (SMESG000072012.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.290e-9
Identity = 69/296 (23.31%), Postives = 131/296 (44.26%), Query Frame = 1
Query:  286 LFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFL-----LCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQ-QKSSNVIGYLYAFFRHYA-ELNWSTQTINIGNEKFIDNVREIVKRNSYF-LTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILENNDWKFLIDSYLMNSLTLLDFVHY 1149
            +F  GS     ++     D +L  P  I   + ++  V FL +N   Q + ++    +PVL++   N   D L     L  +P  +C+S+         S+ LL  MD + + ++N +R +  I   + D   I++  L  ++ WA  + IY  +   F  G S AI++A +   CQ    ++V   +  FF+ Y  +  W +  +    E+   +V  +++ +     + +N ++ ILTP+ P QN   N+ +     +V   ++A+ I++    K      L   L    + HY
Sbjct:   90 IFTFGSYRLGVNFSGADIDALLVGPKFISREEFFDDFVTFLLENPQAQEIHSVPKAFVPVLKMKFCNVEIDLLFASVDLMSIPHDFCLSEN--------SDQLLRNMDERDVRSVNGVRVTDDILRLVYDK-KIFKSALKIIRIWAKRRCIY-SNAMGFCGGVSWAILVARV---CQLWPLASVSTIVINFFKFYGTKWRWPSPVVLKDVEE--SSVLHLMQWDPRINPSDQNHVMPILTPSYPSQNSTYNVCESHKKFMVDQMQKAFRIIQQISLKEKTFQDLFKPLFFFTYRHY 370          
BLAST of SMED30027788 vs. Planmine SMEST
Match: SMESG000072012.1 (SMESG000072012.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.336e-9
Identity = 69/296 (23.31%), Postives = 131/296 (44.26%), Query Frame = 1
Query:  286 LFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNGNFQVVANLSSRSIPVLELTISNNSFDFL-----LCFLPSQYCMSKKPIFDLRNPSENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKLIYFKSTSNFLNGTSLAIMLASIFHKCQ-QKSSNVIGYLYAFFRHYA-ELNWSTQTINIGNEKFIDNVREIVKRNSYF-LTHKNAIVTILTPAMPQQNCARNINKLSLDRIVHYFREAYFILENNDWKFLIDSYLMNSLTLLDFVHY 1149
            +F  GS     ++     D +L  P  I   + ++  V FL +N   Q + ++    +PVL++   N   D L     L  +P  +C+S+         S+ LL  MD + + ++N +R +  I   + D   I++  L  ++ WA  + IY  +   F  G S AI++A +   CQ    ++V   +  FF+ Y  +  W +  +    E+   +V  +++ +     + +N ++ ILTP+ P QN   N+ +     +V   ++A+ I++    K      L   L    + HY
Sbjct:   91 IFTFGSYRLGVNFSGADIDALLVGPKFISREEFFDDFVTFLLENPQAQEIHSVPKAFVPVLKMKFCNVEIDLLFASVDLMSIPHDFCLSEN--------SDQLLRNMDERDVRSVNGVRVTDDILRLVYDK-KIFKSALKIIRIWAKRRCIY-SNAMGFCGGVSWAILVARV---CQLWPLASVSTIVINFFKFYGTKWRWPSPVVLKDVEE--SSVLHLMQWDPRINPSDQNHVMPILTPSYPSQNSTYNVCESHKKFMVDQMQKAFRIIQQISLKEKTFQDLFKPLFFFTYRHY 371          
The following BLAST results are available for this feature:
BLAST of SMED30027788 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pap-12.962e-725.00Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
pap-12.962e-725.00Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
T15H9.63.451e-625.26pep chromosome:WBcel235:II:9607533:9609396:-1 gene... [more]
back to top
BLAST of SMED30027788 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q51D88|PAP_ENTHI1.493e-1125.44Poly(A) polymerase OS=Entamoeba histolytica OX=575... [more]
back to top
BLAST of SMED30027788 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W0WT025.139e-1026.92Poly(A) polymerase gamma OS=Hypsibius dujardini OX... [more]
K2HQM43.258e-925.74Poly(A) polymerase, putative OS=Entamoeba nuttalli... [more]
M7WDW24.425e-925.44Poly(A) polymerase OS=Entamoeba histolytica HM-3:I... [more]
M2SDB94.425e-925.44Poly(A) polymerase, putative OS=Entamoeba histolyt... [more]
A0A175JE124.425e-925.44Poly polymerase putative OS=Entamoeba histolytica ... [more]
back to top
BLAST of SMED30027788 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
papola6.453e-626.01poly(A) polymerase alpha [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30027788 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005362.12.363e-620.86pep scaffold:Pmarinus_7.0:GL481270:231683:246917:-... [more]
back to top
BLAST of SMED30027788 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027788 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000015274.10.000e+099.16SMESG000015274.1[more]
SMESG000072012.11.290e-923.31SMESG000072012.1[more]
SMESG000072012.11.336e-923.31SMESG000072012.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027788 ID=SMED30027788|Name=SMED30027788|organism=Schmidtea mediterranea sexual|type=transcript|length=1820bp
AAATAATTTGAATTAATCACTAAGATTCTTTATAATTTACGCATATTAAT
AATTTTAAACAAAATATTTTACATTTTCATTTATTTTCTATTATTTCTAA
ATCAGATATTTATTCGTGTAATGAATGCACATTCAGATCATGTATGTATA
GTGGAACAAGAAGAATATTTTCCACTTAACGAAAATGGAACTGCTGCCTT
AAGTTATACAGTAAGGAAAATTTTTGAATGGATGAAAGGTTTTTTAAAAG
ATATTGAATTAAACTCAGAAAACATGTATTTTTATTTATTTCCTGTTGGT
TCAATAACATATCACAAATCATATCCTGACAATCCTAAAGATTTTGTACT
ATGCCTTCCAGGTATTATTAAACTTAATAAAGTTTATGAATCACTAGTTC
CTTTTCTAAATAAAAATGGAAATTTCCAAGTTGTAGCAAACTTATCTAGC
AGATCAATTCCTGTATTAGAACTGACAATATCAAACAATTCATTTGATTT
CCTCCTCTGTTTTCTTCCATCTCAATATTGCATGTCTAAAAAACCAATTT
TTGATTTAAGAAATCCATCTGAGAATTTACTCGAACAAATGGATTTTAAG
TCAATTTTAGCGTTAAATAGCCTAAGAAATAGTTTATTAATACGTGATTA
TTTGGGTGATTTATTCTCTATTTATCAAGAAACTCTATTCCATTTAAAGA
AGTGGGCAATATTTAAATTAATATATTTCAAATCGACTTCAAATTTTTTA
AATGGAACATCTTTAGCAATAATGTTAGCAAGCATATTTCATAAATGCCA
ACAGAAATCGTCAAATGTGATTGGATATCTTTATGCTTTCTTTCGGCATT
ACGCTGAATTGAATTGGTCAACTCAAACAATCAATATCGGCAATGAGAAA
TTTATCGATAATGTTCGAGAAATTGTCAAACGGAACTCGTATTTTCTGAC
TCACAAAAATGCGATCGTGACGATATTAACGCCAGCCATGCCTCAACAGA
ATTGTGCTCGAAATATCAACAAATTGAGCCTCGACAGAATTGTCCATTAT
TTTCGCGAAGCGTATTTTATTTTGGAAAATAACGATTGGAAATTTTTAAT
CGATTCCTATTTAATGAATTCGTTGACGTTGTTGGATTTTGTCCATTATG
CCAAATCGATTAAGTCTGCCGAACTGCCACAAATCGTGTTGTTATCGATC
ACCGAAGAGAAATCTCTCGACAACGGTGCCGTATTTGTTGAATTCGAAGA
GTTGATAAAATTGAAGTTGAAAACCGACTGCTGTCATGAAACAGTTCTTC
ATTGTCCATTAGTGATTAGAAATGTGATTGTCGACAGCACTGAACGTCGT
CAACAACGACAACGACGAAATCGGCATTACGTGCTGTTCAATTTCAACTC
TCAAATCCAGCTGTCCAAGTCGAACATTATCAGAATTGCCGATAAAGATT
TACCATTCGGAATCAAATACTCAGTCGAAACGGTCCAGTTTGATGATTAT
CGGATTATTTCTTTGAATTTTGATAGCATGGAAAAAGTTGTCCGTATGAT
TTATACAGATATTTAGAATTGATTTTTACTAAAAAAATATTTTCTCTGCG
TTTATATAAATCGGTGTTGCTGTTCATGAAATTTCTCGATTTTTCTCTTC
TTGCGAAAAATTCATTTTTTGATAAATTTGCAATTTTTATAGTTTTGTTT
AATTGTATTTTTTATTGATTCCGAAAAAAAAAGTTATCTCGCATCTCATT
GGACAAAACACGCGACAAATTTTAATTAAAATTTTACAACATAATTCAAA
CTAGAGCTTTCTATTGAGGG
back to top

protein sequence of SMED30027788-orf-1

>SMED30027788-orf-1 ID=SMED30027788-orf-1|Name=SMED30027788-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=482bp
MNAHSDHVCIVEQEEYFPLNENGTAALSYTVRKIFEWMKGFLKDIELNSE
NMYFYLFPVGSITYHKSYPDNPKDFVLCLPGIIKLNKVYESLVPFLNKNG
NFQVVANLSSRSIPVLELTISNNSFDFLLCFLPSQYCMSKKPIFDLRNPS
ENLLEQMDFKSILALNSLRNSLLIRDYLGDLFSIYQETLFHLKKWAIFKL
IYFKSTSNFLNGTSLAIMLASIFHKCQQKSSNVIGYLYAFFRHYAELNWS
TQTINIGNEKFIDNVREIVKRNSYFLTHKNAIVTILTPAMPQQNCARNIN
KLSLDRIVHYFREAYFILENNDWKFLIDSYLMNSLTLLDFVHYAKSIKSA
ELPQIVLLSITEEKSLDNGAVFVEFEELIKLKLKTDCCHETVLHCPLVIR
NVIVDSTERRQQRQRRNRHYVLFNFNSQIQLSKSNIIRIADKDLPFGIKY
SVETVQFDDYRIISLNFDSMEKVVRMIYTDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR007012PolA_pol_cen_dom
Vocabulary: biological process
TermDefinition
GO:0043631RNA polyadenylation
GO:0031123RNA 3'-end processing
Vocabulary: molecular function
TermDefinition
GO:0004652polynucleotide adenylyltransferase activity
GO:0003723RNA binding
GO:0016779nucleotidyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.1410.10coord: 173..320
e-value: 2.8E-29
score: 103.8
NoneNo IPR availableGENE3DG3DSA:3.30.460.10coord: 36..172
e-value: 2.8E-29
score: 103.8
NoneNo IPR availablePANTHERPTHR10682POLY A POLYMERASEcoord: 37..331
NoneNo IPR availableSUPERFAMILYSSF81631PAP/OAS1 substrate-binding domaincoord: 185..320
IPR007012Poly(A) polymerase, central domainPFAMPF04928PAP_centralcoord: 145..319
e-value: 7.0E-13
score: 48.1