Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30027773
Length (bp)3128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30027773) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30027773) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific serine/threonine protein kinase (SMED30027773) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30027773) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027773

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30027773SMESG000024532.1 dd_Smed_v4_5481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027773SMESG000024532.1 dd_Smed_v4_5481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 93.9745 bits (232), Expect = 6.163e-24
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ NP +R +A QL+   FI
Sbjct:  171 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 306          

HSP 2 Score: 38.891 bits (89), Expect = 6.163e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   53 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK 176          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 93.9745 bits (232), Expect = 6.980e-24
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ NP +R +A QL+   FI
Sbjct:  143 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 278          

HSP 2 Score: 38.5058 bits (88), Expect = 6.980e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   25 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIK 148          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 90.8929 bits (224), Expect = 5.977e-23
Identity = 49/142 (34.51%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S     F+K CL+ +P +R +A QL+   F+
Sbjct:  146 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          

HSP 2 Score: 38.5058 bits (88), Expect = 5.977e-23
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G V+    K + Q +V  K   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   28 EVFDVLEKLGEGSYGSVYKAIHKETGQ-IVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIK 151          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 90.8929 bits (224), Expect = 9.156e-23
Identity = 49/142 (34.51%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S     F+K CL+ +P +R +A QL+   F+
Sbjct:  146 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          

HSP 2 Score: 37.7354 bits (86), Expect = 9.156e-23
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G V+    K + Q +V  K   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   28 EVFDVLEKLGEGSYGSVYKAIHKETGQ-IVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIK 151          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 78.1814 bits (191), Expect = 1.662e-21
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DNI+L   G+ KL DFG       +T E   +  ++   GT  +MAPE++    Y  K+DIWS G++ +EM+ G PP+  + P RA+  +      + +    +S     F+  CL ++  +R SA++L+  QF+
Sbjct:  386 IHRDIKSDNILLGMDGSVKLTDFGFCAQ---ITPE---QSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL 521          

HSP 2 Score: 46.2098 bits (108), Expect = 1.662e-21
Identity = 33/117 (28.21%), Postives = 58/117 (49.57%), Query Frame = 3
Query: 2157 GAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIG----YRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            GA G V+   D  + QE+ +K+   ++    +++ I      R   +  +  Y  S +V D   + + M YL+GGSLT  +  + C+ E +   +  + L  +  LH  Q++HRDIK
Sbjct:  279 GASGTVYTAMDVATGQEVAIKQ-MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTD-VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIK 391          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 88.9669 bits (219), Expect = 1.620e-25
Identity = 44/142 (30.99%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I +DN++L   G  KL D G          +I     +    GT  +M+PEIL +  Y+YK+DIWS G++ +EM+ G PP+ ++ P +AI  + +  + + K    +S E + F+  CL+V+P++R    +L+   F+
Sbjct:  273 VHRDIKSDNVLLGMNGEVKLTDMGF-------CAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL 407          

HSP 2 Score: 47.7506 bits (112), Expect = 1.620e-25
Identity = 39/128 (30.47%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQ-----DKISSQELVLKKSTEMEFSLHR-DIFIGYRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            ++  K+   GA G VF+       D ++ + +  K   + E  L    +   YR  N   L  Y  S +V D D + + M YL GG+LT  + + + + E +   +  + L  +H LHR  IVHRDIK
Sbjct:  156 YEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPN---LVNYIESYLV-DADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIK 278          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 89.3521 bits (220), Expect = 2.202e-25
Identity = 44/142 (30.99%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I +DN++L   G  KL D G          +I     +    GT  +M+PEIL +  Y+YK+DIWS G++ +EM+ G PP+ ++ P +AI  + +  + + K    +S E + F+  CL+V+P++R    +L+   F+
Sbjct:  445 VHRDIKSDNVLLGMNGEVKLTDMGF-------CAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL 579          

HSP 2 Score: 46.9802 bits (110), Expect = 2.202e-25
Identity = 39/128 (30.47%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQ-----DKISSQELVLKKSTEMEFSLHR-DIFIGYRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            ++  K+   GA G VF+       D ++ + +  K   + E  L    +   YR  N   L  Y  S +V D D + + M YL GG+LT  + + + + E +   +  + L  +H LHR  IVHRDIK
Sbjct:  328 YEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPN---LVNYIESYLV-DADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIK 450          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 89.3521 bits (220), Expect = 2.310e-25
Identity = 44/142 (30.99%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I +DN++L   G  KL D G          +I     +    GT  +M+PEIL +  Y+YK+DIWS G++ +EM+ G PP+ ++ P +AI  + +  + + K    +S E + F+  CL+V+P++R    +L+   F+
Sbjct:  496 VHRDIKSDNVLLGMNGEVKLTDMGF-------CAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL 630          

HSP 2 Score: 46.9802 bits (110), Expect = 2.310e-25
Identity = 39/128 (30.47%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQ-----DKISSQELVLKKSTEMEFSLHR-DIFIGYRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            ++  K+   GA G VF+       D ++ + +  K   + E  L    +   YR  N   L  Y  S +V D D + + M YL GG+LT  + + + + E +   +  + L  +H LHR  IVHRDIK
Sbjct:  379 YEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPN---LVNYIESYLV-DADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIK 501          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 89.3521 bits (220), Expect = 2.407e-25
Identity = 44/142 (30.99%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I +DN++L   G  KL D G          +I     +    GT  +M+PEIL +  Y+YK+DIWS G++ +EM+ G PP+ ++ P +AI  + +  + + K    +S E + F+  CL+V+P++R    +L+   F+
Sbjct:  493 VHRDIKSDNVLLGMNGEVKLTDMGF-------CAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL 627          

HSP 2 Score: 46.9802 bits (110), Expect = 2.407e-25
Identity = 39/128 (30.47%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQ-----DKISSQELVLKKSTEMEFSLHR-DIFIGYRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            ++  K+   GA G VF+       D ++ + +  K   + E  L    +   YR  N   L  Y  S +V D D + + M YL GG+LT  + + + + E +   +  + L  +H LHR  IVHRDIK
Sbjct:  376 YEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPN---LVNYIESYLV-DADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIK 498          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 88.5817 bits (218), Expect = 2.509e-25
Identity = 43/142 (30.28%), Postives = 79/142 (55.63%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I +DN++L   G  KL D G    ++  +        +    GT  +M+PEIL +  Y+YK+DIWS G++ +EM+ G PP+ ++ P +AI  + +  + + K    +S E + F+  CL+V+P++R    +L+   F+
Sbjct:  116 VHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGS-------KRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL 250          

HSP 2 Score: 47.3654 bits (111), Expect = 2.509e-25
Identity = 39/124 (31.45%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 2142 KEFATGAFGKVFICQ-----DKISSQELVLKKSTEMEFSLHR-DIFIGYRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            K+   GA G VF+       D ++ + +  K   + E  L    +   YR  N   L  Y  S +V D D + + M YL GG+LT  + + + + E +   +  + L  +H LHR  IVHRDIK
Sbjct:    3 KQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPN---LVNYIESYLV-DADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIK 121          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 88.9669 bits (219), Expect = 9.997e-24
Identity = 46/142 (32.39%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +D+I+L   G  KL DFG         +   L K K+   GT  +M+PE++  +PY  ++DIWS G++++EMV G PPF  + P +A+  ++ M     K +  +S  L  F+   L+ +P +R +A +L+   F+
Sbjct:  484 IHRDIKSDSILLAADGRVKLSDFGFC-----AQVSQELPKRKSLV-GTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFL 619          

HSP 2 Score: 42.3578 bits (98), Expect = 9.997e-24
Identity = 34/129 (26.36%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFS-------LHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            EN D   +   G+ G V I  DK + +++ +KK   M+         L  ++ I     + + +  YS  + + D + + M YL GG+LT  +   + + E +   +  Q L  +  LH   ++HRDIK
Sbjct:  366 ENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKK---MDLRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVN-DELWVVMEYLEGGALTDIVTHSR-MDEEQIATVCKQCLKALAYLHSQGVIHRDIK 489          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: inaC (gene:FBgn0004784 transcript:FBtr0087047)

HSP 1 Score: 80.4925 bits (197), Expect = 1.025e-20
Identity = 54/136 (39.71%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVL---ISIELHQFIKSCLIVNPNERPSA 2917
            IY  +  DNI+LDG G+ KL+DFGLSK  E VT     +  + +  GT NYMAPEI+   PYS   D WSFG++L E + G  PF           +K       K +V     S+E    I S L   PN R  A
Sbjct:  492 IYRDLKLDNILLDGEGHVKLVDFGLSK--EGVTER---QTTRTFC-GTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKD------KKAVFPKHFSVEAMDIITSFLTKKPNNRLGA 615          

HSP 2 Score: 40.4318 bits (93), Expect = 1.025e-20
Identity = 29/129 (22.48%), Postives = 59/129 (45.74%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLK--------KSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            +F+F+K    G+FGKV + + + + +   +K        ++ +ME  ++    +    +    +  +S   + MD +   M Y  GG L   +QQ     E+  I  + ++   +  LH   I++RD+K
Sbjct:  370 DFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKILALSGRPPFLVSMHS-CFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALFFLHERDIIYRDLK 497          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 87.4261 bits (215), Expect = 1.884e-20
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G AKL DFG++  + +   +      +    GT  +MAPE++ EI Y    DIWS G+  +EM  G PP+ +  P RAI  + +     F+     S E   F+  CL+  P++R +A +L+  +FI
Sbjct:  158 IHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFI 293          

HSP 2 Score: 32.7278 bits (73), Expect = 1.884e-20
Identity = 34/124 (27.42%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            FD + +   G++G V+    K SS  +V  K   +E  LH   ++I I  +  +   +  Y    K  D + + M Y   GS++  ++ ++K + E+E   I    L  +  LH  + +HRDIK
Sbjct:   42 FDIMYKLGEGSYGSVYKAVHKESSS-IVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQYD-LWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIK 163          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 87.4261 bits (215), Expect = 1.884e-20
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G AKL DFG++  + +   +      +    GT  +MAPE++ EI Y    DIWS G+  +EM  G PP+ +  P RAI  + +     F+     S E   F+  CL+  P++R +A +L+  +FI
Sbjct:  158 IHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFI 293          

HSP 2 Score: 32.7278 bits (73), Expect = 1.884e-20
Identity = 34/124 (27.42%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            FD + +   G++G V+    K SS  +V  K   +E  LH   ++I I  +  +   +  Y    K  D + + M Y   GS++  ++ ++K + E+E   I    L  +  LH  + +HRDIK
Sbjct:   42 FDIMYKLGEGSYGSVYKAVHKESSS-IVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQYD-LWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIK 163          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0330047)

HSP 1 Score: 80.1073 bits (196), Expect = 2.756e-20
Identity = 43/142 (30.28%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DN++L   G+ K+ DFG   ++E        ++ +    GT  +MAPE++    Y  K+DIWS G++ +EM+ G PP+  + P RA+  +        K    +S  L  F+  CL V  + R +A +L+   F+
Sbjct:  411 IHRDIKSDNVLLGMDGSVKVTDFGFCANIEG-------DEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFL 545          

HSP 2 Score: 39.2762 bits (90), Expect = 2.756e-20
Identity = 35/128 (27.34%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIG--YRLK--NSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E +   +E   GA G VFI  D + ++  V  K+ +M+    +D+ +     LK  N   L  +  + +++  D + + M Y+ GG LT  +  +  + E +   +  + L  I  LH   I+HRDIK
Sbjct:  291 ERYKTTQEVGKGASGIVFIAAD-LQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTD-VVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIK 416          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk3 (serine/threonine kinase 3 (STE20 homolog, yeast) [Source:NCBI gene;Acc:324125])

HSP 1 Score: 95.1301 bits (235), Expect = 1.190e-24
Identity = 51/144 (35.42%), Postives = 78/144 (54.17%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIG 2950
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+     S +   F+K CL+ NP +R +A QL+   FI+G
Sbjct:  142 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279          

HSP 2 Score: 39.2762 bits (90), Expect = 1.190e-24
Identity = 35/126 (27.78%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   +    L  +  LH ++ +HRDIK
Sbjct:   24 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIK 147          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk3 (serine/threonine kinase 3 (STE20 homolog, yeast) [Source:NCBI gene;Acc:324125])

HSP 1 Score: 95.1301 bits (235), Expect = 1.190e-24
Identity = 51/144 (35.42%), Postives = 78/144 (54.17%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIG 2950
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+     S +   F+K CL+ NP +R +A QL+   FI+G
Sbjct:  142 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279          

HSP 2 Score: 39.2762 bits (90), Expect = 1.190e-24
Identity = 35/126 (27.78%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   +    L  +  LH ++ +HRDIK
Sbjct:   24 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIK 147          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 72.0182 bits (175), Expect = 4.206e-23
Identity = 47/144 (32.64%), Postives = 76/144 (52.78%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSV--LISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I   NI+ D AGN KL DFG S+ ++  TI +    +K+   GT  +M+PE++    Y  K DIWS G  +VEM+T  PP+   A   A+  + K+      P++   +S     F+K  + V   +RP+A+ L+   F+
Sbjct:  478 VHRDIKGANILRDSAGNVKLGDFGASRRLQ--TICLSGTGIKSVT-GTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPW---AEFEAMAAIFKIATQPTNPTLPPHVSDHCRDFLKR-IFVETKQRPAAEDLLRHTFV 614          

HSP 2 Score: 57.3806 bits (137), Expect = 4.206e-23
Identity = 40/138 (28.99%), Postives = 66/138 (47.83%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK---------------STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDM--DSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+   K    GAFG+VF+C D  + +EL +K+               + E E  L +++F         ++ QY   ++D    ++ + M Y+ GGS+  +++    + EN   K + QIL  +  LH   IVHRDIK
Sbjct:  353 NWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-------HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIK 483          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 72.0182 bits (175), Expect = 4.679e-23
Identity = 47/146 (32.19%), Postives = 77/146 (52.74%), Query Frame = 2
Query: 2513 LYIYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSV--LISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            + ++  I   NI+ D AGN KL DFG S+ ++  TI +    +K+   GT  +M+PE++    Y  K DIWS G  +VEM+T  PP+   A   A+  + K+      P++   +S     F+K  + V   +RP+A+ L+   F+
Sbjct:  484 MIVHRDIKGANILRDSAGNVKLGDFGASRRLQ--TICLSGTGIKSVT-GTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPW---AEFEAMAAIFKIATQPTNPTLPPHVSDHCRDFLKR-IFVETKQRPAAEDLLRHTFV 622          

HSP 2 Score: 57.3806 bits (137), Expect = 4.679e-23
Identity = 40/138 (28.99%), Postives = 66/138 (47.83%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK---------------STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDM--DSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+   K    GAFG+VF+C D  + +EL +K+               + E E  L +++F         ++ QY   ++D    ++ + M Y+ GGS+  +++    + EN   K + QIL  +  LH   IVHRDIK
Sbjct:  361 NWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-------HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIK 491          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 80.4925 bits (197), Expect = 1.059e-22
Identity = 48/147 (32.65%), Postives = 78/147 (53.06%), Query Frame = 2
Query: 2519 IYFYISADNIILDG-AGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYK--IDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSV--LISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I  DN++++  +G  K+ DFG SK +  +              GT+ YMAPEI+ + P  Y    DIWS G  ++EM TG PPFH+    +A   + K+  +K  P+V   +S +   FI  C   NP++R +A +L+ + F+
Sbjct:  752 VHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGIN------PCTETFTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAA--MFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL 890          

HSP 2 Score: 47.7506 bits (112), Expect = 1.059e-22
Identity = 41/119 (34.45%), Postives = 66/119 (55.46%), Query Frame = 3
Query: 2157 GAFGKVFICQD-----KISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQ-KCIHENEKIKISY--QILTQIHELHRLQIVHRDIK 2489
            G +G V+  +D     +I+ +E+  K ST  +  LH +I +  RLK+ + + QY   V +   I++ M  + GGSL+S ++ +   + +NE   + Y  QIL  +  LH  QIVHRDIK
Sbjct:  641 GTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRLKHRN-IVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIK 757          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 94.7449 bits (234), Expect = 3.412e-24
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S E   F+K CL+ NP +R +A QL+   FI
Sbjct:  144 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 279          

HSP 2 Score: 38.891 bits (89), Expect = 3.412e-24
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   I    L  +  LH ++ +HRDIK
Sbjct:   26 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSHYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIK 149          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 95.1301 bits (235), Expect = 4.115e-24
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S E   F+K CL+ NP +R +A QL+   FI
Sbjct:  140 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 275          

HSP 2 Score: 38.5058 bits (88), Expect = 4.115e-24
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   I    L  +  LH ++ +HRDIK
Sbjct:   22 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSHYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIK 145          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 95.1301 bits (235), Expect = 4.394e-24
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S E   F+K CL+ NP +R +A QL+   FI
Sbjct:  147 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 282          

HSP 2 Score: 38.5058 bits (88), Expect = 4.394e-24
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   I    L  +  LH ++ +HRDIK
Sbjct:   29 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSHYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIK 152          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 95.1301 bits (235), Expect = 4.468e-24
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S E   F+K CL+ NP +R +A QL+   FI
Sbjct:  142 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 277          

HSP 2 Score: 38.1206 bits (87), Expect = 4.468e-24
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   I    L  +  LH ++ +HRDIK
Sbjct:   24 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSHYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIK 147          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 95.1301 bits (235), Expect = 4.468e-24
Identity = 52/142 (36.62%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S E   F+K CL+ NP +R +A QL+   FI
Sbjct:  139 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 274          

HSP 2 Score: 38.1206 bits (87), Expect = 4.468e-24
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   I    L  +  LH ++ +HRDIK
Sbjct:   21 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSHYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIK 144          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 91.6633 bits (226), Expect = 9.260e-24
Identity = 50/142 (35.21%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ +P +R +A QL+   FI
Sbjct:  141 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFI 276          

HSP 2 Score: 39.6614 bits (91), Expect = 9.260e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   23 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 146          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 91.6633 bits (226), Expect = 9.336e-24
Identity = 50/142 (35.21%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ +P +R +A QL+   FI
Sbjct:  143 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFI 278          

HSP 2 Score: 39.6614 bits (91), Expect = 9.336e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   25 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 148          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 90.5077 bits (223), Expect = 8.529e-23
Identity = 49/142 (34.51%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S     F+K CL+ +P +R +A QL+   F+
Sbjct:  146 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFV 281          

HSP 2 Score: 37.7354 bits (86), Expect = 8.529e-23
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G V+    K + Q +V  K   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   28 EVFDVLEKLGEGSYGSVYKAIHKETGQ-IVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIK 151          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 78.1814 bits (191), Expect = 1.303e-21
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DNI+L   G+ KL DFG       +T E   +  ++   GT  +MAPE++    Y  K+DIWS G++ +EM+ G PP+  + P RA+  +      + +    +S     F+  CL ++  +R SA++L+  QF+
Sbjct:  385 IHRDIKSDNILLGMDGSVKLTDFGFCAQ---ITPE---QSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL 520          

HSP 2 Score: 46.2098 bits (108), Expect = 1.303e-21
Identity = 33/117 (28.21%), Postives = 58/117 (49.57%), Query Frame = 3
Query: 2157 GAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIG----YRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            GA G V+   D  + QE+ +K+   ++    +++ I      R   +  +  Y  S +V D   + + M YL+GGSLT  +  + C+ E +   +  + L  +  LH  Q++HRDIK
Sbjct:  278 GASGTVYTAMDVATGQEVAIKQ-MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTD-VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIK 390          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 78.1814 bits (191), Expect = 1.303e-21
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DNI+L   G+ KL DFG       +T E   +  ++   GT  +MAPE++    Y  K+DIWS G++ +EM+ G PP+  + P RA+  +      + +    +S     F+  CL ++  +R SA++L+  QF+
Sbjct:  385 IHRDIKSDNILLGMDGSVKLTDFGFCAQ---ITPE---QSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL 520          

HSP 2 Score: 46.2098 bits (108), Expect = 1.303e-21
Identity = 33/117 (28.21%), Postives = 58/117 (49.57%), Query Frame = 3
Query: 2157 GAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIG----YRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            GA G V+   D  + QE+ +K+   ++    +++ I      R   +  +  Y  S +V D   + + M YL+GGSLT  +  + C+ E +   +  + L  +  LH  Q++HRDIK
Sbjct:  278 GASGTVYTAMDVATGQEVAIKQ-MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGD--ELWVVMEYLAGGSLTD-VVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIK 390          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|G5EGQ3|MAX2_CAEEL (Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans OX=6239 GN=max-2 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.531e-24
Identity = 44/142 (30.99%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I +DN++L   G  KL D G          +I     +    GT  +M+PEIL +  Y+YK+DIWS G++ +EM+ G PP+ ++ P +AI  + +  + + K    +S E + F+  CL+V+P++R    +L+   F+
Sbjct:  493 VHRDIKSDNVLLGMNGEVKLTDMGF-------CAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFL 627          

HSP 2 Score: 46.9802 bits (110), Expect = 2.531e-24
Identity = 39/128 (30.47%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQ-----DKISSQELVLKKSTEMEFSLHR-DIFIGYRLKNSSKLFQY--SRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            ++  K+   GA G VF+       D ++ + +  K   + E  L    +   YR  N   L  Y  S +V D D + + M YL GG+LT  + + + + E +   +  + L  +H LHR  IVHRDIK
Sbjct:  376 YEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPN---LVNYIESYLV-DADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIK 498          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q7ZUQ3|STK3_DANRE (Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.352e-24
Identity = 51/144 (35.42%), Postives = 78/144 (54.17%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIG 2950
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+     S +   F+K CL+ NP +R +A QL+   FI+G
Sbjct:  142 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279          

HSP 2 Score: 39.2762 bits (90), Expect = 7.352e-24
Identity = 35/126 (27.78%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   +    L  +  LH ++ +HRDIK
Sbjct:   24 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIK 147          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q10056|SHK2_SCHPO (Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk2 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.191e-23
Identity = 47/142 (33.10%), Postives = 80/142 (56.34%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DN++LD +GN K+ DFG    + N T +      +    GT  +MAPE++++  Y  K+DIWS G++++EM+   PP+ ++ P RA+  + K      K   L+S  L  F+ SCL ++   R +A +L+   F+
Sbjct:  431 IHRDIKSDNVLLDNSGNIKITDFGFCARLSNRTNK------RVTMVGTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMIENEPPYLREDPIRALYLIAKNGTPTLKKPNLVSKNLKSFLNSCLTIDTIFRATAAELLTHSFL 566          

HSP 2 Score: 38.5058 bits (88), Expect = 1.191e-23
Identity = 35/117 (29.91%), Postives = 56/117 (47.86%), Query Frame = 3
Query: 2157 GAFGKVFI------CQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            G F  V I      CQ +   +EL+L + T M  S+H +I            +  S +V++   + + M Y++ GSLT  I++ K + E +  +I  +    I  LH   I+HRDIK
Sbjct:  335 GIFDSVAIKSIDLQCQTR---KELILNEITVMRESIHPNIVT----------YLDSFLVRERH-LWVVMEYMNAGSLTDIIEKSK-LTEAQIARICLETCKGIQHLHARNIIHRDIK 436          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q802A6|STK4_SQUAC (Serine/threonine-protein kinase 3/4 OS=Squalus acanthias OX=7797 GN=STK4 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.297e-23
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L + E   F+K CL+ NP +R +A QL+   FI
Sbjct:  148 IHRDIKAGNILLNNEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGISAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWTDEFTDFVKQCLVKNPEQRAAATQLLQHPFI 283          

HSP 2 Score: 39.6614 bits (91), Expect = 1.297e-23
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   30 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTD-LWIVMEYCGAGSVSDLIRIRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIK 153          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q6IP06|STK3_XENLA (Serine/threonine-protein kinase 3 OS=Xenopus laevis OX=8355 GN=stk3 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.006e-23
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L + E   F+K CL+ NP +R +A QL+   FI
Sbjct:  142 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWTDEFTDFVKKCLVKNPEQRATATQLLQHPFI 277          

HSP 2 Score: 38.891 bits (89), Expect = 2.006e-23
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   24 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSHYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILRSTLKGLEYLHFMRKIHRDIK 147          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: T2M6M6 (Mitogen-activated protein kinase kinase kinase 3 OS=Hydra vulgaris OX=6087 GN=MAP3K3 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.825e-25
Identity = 45/142 (31.69%), Postives = 74/142 (52.11%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I   NI+LD +GN KL DFG SK ++ +  +   + +     GT  +M+PE++    Y  K DIWS G  ++EM+T  PP+ +  P  A+ ++         P    SI   +F+  C   +P+ RP+A +L+   F+
Sbjct:  489 IHRDIKGANILLDSSGNCKLADFGASKQIQTIRSQTGCKSVH----GTPYWMSPEVINGAGYGRKADIWSLGCTVLEMLTTKPPWFQFEPMAALFKIATQTTIPHLPDD-SSISCKRFVDDCFKRDPSLRPNALELLSYAFV 625          

HSP 2 Score: 62.003 bits (149), Expect = 5.825e-25
Identity = 42/135 (31.11%), Postives = 69/135 (51.11%), Query Frame = 3
Query: 2127 NFDF--LKEFATGAFGKVFICQDKISSQELVLK------------KSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            NF +  +++  +G FG V++C D  + +EL +K            K  E+   L R+I + Y+  N  ++ +Y   ++   SI + M Y+ GGS+  KI +   + E E     +QIL  I+ LH   I+HRDIK
Sbjct:  364 NFKWKQVRQIGSGGFGTVYLCVDLNTGKELAMKYIETGHINTAALKEVEI---LQREISL-YKTLNHERIVEYYGTIQANTSISIFMEYMEGGSIHDKISKIGALDEKETSCYCFQILEGINYLHSKNIIHRDIK 494          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: I7LT45 (Cyclin-dependent kinase-like Serine/Threonine kinase family protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00716030 PE=4 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.199e-24
Identity = 52/142 (36.62%), Postives = 84/142 (59.15%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  + +DNI+L+  G+ K+ DFG +  +   T E   +K +    GT  +MAPE++    YS K+DIWS G++ +E++ G PP+ +  PA+A+  + K   +K   +   S E   F+ +CL ++P ERP+AQQLI   FI
Sbjct:  295 IHRDLKSDNILLNQNGDVKIADFGFATQL---TREHFSKKSQV---GTPAWMAPELILRKDYSQKVDIWSLGVICIEILEGEPPYIRDKPAKAMYYITKKKPHKLD-ATKFSQEACDFVSTCLNIDPQERPTAQQLISHPFI 429          

HSP 2 Score: 46.2098 bits (108), Expect = 1.199e-24
Identity = 40/131 (30.53%), Postives = 64/131 (48.85%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQDKISSQELVLK----------KSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQ-KCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            +DFL +   GA  KV+ C++K + QE  ++          + T+ME      I +    KN++ + QY +    MD I +A+ Y++ GSLT  I      + E     I  QIL  +  +HR   +HRD+K
Sbjct:  177 YDFLSQIGKGATCKVYRCKNKQTGQECAMRVIRMLNPDQIEKTKME------ILLMNESKNNN-IVQYYKSYIYMDVIFMAIEYMNAGSLTELIYGNFSFLSEQMASYICEQILFGLFFIHRTNQIHRDLK 300          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: T1G1N2 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20214980 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.956e-24
Identity = 53/149 (35.57%), Postives = 78/149 (52.35%), Query Frame = 2
Query: 2510 LLYIYFYISADNIILDGAGNAKLIDFGLSK---SMENVTIEILLEKLKAYA-PGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            L+ ++  I   NI+ D  GN KL DFG +K   S+ N T ++      A    GT  YM+PEI+    Y  K+DIWS G  +VEM+TG+PP+H+     AI ++       +K     S+++  F+  C   +P  RPSA+ L    FI
Sbjct:  124 LMIVHRDIKGANILRDHEGNIKLTDFGAAKRLSSIVNKTADVSKNLTGAKTMTGTPYYMSPEIIEGKRYGRKVDIWSLGCTVVEMLTGHPPWHEYEGVAAIFKIATQPHPSYKLPPDTSLQVKDFLSCCFERDPERRPSAKILYNHMFI 272          

HSP 2 Score: 52.373 bits (124), Expect = 2.956e-24
Identity = 39/131 (29.77%), Postives = 65/131 (49.62%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK----------STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+   K    G FG+V++C D  +  EL +K+          S E+  +L  +I +   L N  ++ QY    K+   + + M ++ GGS+  +IQ    + E+   + + Q+L  +  LH L IVHRDIK
Sbjct:    4 NWKKGKILGAGGFGQVYLCYDVDTGVELAVKQVNVYCQSEDISKEVR-ALQSEIKLLQDLSNP-RIVQYYGSQKEPHMLSIFMEFVPGGSVKDQIQDYGPLTESVTKRYTKQVLEGLEFLHSLMIVHRDIK 132          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A7S4G7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g104385 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.518e-24
Identity = 47/142 (33.10%), Postives = 74/142 (52.11%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I   NI+ D  GN KL DFG SK ++ +  +     +     GT  +MAPE++    Y  K D+WS G  +VEM+T  PP+    P  A+ ++         PS L S++  +F++S L +N   RPSA +L+   F+
Sbjct:  126 VHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVH----GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDL-SVDAVEFVRSTLRMNSKSRPSADELLRFSFV 262          

HSP 2 Score: 62.3882 bits (150), Expect = 3.518e-24
Identity = 47/130 (36.15%), Postives = 68/130 (52.31%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK--------STEMEF-SLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+   K    GAFG+V++C D  + +EL +K+        ST+ E  +L  +I      +N  ++ QY  I  D   I + M YL GGS+   I+Q   ++E+   K S QIL  I  LH  +IVHRDIK
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNE-RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 131          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: T1EDA5 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20194557 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 7.819e-24
Identity = 46/138 (33.33%), Postives = 73/138 (52.90%), Query Frame = 2
Query: 2531 ISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            +   NI+ D  GN KL DFG SK ++ ++  I+  +      GT+ YM+PE+L    Y  K DIWS G  +VEM+TG+PP+H+     AI ++    E  +     +S +   F+  C   +   RP++ QL+   F+
Sbjct:  132 VKGANILRDNEGNVKLSDFGASKRLQTISNSIMQTQ-----TGTIYYMSPELLDGNGYGRKTDIWSLGCSVVEMLTGHPPWHQLENFAAIFKIVTSDEPGYSLPDSVSKQARDFVSECFTRSLERRPTSSQLLYHSFV 264          

HSP 2 Score: 51.9878 bits (123), Expect = 7.819e-24
Identity = 35/133 (26.32%), Postives = 63/133 (47.37%), Query Frame = 3
Query: 2121 MENFDFLKEFATGAFGKVFICQDKISSQELVLKK----------STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            M+++   +   +G+FG+VF+C D  + +E  +K+           + +  +L  +I I         + QY     D     + M Y+ GGS+  +I+Q   + E   I  + Q+L  +  LH+  IVHRD+K
Sbjct:    1 MKSWKRGRLLGSGSFGQVFLCCDMETGKEYAMKQVHIFSKNSQHCSRVLSALREEINILKEGVKHPHIVQYFGCQDDGVVFSILMEYMPGGSVKDQIKQYGPLTERNTISYTKQVLLGLEYLHKKSIVHRDVK 133          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: stk3 (serine/threonine kinase 3 [Source:NCBI gene;Acc:103027492])

HSP 1 Score: 93.9745 bits (232), Expect = 1.855e-24
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ NP +R +A QL+   FI
Sbjct:  142 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 277          

HSP 2 Score: 39.6614 bits (91), Expect = 1.855e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   24 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 147          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 85.1149 bits (209), Expect = 1.125e-22
Identity = 47/137 (34.31%), Postives = 70/137 (51.09%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLI 2929
            I+  I A NI+L+  G AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+     S     F+  CL+ NP  R +A QL+
Sbjct:  149 IHRDIKAGNILLNSEGQAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDQWSEPFRDFVSQCLVKNPENRATATQLL 279          

HSP 2 Score: 42.743 bits (99), Expect = 1.125e-22
Identity = 37/126 (29.37%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQ-KCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K  + E+V  K   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+Q+ K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   31 EVFDVLEKLGEGSYGSVFKAHYK-ETGEIVAIKQVPVESDLQEIIKEISIMQQCNSPHVVRYYGSYFKNSD-LWIVMEYCGAGSVSDIIRQRNKTLAEDEIAAILQSTLKGLEYLHFMRKIHRDIK 154          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 70.4774 bits (171), Expect = 1.156e-22
Identity = 47/146 (32.19%), Postives = 78/146 (53.42%), Query Frame = 2
Query: 2513 LYIYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELH--QFIKSCLIVNPNERPSAQQLIGSQFI 2944
            + ++  I   NI+ D AGN KL DFG S+ ++  TI +    +K+   GT  +M+PE++    Y  K DIWS G  +VEM+T  PP+   A   A+  + K+      P++   +  H   F+K  + V   +RP+A++L+   F+
Sbjct:  481 MIVHRDIKGANILRDSAGNVKLGDFGASRRLQ--TICLSGTGIKSVT-GTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPPW---AEFEAMAAIFKIATQPTNPALPAHVSDHCRDFLKR-IFVETKQRPAAEELLRHIFV 619          

HSP 2 Score: 57.3806 bits (137), Expect = 1.156e-22
Identity = 41/138 (29.71%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK---------------STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLA--MPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+   K    GAFG+VF+C D  + +EL +K+               + E E  L +++F         ++ QY   ++D     L+  M Y+ GGS+  +++    + EN   K + QIL  +  LH   IVHRDIK
Sbjct:  358 NWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-------HERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIK 488          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5-like [Source:NCBI gene;Acc:103038360])

HSP 1 Score: 76.6406 bits (187), Expect = 3.008e-22
Identity = 48/145 (33.10%), Postives = 76/145 (52.41%), Query Frame = 2
Query: 2531 ISADNIILDG-AGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSY--KIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSV--LISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIG 2950
            I  DN++++  +G  K+ DFG SK +  +              GT+ YMAPEI+ + P  Y    DIWS G  ++EM TG PPFH+    +A   + K+  +K  P+V   +S E    +  C   NP++R +A +L+ + F+ G
Sbjct:  754 IKGDNVLINTYSGVLKISDFGTSKRLAGIN------PCTETFTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQA--AMFKVGMFKIHPNVPESMSEEAKACLMCCFESNPDKRATASELLKNAFLRG 890          

HSP 2 Score: 49.6766 bits (117), Expect = 3.008e-22
Identity = 42/119 (35.29%), Postives = 66/119 (55.46%), Query Frame = 3
Query: 2157 GAFGKVFICQD-----KISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQ-KCIHENEKIKISY--QILTQIHELHRLQIVHRDIK 2489
            G +G V+  +D     +I+ +E+  K ST  +  LH +I +  RLK+ + + QY   V +   I++ M  + GGSL+S ++ Q   + +NE   + Y  QIL  +  LH  QIVHRDIK
Sbjct:  639 GTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRLKHRN-IVQYLGSVSEGGFIKIFMEEVPGGSLSSLLRSQWGPLKDNEPTIVFYTKQILEGLKYLHDNQIVHRDIK 755          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak6b (serine/threonine-protein kinase PAK 6-like [Source:NCBI gene;Acc:103030407])

HSP 1 Score: 83.1889 bits (204), Expect = 7.094e-22
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFII 2947
            I+  I +D+I+L   G  KL DFG         I   + K K+   GT  +MAPE++ + PY  ++D+WS G+++VEMV G PP+    P  A+  L+       + S  IS  L  F+ S L  +P +R SA  L+   F++
Sbjct:  512 IHRDIKSDSILLTLDGRIKLSDFGFC-----AQISKDIPKRKSLV-GTPYWMAPEVISKTPYGTEVDVWSLGIMVVEMVDGEPPYFSDTPVAAMKRLRDEPAPSVRNSSKISPVLKDFLDSMLTRDPLQRSSASDLLKHPFLL 648          

HSP 2 Score: 41.9726 bits (97), Expect = 7.094e-22
Identity = 37/131 (28.24%), Postives = 69/131 (52.67%), Query Frame = 3
Query: 2118 YMENFDFLKEFATGAFGKVFICQDKISSQELV-----LKKSTEMEFSLHRDIFI--GYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            Y+ENF  + E   G+ G V I ++K S +++      L+K    E  L  ++ I   YR KN  ++++ + + +++  I   M YL GG+LT+ + + + + E +   +   +L  +  LH   ++HRDIK
Sbjct:  395 YLENFVKIGE---GSTGVVCIAREKHSGKQVAVKMMDLRKQQRREL-LFNEVVIMRDYRHKNVVEMYKSALVEEELWVI---MEYLQGGALTNIVSETR-LTEEQIATVCEAVLQALAYLHAQGVIHRDIK 517          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 66.2402 bits (160), Expect = 4.811e-21
Identity = 43/143 (30.07%), Postives = 69/143 (48.25%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELH-QFIKSCLIVNPNERPSAQQLIGSQFI 2944
            ++  I   NI+ D  GN KL DFG SK ++ +  +    +      GT  +M+PE++    Y  K DIWS G  +VEM+T  PP+   A   A+  + K+      P + +    H + +   + V    RPSA+ L+   F+
Sbjct:  483 VHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMR---SVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPW---AEFEAMAAIFKIATQPTDPRLPLHASEHARDLLRRIFVEAKLRPSAEDLLRHPFV 619          

HSP 2 Score: 53.5286 bits (127), Expect = 4.811e-21
Identity = 42/134 (31.34%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK--------STEMEF-SLHRDIFIGYRLKN--SSKLFQYSRIVKDMD--SIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+   K    GAFG+V++C D  + +EL +K+         T  E  +L  +I +   LKN    ++ QY   ++D    ++ + M Y+ GGS+  +++    + EN   K + QIL  +  LH   IVHRDIK
Sbjct:  358 NWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQL---LKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIK 488          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 80.1073 bits (196), Expect = 8.837e-20
Identity = 46/142 (32.39%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +D+I+L   G  KL DFG       V+ E+   K      GT  +MAPE++  +PY  ++D+WS G++++EMV G PP+  + P +A+  ++  V  K K     S  L  F+   L+ +P  R +A +L+   F+
Sbjct:  535 IHRDIKSDSILLTADGRIKLSDFGFCA---QVSKEVTRRKSLV---GTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFL 670          

HSP 2 Score: 35.4242 bits (80), Expect = 8.837e-20
Identity = 31/131 (23.66%), Postives = 61/131 (46.56%), Query Frame = 3
Query: 2118 YMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIG-------YRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            Y+ENF  + E +TG    V +  D+ S +++ +KK   +     R++          Y  +N   ++    +    D + + M +L GG+LT  +   + ++E +   +   +L  +  LH   ++HRDIK
Sbjct:  418 YLENFIKIGEGSTGV---VCLAVDRRSGRQVAVKK-MHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVA---DELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCVSVLRALAYLHGQGVIHRDIK 540          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 84.7297 bits (208), Expect = 4.220e-19
Identity = 53/153 (34.64%), Postives = 79/153 (51.63%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEI-----LREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQN 2962
            I+  + A NI+L   G+ KL DFG+S   +N      L++  ++  GT  +MAPE+     +++ PY YK DIWS G+ L+E+    PP H+  P R ++++ K            S E   F+K CL  NP  R +A QL+   FI G   N
Sbjct:  151 IHRDLKAGNILLTFEGDVKLADFGVS--AKNTRT---LQRRDSFI-GTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISGVDSN 297          

HSP 2 Score: 28.4906 bits (62), Expect = 4.220e-19
Identity = 29/130 (22.31%), Postives = 63/130 (48.46%), Query Frame = 3
Query: 2130 FDFLKEFATGAFGKVFICQDKIS---SQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDS------IQLAMPYLSGGSLTS-KIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            +  + E   GAFGKV+  Q+K S   +   V++  +E E     D  +   +     L  +  IV  +++      + + + +  GG++ +  ++ ++ + E +   +  Q+L  ++ LH  +I+HRD+K
Sbjct:   33 WSVIGELGDGAFGKVYKAQNKESGVLAAAKVIETKSEEELE---DYMVEIEI---LALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLK 156          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 4.874e-19
Identity = 38/102 (37.25%), Postives = 51/102 (50.00%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVE 2824
            +Y  +  +NI+LD  G+  L DFGL K        I          GT  Y+APE+L++ PY   +D W  G VL EM+ G PPF+ K        LK+M E
Sbjct:  213 VYRDLKPENILLDYQGHIVLTDFGLCKE------GIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSK-------NLKQMYE 301          

HSP 2 Score: 49.6766 bits (117), Expect = 4.874e-19
Identity = 38/134 (28.36%), Postives = 62/134 (46.27%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQD---------KISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLF----QYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            +FDFL     G+FGKV + +          K+  + ++L+K  E      R++ +    KN    F     YS   +  D +   M Y++GG L   +Q+Q    E+     + +I + I  LH L IV+RD+K
Sbjct:   91 DFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLV----KNVRHPFLVGLHYS--FQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLK 218          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008103.1 (pep scaffold:Pmarinus_7.0:GL476484:390774:392599:-1 gene:ENSPMAG00000007328.1 transcript:ENSPMAT00000008103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 1.175e-18
Identity = 42/124 (33.87%), Postives = 71/124 (57.26%), Query Frame = 2
Query: 2573 KLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            KL DFG       V+ E+   K      GT  +MAPE++  +PY  ++DIWS G++++EMV G PP+  + P +A+  ++  +  K K S   +++L  F+   L+ +P +R SA +L+G  F+
Sbjct:    3 KLSDFGFCA---QVSKEVTRRKSLV---GTPYWMAPEVISRLPYGPEVDIWSLGVMVMEMVDGEPPYFNEPPLQAMRRIRDNIPPKIKNSQGTTVQLRSFLDRMLVRDPTQRASAVELLGHPFL 120          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 88.5817 bits (218), Expect = 2.122e-21
Identity = 46/143 (32.17%), Postives = 77/143 (53.85%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFII 2947
            ++  I +DNI+L   G+ KL DFG    +  + ++      +    GT  +MAPE++    Y  K+DIWS G++++EM+ G PP+  + P RA+  +      K K    +S  L +F+  CL V P +R SA +L+  ++I 
Sbjct:  736 LHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLK------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYIT 872          

HSP 2 Score: 31.5722 bits (70), Expect = 2.122e-21
Identity = 39/141 (27.66%), Postives = 62/141 (43.97%), Query Frame = 3
Query: 2088 N*FCSRGFASYMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDS------IQLAMPYLSGGSLTSKIQQQKCI-HENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N  CS G  S    +  L +   GA G V+   + I +   V  K   +E    +++ I   L    K  ++  IV  +DS      + + M Y+ GGSLT  +    CI  E +   +  + L+ +  LH   ++HRDIK
Sbjct:  608 NEICSDGDPSTK--YANLVKIGQGASGGVYTAYE-IGTNVSVAIKQMNLEKQPKKELIINEIL--VMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH--CILTEGQIGAVCRETLSGLEFLHSKGVLHRDIK 741          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: YPL150W_mRNA (Protein kinase of unknown cellular role; binds phosphatidylinositols and cardiolipin in a large-scale study [Source:SGD;Acc:S000006071])

HSP 1 Score: 79.337 bits (194), Expect = 7.517e-21
Identity = 51/147 (34.69%), Postives = 75/147 (51.02%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKS-MENVTIEILLEKLKAYAPGTVNYMAPEILREIPYS-YKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGY 2953
            ++  +  +NI+LD  GNAKL DFG ++  M   T+E +         GT  YMAPE++    Y  +KIDIWS G++L  ++TG  PF     A+   ++    E K+   V I  +    I   L  NP ERPS  Q++   F+  Y
Sbjct:  154 VHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVC--------GTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNE-EPKYDAKV-IPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPY 290          

HSP 2 Score: 39.2762 bits (90), Expect = 7.517e-21
Identity = 29/123 (23.58%), Postives = 62/123 (50.41%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFI--GYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+  LK+   G+FGKV++   + + +++ LK S + + ++ R++F    +     +KL++   ++     + +A+ Y  G  L   +   + I   E  ++  QI   ++  H +  VHRD+K
Sbjct:   40 NYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDKNDPNIVREVFYHRQFDFPYITKLYE---VIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQISGAVYYAHSMHCVHRDLK 159          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 86.6557 bits (213), Expect = 6.595e-20
Identity = 47/143 (32.87%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLK-AYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DNI+L+  G  K+ DFG         +E+  ++ K A   GT  +MAPEI+ +  Y  K+D+WS G++L+EM+ G PP+  + P +A+  +      K +    +S +  QF+ +CL VN   R S ++L+  +F+
Sbjct:  504 IHRDIKSDNILLNSQGLVKITDFGF-------CVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFL 639          

HSP 2 Score: 28.8758 bits (63), Expect = 6.595e-20
Identity = 18/66 (27.27%), Postives = 31/66 (46.97%), Query Frame = 3
Query: 2319 DMDSIQLAMPYLSGGSLTSKI---------QQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            D + + + M Y+ GG LT  +         +    ++EN+   I  +    +  LH  +I+HRDIK
Sbjct:  444 DDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIK 509          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 82.8037 bits (203), Expect = 1.952e-19
Identity = 43/142 (30.28%), Postives = 76/142 (53.52%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +DN++LD     K+ DFG    + +   +      +A   GT  +MAPE++++  Y  KID+WS G++ +EM+ G PP+  + P +A+  +      K K    +S+E+ +F+  CL V+   R S ++L+   F 
Sbjct:  690 IHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSK------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 825          

HSP 2 Score: 30.8018 bits (68), Expect = 1.952e-19
Identity = 28/109 (25.69%), Postives = 48/109 (44.04%), Query Frame = 3
Query: 2187 DKISSQELVLKKSTEMEFSLHRDIFI-GYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHE-------LHRLQIVHRDIK 2489
            DK++ +++VL K    E  ++  + +   R KN     +    ++  D + + M ++ GGSLT  I+       +       QI   + E       LH   I+HRDIK
Sbjct:  589 DKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEA--YLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIK 695          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 76.2554 bits (186), Expect = 6.859e-19
Identity = 52/156 (33.33%), Postives = 76/156 (48.72%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAI--IELKKMV-----EYKFKPSVLISIE--LHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQ 2959
            I+  I   NI+L+  G  KL DFG+S    N         L     GT  YMAPE ++  PYS   D+WS G+ L+E+  G  PF      + +  IEL  M+     + K +P + IS       FI  CL  +  ERPS +Q++   +I+G ++
Sbjct:  339 IHRDIKPQNILLNEKGEIKLCDFGVSGEAVN--------SLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWIVGQMK 486          

HSP 2 Score: 35.4242 bits (80), Expect = 6.859e-19
Identity = 37/127 (29.13%), Postives = 58/127 (45.67%), Query Frame = 3
Query: 2148 FATGAFGKVFICQDKISSQELVLKK----STEMEFSLHRDIFIGYRLKNSSK---LFQYSRIVKD--MDSIQLAMPYLSGGSLTSK----IQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
               GA G V  C+ K   +   LK     +T+ E+   + IF   +   S K   + QY  +  D    SI +AM Y+ G SL +     +++   I E    KI+  +L  +  LH  +++HRDIK
Sbjct:  220 LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEY--QKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIK 344          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 81.2629 bits (199), Expect = 1.574e-28
Identity = 47/138 (34.06%), Postives = 72/138 (52.17%), Query Frame = 2
Query: 2531 ISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I   NI+ D  GN KL DFG SK ++ +  +     +     GT  +MAPE++    Y  K D+WS G  +VEM+T  PP+    P  A+ ++         PS L S++  +F++S L +N   RPSA +L+   F+
Sbjct:  130 IKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVH----GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDL-SVDAVEFVRSTLRMNSKSRPSADELLRFSFV 262          

HSP 2 Score: 64.6994 bits (156), Expect = 1.574e-28
Identity = 48/132 (36.36%), Postives = 69/132 (52.27%), Query Frame = 3
Query: 2121 MENFDFLKEFATGAFGKVFICQDKISSQELVLKK--------STEMEF-SLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            M N+   K    GAFG+V++C D  + +EL +K+        ST+ E  +L  +I      +N  ++ QY  I  D   I + M YL GGS+   I+Q   ++E+   K S QIL  I  LH  +IVHRDIK
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNE-RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 131          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 92.0485 bits (227), Expect = 3.244e-23
Identity = 50/147 (34.01%), Postives = 76/147 (51.70%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQ 2959
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++E+ Y    DIWS G+  +EM  G PP+    P RAI  +       F+     S +   F+  CL+ NP ER +A +L+   FI G  Q
Sbjct:  140 IHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQ 280          

HSP 2 Score: 36.1946 bits (82), Expect = 3.244e-23
Identity = 34/127 (26.77%), Postives = 62/127 (48.82%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKK---STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTS--KIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+    T+++  + ++I +  +  +   +  Y    K+ D + + M Y   GS++   KI+ +    E  K  + Y  L  +  LH  + +HRDIK
Sbjct:   22 EVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQ-EIIKEISMMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKY-TLKGLEYLHLRRKIHRDIK 145          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO48741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM4])

HSP 1 Score: 86.2705 bits (212), Expect = 1.204e-22
Identity = 51/153 (33.33%), Postives = 80/153 (52.29%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEIL-----REIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQN 2962
            I+  + A N++L   GN K+ DFG+S   +       L+K   +  GT  +MAPE++     ++ PY YK DIWS G+ L+E+    PP H   P R + ++ K     F      S +L+ F+ SC++ NP+ R SA ++I   FI  +  N
Sbjct:  140 IHRDLKAGNLLLASDGNVKMADFGVSAKNKKT-----LQKRSTFI-GTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIELAQMVPPNHNMHPMRVLFKIPKSDPPTFDNPNKWSNDLNDFLASCVVKNPDMRASATEMIKHPFIADFTDN 286          

HSP 2 Score: 39.6614 bits (91), Expect = 1.204e-22
Identity = 33/128 (25.78%), Postives = 66/128 (51.56%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISS-----QELVLKKSTEME-FSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTS-KIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N++ + E   G+FGKV+  Q K  S     + +++    E+E F +  DI    + KN   LF+    + D   + + + + SGG+L    ++ ++ ++E E   ++ Q+   +  LH  +++HRD+K
Sbjct:   21 NWELVGELGDGSFGKVYKAQHKTESSLSAAKIIIVNDENELEDFMVEIDILSECKHKNLVGLFET--FLHD-GKLWMMLEFCSGGALDDLMLELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLK 145          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 60.077 bits (144), Expect = 2.907e-20
Identity = 38/125 (30.40%), Postives = 69/125 (55.20%), Query Frame = 3
Query: 2127 NFDFLKEFATGAFGKVFICQDKISSQELVLKK----STEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            N+D L+    G+F KVF C ++ +  E   K+      E +  + ++I +   L++ + +  YS I ++ +++ L M Y++GGSL  ++ QQ    E +   ++ Q+L  +  LH  +IVHRDIK
Sbjct:    4 NYDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHENIVSLYSSI-REGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIK 127          

HSP 2 Score: 57.7658 bits (138), Expect = 2.907e-20
Identity = 38/143 (26.57%), Postives = 73/143 (51.05%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNA---KLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVL---ISIELHQFIKSCLIVNPNERPSAQQLI 2929
            ++  I  DN++L   GN    KL DFGL++++ N T     + +   A G   ++APE + E P    +DIW+ G++   ++ G PPF   +  + ++ + +  +Y   PS     +S +    +   ++V+P  R SA++ +
Sbjct:  122 VHRDIKPDNLLLKRTGNNVTIKLADFGLAQALPNDT-----DVISCGASGAPMFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPPFWSNSDEQLLLSILRG-QYTM-PSPFWDNVSNDARDLVHKLIVVDPEARISAKEAL 257          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 82.4185 bits (202), Expect = 7.694e-20
Identity = 48/142 (33.80%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I +D+I+L   G  KL DFG       VT ++   K      GT  +MAPE++   PY  ++DIWS G++++EMV G PP+  + P +A+ +L+ +     +  + IS  L  F+ + LI +P  R +A +L+   FI
Sbjct:  145 IHRDIKSDSILLTSNGTVKLSDFGFCA---QVTEDMPRRKSLV---GTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFI 280          

HSP 2 Score: 33.8834 bits (76), Expect = 7.694e-20
Identity = 30/129 (23.26%), Postives = 59/129 (45.74%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIG-------YRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            EN     +   G+ G V +  DK + +++ +KK  +++    R++          Y   N  +++  S +V D   + + M +L GG+LT  +     + E +   +   +L  +  LH   ++HRDIK
Sbjct:   27 ENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKK-MDLKKQQRRELLFNEVVIMRDYPHPNIVEMYG-SHLVGD--ELWVVMEFLEGGTLTDIVTHTN-LSEEQVACVCRAVLKALTFLHSQGVIHRDIK 150          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 93.9745 bits (232), Expect = 2.504e-24
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ NP +R +A QL+   FI
Sbjct:  143 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 278          

HSP 2 Score: 39.6614 bits (91), Expect = 2.504e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   25 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 148          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 93.9745 bits (232), Expect = 2.588e-24
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G+AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S +   F+K CL+ NP +R +A QL+   FI
Sbjct:  146 IHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 281          

HSP 2 Score: 39.2762 bits (90), Expect = 2.588e-24
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K S Q + +K+   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E+E   I    L  +  LH ++ +HRDIK
Sbjct:   28 EVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQ-VPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTD-LWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 151          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000044704.1 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 90.8929 bits (224), Expect = 1.457e-23
Identity = 50/142 (35.21%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S     F+  CL+ NP  R +A QL+   FI
Sbjct:  149 IHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFI 284          

HSP 2 Score: 39.6614 bits (91), Expect = 1.457e-23
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K  + E+V  K   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   + +  L  +  LH ++ +HRDIK
Sbjct:   31 EVFDVLEKLGEGSYGCVFKANYK-ETGEIVAIKQVPVESDLQEIIKEISIMQQCNSPHVVRYYGSYFKNSD-LWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIK 154          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000024938.2 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 90.8929 bits (224), Expect = 2.251e-23
Identity = 50/142 (35.21%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFI 2944
            I+  I A NI+L+  G AKL DFG++  + +   +      +    GT  +MAPE+++EI Y+   DIWS G+  +EM  G PP+    P RAI  +       F+   L S     F+  CL+ NP  R +A QL+   FI
Sbjct:  149 IHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFI 284          

HSP 2 Score: 39.2762 bits (90), Expect = 2.251e-23
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 2124 ENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLH---RDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQ-QQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            E FD L++   G++G VF    K  + E+V  K   +E  L    ++I I  +  +   +  Y    K+ D + + M Y   GS++  I+ + K + E E   + +  L  +  LH ++ +HRDIK
Sbjct:   31 EVFDVLEKLGEGSYGCVFKANYK-ETGEIVAIKQVPVESDLQEIIKEISIMQQCNSPHVVRYYGSYFKNSD-LWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIK 154          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 75.8702 bits (185), Expect = 7.746e-22
Identity = 48/141 (34.04%), Postives = 73/141 (51.77%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQF 2941
            ++  I   NI+ D AGN KL DFG SK ++  TI +    +++   GT  +M+PE++    Y  K D+WS G  +VEM+T  PP+ +     AI ++         PS   S +   FI  C+ V    RPSA++L+   F
Sbjct:  477 VHRDIKGANILRDSAGNVKLGDFGASKRLQ--TICMSGTGIRSVT-GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPLLPS-HTSDQARDFIH-CIFVEAKHRPSAEELLRHPF 612          

HSP 2 Score: 49.2914 bits (116), Expect = 7.746e-22
Identity = 42/129 (32.56%), Postives = 64/129 (49.61%), Query Frame = 3
Query: 2142 KEFATGAFGKVFICQDKISSQELVLKK--------STEMEFS-LHRDIFIGYRLKN--SSKLFQYSRIVKDMD--SIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            K    GAFG V++C D  + +EL  K+         T  E S L  +I +   LKN    ++ QY   ++D    ++ + M Y+ GGS+  +++    + EN   K + QIL  +  LH   IVHRDIK
Sbjct:  357 KLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQL---LKNLHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIK 482          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024565.1 (SMESG000024565.1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 443/443 (100.00%), Postives = 443/443 (100.00%), Query Frame = 2
Query:  185 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMI 1513
            MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMI
Sbjct:    1 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMI 443          

HSP 2 Score: 262.692 bits (670), Expect = 2.222e-138
Identity = 127/142 (89.44%), Postives = 133/142 (93.66%), Query Frame = 2
Query: 2531 ISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYL 2956
            I  DNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAP R +IELKKMVEY+FKP++LISIE +QFIK CL V+PNERPSAQQLI SQFII YL
Sbjct:  566 IKPDNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPPRVVIELKKMVEYEFKPNLLISIEFNQFIKWCLTVDPNERPSAQQLIESQFIIDYL 707          

HSP 3 Score: 251.136 bits (640), Expect = 2.222e-138
Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 3
Query: 2121 MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK
Sbjct:  445 MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 567          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024565.1 (SMESG000024565.1)

HSP 1 Score: 261.922 bits (668), Expect = 7.503e-139
Identity = 127/142 (89.44%), Postives = 133/142 (93.66%), Query Frame = 2
Query: 2531 ISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYL 2956
            I  DNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAP R +IELKKMVEY+FKP++LISIE +QFIK CL V+PNERPSAQQLI SQFII YL
Sbjct:  122 IKPDNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPPRVVIELKKMVEYEFKPNLLISIEFNQFIKWCLTVDPNERPSAQQLIESQFIIDYL 263          

HSP 2 Score: 253.447 bits (646), Expect = 7.503e-139
Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 3
Query: 2121 MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK
Sbjct:    1 MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 123          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024532.1 (SMESG000024532.1)

HSP 1 Score: 276.174 bits (705), Expect = 1.705e-105
Identity = 134/148 (90.54%), Postives = 139/148 (93.92%), Query Frame = 2
Query: 2519 IYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQN 2962
            I+  I  DNI+ DGAGNAKLIDFGLSK M+N T E +LEKLKAYAPGT+NYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQN
Sbjct:  539 IHRDIKPDNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYAPGTINYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQN 686          

HSP 2 Score: 128.257 bits (321), Expect = 1.705e-105
Identity = 63/123 (51.22%), Postives = 87/123 (70.73%), Query Frame = 3
Query: 2121 MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            MEN +  KEF  G FG+VF  QD IS ++L +K +   + SL+RDIFI   + N+S+LF+YS + K    + +AMPY++GGSLTS IQ +K + E E ++ISYQIL QI +LH L+I+HRDIK
Sbjct:  422 MENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIK 544          

HSP 3 Score: 251.136 bits (640), Expect = 3.627e-71
Identity = 162/437 (37.07%), Postives = 244/437 (55.84%), Query Frame = 2
Query:  185 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASL---KFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDE 1486
            MKI V+  EN  +K  I+++++S V +I++K+DKI  G+ KW K  ++ ++KNII+ DE  I  YK+CE DEI   +IENYL SDDVI+EVFL+G  P +I+LIV+ N+SI+ I+SMIE +Q ++INI D+ G +M   Q V++     YYRLIV Y  +     +FEDC++Q+ +F     + F L     +E +  T IN V   +N+I+ IM  ND  + RLKENLS  PS  +    +F  +I  RI DIC ++W+ +++      + +I   F +++L+ LHQY    +   E   K+FN IV+DAL Y V      + +   C+   Y   L           + D FL   R  SE+ E+ N Y ++    +   K  N +          T+++AK  +AQK GV + DLY I   N DK  + + Y E
Sbjct:    1 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHDE-YIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFT----FRFCLNSEFEFEDM--TEINTV-NLINKIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKS-FELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLV------KHLHDHCKDLKYHQKL-----------FFDHFLLVPRPVSEYIELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKE 411          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 160.229 bits (404), Expect = 4.745e-74
Identity = 78/143 (54.55%), Postives = 101/143 (70.63%), Query Frame = 2
Query: 2531 ISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQ 2959
            I  +NI+ D   N KLIDFGL+K + +   + L  K KA +PGT+NYMAPE+ +E P S KIDIWSFGMV+VEMVTG  PF+   P + ++ L K+++Y+FKP + IS +L QFI  CL V+PN RP+AQQLI SQ I  YLQ
Sbjct:  416 IKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQ 558          

HSP 2 Score: 139.043 bits (349), Expect = 4.745e-74
Identity = 69/125 (55.20%), Postives = 94/125 (75.20%), Query Frame = 3
Query: 2115 SYMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            S M +F+ L E A G FGKVFIC+DKIS +++V+KK  +++ SLHR+I IG  L +  +L +YS +++D  +I L MPYL GG+LTS IQQ KC+ ENE I+IS+QILTQI ELH+ +I+H DIK
Sbjct:  294 SKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILFDK-ELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIK 417          

HSP 3 Score: 160.999 bits (406), Expect = 3.439e-41
Identity = 104/317 (32.81%), Postives = 167/317 (52.68%), Query Frame = 2
Query:  590 MTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQL------SRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMIKFV 1522
            M  +Q+VT+  +  YYRLIV  G++     TF++C  Q+ + +II YY         +E   E    ++I Q+ +I+ I+ SND  + RL ENLS FP AF+K + +F  DI+ RIWDIC++Y +L      S     NDEW  + LFF  ALL+ + +Y +  +N  +   K+FN I+VDAL   V      R + + CE   ++             +W++ F   ++   + DE+F + ++ +   ++  +   E     +P+TI+EA +A+A K  +   DLY+I     DKP DG+PY + +  F LM K  
Sbjct:    1 MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYY--YSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLV------RHLMNPCEDWKHA-----------AKRWLNSFFLITQSDGDMDELFVK-FDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMA 297          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 160.229 bits (404), Expect = 4.824e-74
Identity = 78/143 (54.55%), Postives = 101/143 (70.63%), Query Frame = 2
Query: 2531 ISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQ 2959
            I  +NI+ D   N KLIDFGL+K + +   + L  K KA +PGT+NYMAPE+ +E P S KIDIWSFGMV+VEMVTG  PF+   P + ++ L K+++Y+FKP + IS +L QFI  CL V+PN RP+AQQLI SQ I  YLQ
Sbjct:  424 IKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQ 566          

HSP 2 Score: 139.043 bits (349), Expect = 4.824e-74
Identity = 69/125 (55.20%), Postives = 94/125 (75.20%), Query Frame = 3
Query: 2115 SYMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIK 2489
            S M +F+ L E A G FGKVFIC+DKIS +++V+KK  +++ SLHR+I IG  L +  +L +YS +++D  +I L MPYL GG+LTS IQQ KC+ ENE I+IS+QILTQI ELH+ +I+H DIK
Sbjct:  302 SKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILFDK-ELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIK 425          

HSP 3 Score: 166.777 bits (421), Expect = 4.730e-43
Identity = 107/323 (33.13%), Postives = 171/323 (52.94%), Query Frame = 2
Query:  572 DFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQL------SRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMIKFV 1522
            D  GN+M  +Q+VT+  +  YYRLIV  G++     TF++C  Q+ + +II YY         +E   E    ++I Q+ +I+ I+ SND  + RL ENLS FP AF+K + +F  DI+ RIWDIC++Y +L      S     NDEW  + LFF  ALL+ + +Y +  +N  +   K+FN I+VDAL   V      R + + CE   ++             +W++ F   ++   + DE+F + ++ +   ++  +   E     +P+TI+EA +A+A K  +   DLY+I     DKP DG+PY + +  F LM K  
Sbjct:    3 DCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYY--YSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLV------RHLMNPCEDWKHA-----------AKRWLNSFFLITQSDGDMDELFVK-FDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMA 305          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK36.163e-2435.92serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
STK36.980e-2435.92serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
STK45.977e-2334.51serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK49.156e-2334.51serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
PAK11.662e-2131.69p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-21.620e-2530.99Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.202e-2530.99Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.310e-2530.99Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.407e-2530.99Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.509e-2530.28Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbt9.997e-2432.39gene:FBgn0025743 transcript:FBtr0074285[more]
inaC1.025e-2039.71gene:FBgn0004784 transcript:FBtr0087047[more]
hpo1.884e-2033.80gene:FBgn0261456 transcript:FBtr0331920[more]
hpo1.884e-2033.80gene:FBgn0261456 transcript:FBtr0086500[more]
Pak32.756e-2030.28gene:FBgn0044826 transcript:FBtr0330047[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk31.190e-2435.42serine/threonine kinase 3 (STE20 homolog, yeast) [... [more]
stk31.190e-2435.42serine/threonine kinase 3 (STE20 homolog, yeast) [... [more]
map3k24.206e-2332.64mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k24.679e-2332.19mitogen-activated protein kinase kinase kinase 2 [... [more]
si:ch211-1i11.31.059e-2232.65si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp43.412e-2436.62elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.115e-2436.62elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.394e-2436.62elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.468e-2436.62elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.468e-2436.62elongator acetyltransferase complex subunit 4 [Sou... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk39.260e-2435.21serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk39.336e-2435.21serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk48.529e-2334.51serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Pak11.303e-2131.69p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak11.303e-2131.69p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5EGQ3|MAX2_CAEEL2.531e-2430.99Serine/threonine-protein kinase max-2 OS=Caenorhab... [more]
sp|Q7ZUQ3|STK3_DANRE7.352e-2435.42Serine/threonine-protein kinase 3 OS=Danio rerio O... [more]
sp|Q10056|SHK2_SCHPO1.191e-2333.10Serine/threonine-protein kinase shk2 OS=Schizosacc... [more]
sp|Q802A6|STK4_SQUAC1.297e-2335.92Serine/threonine-protein kinase 3/4 OS=Squalus aca... [more]
sp|Q6IP06|STK3_XENLA2.006e-2335.92Serine/threonine-protein kinase 3 OS=Xenopus laevi... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2M6M65.825e-2531.69Mitogen-activated protein kinase kinase kinase 3 O... [more]
I7LT451.199e-2436.62Cyclin-dependent kinase-like Serine/Threonine kina... [more]
T1G1N22.956e-2435.57Protein kinase domain-containing protein OS=Helobd... [more]
A7S4G73.518e-2433.10Predicted protein (Fragment) OS=Nematostella vecte... [more]
T1EDA57.819e-2433.33Protein kinase domain-containing protein OS=Helobd... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk31.855e-2435.92serine/threonine kinase 3 [Source:NCBI gene;Acc:10... [more]
STK41.125e-2234.31serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
map3k21.156e-2232.19mitogen-activated protein kinase kinase kinase 2 [... [more]
si:ch211-1i11.33.008e-2233.10mitogen-activated protein kinase kinase kinase 5-l... [more]
pak6b7.094e-2234.27serine/threonine-protein kinase PAK 6-like [Source... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k24.811e-2130.07mitogen-activated protein kinase kinase kinase 2 [... [more]
pak48.837e-2032.39p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
slka4.220e-1934.64STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
ENSPMAT00000006766.14.874e-1937.25pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008103.11.175e-1833.87pep scaffold:Pmarinus_7.0:GL476484:390774:392599:-... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE202.122e-2132.17Cdc42p-activated signal transducing kinase; involv... [more]
YPL150W_mRNA7.517e-2134.69Protein kinase of unknown cellular role; binds pho... [more]
SKM16.595e-2032.87Member of the PAK family of serine/threonine prote... [more]
CLA41.952e-1930.28Cdc42p-activated signal transducing kinase; member... [more]
MKK26.859e-1933.33MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.574e-2834.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428453.244e-2334.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487411.204e-2233.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412422.907e-2030.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458467.694e-2033.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk32.504e-2435.92serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
stk32.588e-2435.92serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
ENSORLT00000044704.11.457e-2335.21serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
ENSORLT00000024938.22.251e-2335.21serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
map3k37.746e-2234.04mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024565.12.222e-138100.00SMESG000024565.1[more]
SMESG000024565.17.503e-13989.44SMESG000024565.1[more]
SMESG000024532.11.705e-10590.54SMESG000024532.1[more]
SMESG000024843.14.745e-7454.55SMESG000024843.1[more]
SMESG000024843.14.824e-7454.55SMESG000024843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027773 ID=SMED30027773|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3128bp
CATCACTATATACCATTTAATTTTACACTATGTTGTCTTACTTTTTATCT
ATTTTGATGTCAATCAATAATATTAAACTTTGGAATAATCACTGCAACTA
TTAATTCTATCACATGCAAATAATATATAACCATAATAAGATAGAAATAT
AATTTATTTGCAGTTCGAGAAAATTAATTGAAGGATGAAGATATTTGTCA
TTCGTGTGGAAAATCCTGAAATAAAGATAGAGATAAAACTGGAAGAATAT
TCATTGGTGAGGAATATAAGAAATAAATTGGACAAAATTTTCCCCGGTCG
TGTCAAATGGAATAAACATTTTATAAAGCTAGTTCACAAAAATATAATAA
TGGACGATGAGAAAAGCATTGGATGGTACAAATTATGCGAGGGGGATGAG
ATTCTGTGCGTCAGAATTGAGAATTACTTGTGCAGTGATGACGTCATTTT
GGAAGTTTTTCTGAGTGGATTTGTGCCTGAAGTAATTTACTTGATAGTTC
AAAGAAATTATTCAATTTCAAAAATAAAATCAATGATTGAGAGAATTCAG
TGTGAAATAATAAATATTTGCGATTTTACCGGAAATAAAATGACAGGAAG
TCAAACGGTCACAGAGACTTCCAGCTGTGCATATTACAGATTGATTGTGA
AATATGGCCGCAAGGAAACTTGCATTTCAACATTTGAGGATTGCCTCAAA
CAATATCATAAATTCAGAATCATTCATTACTATGATTTCATTTTGCGACT
CAGACATCTTTATGAATGTTTGTTTGAAACGAGAATAAATGAAGTGATAA
AACAAATGAATGAAATAAAAGCAATTATGCTATCAAATGATCCATTCGAA
ATTAGATTGAAAGAAAATTTATCAGAGTTTCCTTCTGCATTTATCAAATG
CCATTCAATATTTTGTGACGATATTTCTTCAAGAATATGGGATATTTGTG
ATGACTATTGGCAGCTGAGTCGAAATGTAATTGAGAATGATGAATGGATT
GTGATTGGATTATTTTTCCGCATGGCGCTATTAATTGTGCTCCATCAATA
CTTGGAACACGAACGAAATCATTGTGAAATTGCTACCAAAACATTCAATT
CGATCGTTGTCGACGCTTTGGGATATTCTGTGACGCTTTTGATAAAAATT
CGACAAATGGAATCATTCTGCGAAACTGCCGGATATTCCTTCGATTTGAT
TGGTGAGCTAATGGAAGATATTTGCGTAAAGTGGATGGATCCATTTTTGT
CGACTTCTCGTTATTATTCCGAGTTTGATGAAGTTTTCAATCGTTACTAT
AATAAAACGTTTGCTTCATTAAAATTTGGAAACGGTTCCGTGGAATTTCA
TTTTCATTCGGATCCACAAACAATCATTGAGGCCAAAGAAGCAATGGCAC
AGAAATGCGGAGTGAAAGTGAATGATTTGTATGCCATTTATCAGAGGAAT
GAGGATAAACCGACTGATGGAGAACCATACGACGAAACAATTTTGGATTT
TGTATTAATGATAAAGTTTGTTTGACTAGATCGAATTTATTTGAATCGAA
TTAAAGTAGTGAGATATGATCTCACAAGAACAAATATATTATTTTTCATC
GCATCAGTCCGTAATAAATACATTATAAAACCAAAAGTCGTTTCACTAGA
AAAAAGACAGTAGGAGTAACCGTCAGAATAATTTCAAACTGTATTAAACA
GTAACTGACAAGATGCTAAATTAGAAAAACTTAACTTAAAAATTCTTAAA
AAAATAAATGTTTTACTTTTTTTCTATCTTAAAATGACTTTTTTTACTTG
TGATAAAATTTCTTAGACTTTTTTATTGACTATATTTTATTGGGTCAAAA
CTTAAGCACGTCCTTGCTTATCAAAATTAACATTTTTTAATTTGGAAATG
TAGGTTTAATAGAGAATTAAATTCTAATAATTTTAACAATTTTTATTAGT
CAAATCTTTCATATCAAAAATGTCTTCTAAAAATGATTAATCCTACGATG
CGACCCAATGGATCTGTTTTAGTTCTAGGCTAAAATATGACTCAGTGTCT
TTGTTCTCCAAAAAGTATGACTCATGCGATGAGTCATAATTGATTTTGTT
CTCGCGGATTCGCATCTTATATGGAAAATTTTGATTTTCTGAAAGAATTC
GCTACTGGAGCATTCGGAAAAGTTTTCATTTGTCAAGATAAAATATCAAG
CCAGGAATTAGTTCTAAAAAAGTCAACTGAAATGGAATTCAGTCTCCACC
GCGACATCTTTATTGGTTATCGTCTCAAAAACTCCAGTAAACTATTCCAA
TATTCAAGAATTGTCAAAGATATGGACAGCATCCAATTGGCCATGCCTTA
CCTGTCAGGGGGATCTCTCACCTCAAAGATTCAGCAGCAAAAATGTATAC
ATGAAAACGAGAAAATCAAAATCTCCTATCAAATCCTCACACAAATACAT
GAATTACACAGATTACAAATTGTCCATCGAGACATCAAACGTTTGGTGTT
GTCTGAATGCTATTATATATTTATTTTTATATTTCAGCCGATAATATCAT
TTTAGACGGAGCGGGAAACGCGAAATTAATTGACTTTGGGCTAAGTAAAT
CGATGGAAAATGTGACCATTGAAATCCTATTAGAAAAACTGAAGGCCTAC
GCCCCTGGCACCGTCAATTACATGGCACCGGAAATATTGAGAGAAATTCC
TTATTCGTATAAAATTGATATTTGGTCATTTGGAATGGTGCTGGTTGAGA
TGGTGACAGGAAATCCTCCTTTCCATAAGAAAGCTCCAGCCCGGGCGATA
ATAGAGCTCAAGAAGATGGTAGAATATAAATTCAAACCAAGCGTGCTCAT
TTCTATTGAATTACACCAATTTATCAAGTCATGCTTGATTGTGAACCCAA
ATGAGAGGCCTAGTGCTCAACAGTTGATCGGGTCACAATTTATTATTGGT
TATTTGCAGAACTGATTCCATTAATAATTTGCGACGTTGGCACATTTTGA
GCTCAAAGAAAAACACACAAATATTTGCAATTGGGATGACCTTACTGTAA
CAAACTCATATTTTTATAATTGCTAAAATTGTTGTTTAAATTGTTTGTGG
AAAAAATACAAAATAAAAAATCTATTAA
back to top

protein sequence of SMED30027773-orf-1

>SMED30027773-orf-1 ID=SMED30027773-orf-1|Name=SMED30027773-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=153bp
MLLYIYFYISADNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAP
GTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIE
LKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYL
QN*
back to top

protein sequence of SMED30027773-orf-2

>SMED30027773-orf-2 ID=SMED30027773-orf-2|Name=SMED30027773-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLV
HKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEV
IYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAY
YRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETR
INEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSR
IWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIA
TKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKW
MDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEA
KEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMIKFV*
back to top

protein sequence of SMED30027773-orf-3

>SMED30027773-orf-3 ID=SMED30027773-orf-3|Name=SMED30027773-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGY
RLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIK
ISYQILTQIHELHRLQIVHRDIKRLVLSECYYIFIFIFQPIISF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0035329hippo signaling
GO:0043010camera-type eye development
GO:0090090negative regulation of canonical Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCDDcd17039Ubl_ubiquitin_likecoord: 6..76
e-value: 0.00455911
score: 33.7238
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 1..77