high mobility group-2

Overview
Namehigh mobility group-2 (AFJ24755.1)
Smed IDSMED30027770
Length (bp)686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of high mobility group-2 (SMED30027770) t-SNE clustered cells

Violin plots show distribution of expression levels for high mobility group-2 (SMED30027770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of high mobility group-2 (SMED30027770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for high mobility group-2 (SMED30027770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027770SMESG000020771.1 SmedASXL_006537SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027770SMESG000020771.1 Contig50327newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027770SMESG000020771.1 Contig50327uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
X1 cellSMED30027770SMESG000020771.1 CUFF.40159.1be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30027770SMESG000020771.1 dd_Smed_v4_1646_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30027770SMESG000020771.1 H.22.5fsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 1 cellSMED30027770SMESG000020771.1 H.22.5fsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30027770SMESG000020771.1 SMED30027770smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30027770SMESG000020771.1 SMED_09062_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027770SMESG000020771.1 SMED_09062_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of high mobility group-2 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 130.568 bits (327), Expect = 8.162e-38
Identity = 65/134 (48.51%), Postives = 90/134 (67.16%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS 444
            KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW+
Sbjct:    7 KKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWN 134          
BLAST of high mobility group-2 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 130.568 bits (327), Expect = 8.162e-38
Identity = 65/134 (48.51%), Postives = 90/134 (67.16%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS 444
            KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW+
Sbjct:    7 KKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWN 134          
BLAST of high mobility group-2 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 132.109 bits (331), Expect = 1.236e-37
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 132.109 bits (331), Expect = 1.236e-37
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 132.109 bits (331), Expect = 1.236e-37
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 112.849 bits (281), Expect = 1.586e-30
Identity = 68/173 (39.31%), Postives = 95/173 (54.91%), Query Frame = 1
Query:   13 YNLVTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK--YEEMNKEAKEKYNLAMLEYK 525
            Y    + M      G  S Y  + +   EE+KKK P+  V  TEISK  SEKWK + D EK ++  LAQ D +RY  E+  Y  E   R    K KR  KDP+ PK  L+AFFF+S + R  ++  +P++KVG +A+ LGKMW     ++K  YE+  +  K++Y   M  YK
Sbjct:   33 YQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAYGGEDAMR----KRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYK 201          

HSP 2 Score: 46.595 bits (109), Expect = 4.007e-6
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE 267
            P  A SA+  Y+Q  R E +  +PD KV   ++++   + WK +  + K+ Y   AQADK RY  EM  Y+ E
Sbjct:  133 PKRALSAFFFYSQDKRPEIQAGHPDWKVG--QVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKAE 203          
BLAST of high mobility group-2 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 112.849 bits (281), Expect = 1.586e-30
Identity = 68/173 (39.31%), Postives = 95/173 (54.91%), Query Frame = 1
Query:   13 YNLVTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK--YEEMNKEAKEKYNLAMLEYK 525
            Y    + M      G  S Y  + +   EE+KKK P+  V  TEISK  SEKWK + D EK ++  LAQ D +RY  E+  Y  E   R    K KR  KDP+ PK  L+AFFF+S + R  ++  +P++KVG +A+ LGKMW     ++K  YE+  +  K++Y   M  YK
Sbjct:   33 YQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAYGGEDAMR----KRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYK 201          

HSP 2 Score: 46.595 bits (109), Expect = 4.007e-6
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE 267
            P  A SA+  Y+Q  R E +  +PD KV   ++++   + WK +  + K+ Y   AQADK RY  EM  Y+ E
Sbjct:  133 PKRALSAFFFYSQDKRPEIQAGHPDWKVG--QVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKAE 203          
BLAST of high mobility group-2 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 108.227 bits (269), Expect = 9.780e-29
Identity = 68/175 (38.86%), Postives = 95/175 (54.29%), Query Frame = 1
Query:   13 YNLVTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEME--GYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK--YEEMNKEAKEKYNLAMLEYK 525
            Y    + M      G  S Y  + +   EE+KKK P+  V  TEISK  SEKWK + D EK ++  LAQ D +RY  E+    Y  E   R    K KR  KDP+ PK  L+AFFF+S + R  ++  +P++KVG +A+ LGKMW     ++K  YE+  +  K++Y   M  YK
Sbjct:   32 YQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMR----KRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYK 202          

HSP 2 Score: 46.595 bits (109), Expect = 4.069e-6
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE 267
            P  A SA+  Y+Q  R E +  +PD KV   ++++   + WK +  + K+ Y   AQADK RY  EM  Y+ E
Sbjct:  134 PKRALSAFFFYSQDKRPEIQAGHPDWKVG--QVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKAE 204          
BLAST of high mobility group-2 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 108.227 bits (269), Expect = 1.055e-28
Identity = 68/175 (38.86%), Postives = 95/175 (54.29%), Query Frame = 1
Query:   13 YNLVTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEME--GYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK--YEEMNKEAKEKYNLAMLEYK 525
            Y    + M      G  S Y  + +   EE+KKK P+  V  TEISK  SEKWK + D EK ++  LAQ D +RY  E+    Y  E   R    K KR  KDP+ PK  L+AFFF+S + R  ++  +P++KVG +A+ LGKMW     ++K  YE+  +  K++Y   M  YK
Sbjct:   33 YQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMR----KRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYK 203          

HSP 2 Score: 46.595 bits (109), Expect = 4.171e-6
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE 267
            P  A SA+  Y+Q  R E +  +PD KV   ++++   + WK +  + K+ Y   AQADK RY  EM  Y+ E
Sbjct:  135 PKRALSAFFFYSQDKRPEIQAGHPDWKVG--QVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKAE 205          
BLAST of high mobility group-2 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 108.227 bits (269), Expect = 1.055e-28
Identity = 68/175 (38.86%), Postives = 95/175 (54.29%), Query Frame = 1
Query:   13 YNLVTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEME--GYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK--YEEMNKEAKEKYNLAMLEYK 525
            Y    + M      G  S Y  + +   EE+KKK P+  V  TEISK  SEKWK + D EK ++  LAQ D +RY  E+    Y  E   R    K KR  KDP+ PK  L+AFFF+S + R  ++  +P++KVG +A+ LGKMW     ++K  YE+  +  K++Y   M  YK
Sbjct:   33 YQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMR----KRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYK 203          

HSP 2 Score: 46.595 bits (109), Expect = 4.171e-6
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE 267
            P  A SA+  Y+Q  R E +  +PD KV   ++++   + WK +  + K+ Y   AQADK RY  EM  Y+ E
Sbjct:  135 PKRALSAFFFYSQDKRPEIQAGHPDWKVG--QVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKAE 205          
BLAST of high mobility group-2 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089259)

HSP 1 Score: 141.739 bits (356), Expect = 5.565e-40
Identity = 75/165 (45.45%), Postives = 103/165 (62.42%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KP G  +AY  + Q  REE+KKK+PD  V F E S+  +E+WK + DKEK++++ +A+ DK+RY  EM+ Y P         K +++ KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+   + K KYE M +  K +Y   M EYK 
Sbjct:  168 DAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKT 332          
BLAST of high mobility group-2 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089260)

HSP 1 Score: 141.739 bits (356), Expect = 5.565e-40
Identity = 75/165 (45.45%), Postives = 103/165 (62.42%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KP G  +AY  + Q  REE+KKK+PD  V F E S+  +E+WK + DKEK++++ +A+ DK+RY  EM+ Y P         K +++ KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+   + K KYE M +  K +Y   M EYK 
Sbjct:  168 DAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKT 332          
BLAST of high mobility group-2 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089261)

HSP 1 Score: 141.739 bits (356), Expect = 5.565e-40
Identity = 75/165 (45.45%), Postives = 103/165 (62.42%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KP G  +AY  + Q  REE+KKK+PD  V F E S+  +E+WK + DKEK++++ +A+ DK+RY  EM+ Y P         K +++ KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+   + K KYE M +  K +Y   M EYK 
Sbjct:  168 DAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKT 332          
BLAST of high mobility group-2 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089262)

HSP 1 Score: 141.739 bits (356), Expect = 5.672e-40
Identity = 75/165 (45.45%), Postives = 103/165 (62.42%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KP G  +AY  + Q  REE+KKK+PD  V F E S+  +E+WK + DKEK++++ +A+ DK+RY  EM+ Y P         K +++ KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+   + K KYE M +  K +Y   M EYK 
Sbjct:  169 DAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKT 333          
BLAST of high mobility group-2 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0339766)

HSP 1 Score: 141.739 bits (356), Expect = 5.672e-40
Identity = 75/165 (45.45%), Postives = 103/165 (62.42%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KP G  +AY  + Q  REE+KKK+PD  V F E S+  +E+WK + DKEK++++ +A+ DK+RY  EM+ Y P         K +++ KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+   + K KYE M +  K +Y   M EYK 
Sbjct:  169 DAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKT 333          
BLAST of high mobility group-2 vs. Ensembl Zebrafish
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 135.961 bits (341), Expect = 2.113e-39
Identity = 79/172 (45.93%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKY--NLAMLEYKNGVPSAKK 549
            KP G  S+Y  + Q  REE+KKKNP   VNF+E SK  SE+W+ +S KEK K+  +A+ DK RY +EM+ Y P         K  ++ KDPN PK P +AFF F ++HR  VK  NP   +GDIAK LG+MWS+   K+KS YE+   + KEKY  ++A    K G P   K
Sbjct:    7 KPRGKTSSYAFFVQTCREEHKKKNPGTSVNFSEFSKKCSERWRTMSSKEKGKFEEMAKTDKVRYDREMKNYVPPK-----GAKGGKKKKDPNAPKRPPSAFFVFCSDHRPKVKGDNPGISIGDIAKKLGEMWSKLSPKEKSPYEQKAMKLKEKYEKDVAAYRAKGGKPDGAK 173          
BLAST of high mobility group-2 vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 134.806 bits (338), Expect = 6.444e-39
Identity = 72/171 (42.11%), Postives = 109/171 (63.74%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS--ECKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKS 552
            KP G  SAY  + Q  R+E+K+K+PD  VNF+E SK  SE+WK+++  +K K+  +A+ADK RY +EM+ Y P     K   K  R+ KDPN PK P +AFF F +E+R TVK ++P   +G+IAK LG++WS    KD++ +E+   + +EKY   +  Y+ G  ++K+ 
Sbjct:    8 KPKGKTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPP----KGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRG 174          
BLAST of high mobility group-2 vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 134.806 bits (338), Expect = 6.444e-39
Identity = 72/171 (42.11%), Postives = 109/171 (63.74%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS--ECKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKS 552
            KP G  SAY  + Q  R+E+K+K+PD  VNF+E SK  SE+WK+++  +K K+  +A+ADK RY +EM+ Y P     K   K  R+ KDPN PK P +AFF F +E+R TVK ++P   +G+IAK LG++WS    KD++ +E+   + +EKY   +  Y+ G  ++K+ 
Sbjct:    8 KPKGKTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPP----KGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRG 174          
BLAST of high mobility group-2 vs. Ensembl Zebrafish
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 133.265 bits (334), Expect = 8.290e-39
Identity = 74/154 (48.05%), Postives = 97/154 (62.99%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKY 501
            KP G  S+Y  + Q  REE+KKKNP   VNF+E SK  SE+W+ +S KEK K+  +A+ DK RY +EM+ Y P         K  ++ KDPN PK P +AFF F ++HR  VK  NP   +GDIAK LG+MWS+   K+KS YE+   + KEKY
Sbjct:    7 KPRGKTSSYAFFVQTCREEHKKKNPGTSVNFSEFSKKCSERWRTMSSKEKGKFEEMAKTDKVRYDREMKNYVPPK-----GAKGGKKKKDPNAPKRPPSAFFVFCSDHRPKVKGDNPGISIGDIAKKLGEMWSKLSPKEKSPYEQKAMKLKEKY 155          
BLAST of high mobility group-2 vs. Ensembl Zebrafish
Match: hmgb3b (high mobility group box 3b [Source:ZFIN;Acc:ZDB-GENE-050417-290])

HSP 1 Score: 125.176 bits (313), Expect = 1.135e-35
Identity = 63/140 (45.00%), Postives = 83/140 (59.29%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK 465
            KP G  SAY  + +  REE+ KKNP   VNF+E SK  SE+WK +S KEK K+  LA+ DK RY +EM  Y        P KK +++ KDPN P+ P + FF F  + R  +K +NP   +GD+AK LG MW+   D  K
Sbjct:    8 KPKGKMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQDKARYDQEMMHYN-------PGKKGRKQKKDPNAPRRPPSGFFLFCAKQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEK 140          
BLAST of high mobility group-2 vs. Ensembl Xenopus
Match: hmgb2 (high mobility group box 2 [Source:NCBI gene;Acc:394499])

HSP 1 Score: 133.265 bits (334), Expect = 3.881e-38
Identity = 76/162 (46.91%), Postives = 100/162 (61.73%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSE--CKDKSKYEEMNKEAKEKYNLAMLEYK 525
            KP G  S+Y  + Q  REE+KKK+PD  VNF E SK  SE+WK +S KEK K+  +A+ DK RY +EM+ Y P        +K  ++ KDPN PK P +AFF F +EHR  +K ++P   +GD AK LG+MWSE   KDK  YE+   + KEKY   +  YK
Sbjct:    8 KPRGKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMAKNDKVRYEREMKTYIPPK-----GEKKGKKKKDPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDVAAYK 164          
BLAST of high mobility group-2 vs. Ensembl Xenopus
Match: cep170b (centrosomal protein 170B [Source:Xenbase;Acc:XB-GENE-5943417])

HSP 1 Score: 132.88 bits (333), Expect = 4.837e-38
Identity = 75/165 (45.45%), Postives = 101/165 (61.21%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK 525
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E R  +K ++P   +GDIAK LG+MW  +   DK  YE    + KEKY   +  Y+
Sbjct:    5 DPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKSKFEDMAKADKVRYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGSTIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKDVAAYR 163          
BLAST of high mobility group-2 vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 123.635 bits (309), Expect = 1.353e-34
Identity = 71/157 (45.22%), Postives = 94/157 (59.87%), Query Frame = 1
Query:   64 SAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEA--KEKYNLAMLEYKN 528
            SAY  + Q  REE+KKKNP+  VNF E SK  SE+WK +S KEK K++ LA+ADK RY +EM+ + P            ++ KDPN PK P + FF F +E R  +K  NP   +GD+AK LG+MW+   D  K    NK A  KEKY   + +YK+
Sbjct:   14 SAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVK--------KGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKDVADYKS 162          
BLAST of high mobility group-2 vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 120.939 bits (302), Expect = 7.371e-34
Identity = 69/148 (46.62%), Postives = 89/148 (60.14%), Query Frame = 1
Query:   64 SAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEA--KEKY 501
            SAY  + Q  REE+KKKNP+  VNF E SK  SE+WK +S KEK K++ LA+ADK RY +EM+ + P            ++ KDPN PK P + FF F +E R  +K  NP   +GD+AK LG+MW+   D  K    NK A  KEKY
Sbjct:   14 SAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVK--------KGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKY 153          
BLAST of high mobility group-2 vs. Ensembl Xenopus
Match: abcb6 (ATP binding cassette subfamily B member 6 (Langereis blood group) [Source:Xenbase;Acc:XB-GENE-1001119])

HSP 1 Score: 54.6842 bits (130), Expect = 2.960e-8
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  286 SKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSE--CKDKSKYEEMNKEAKEKYNLAMLEYKN 528
             +K KR  +D N PKAPLT +  F NE R+ ++ + P+    +I +++G  WS+    +K  Y +  ++ KE+Y   + +Y+N
Sbjct:   88 GRKRKRSPRDNNAPKAPLTGYVRFMNERREQLRTERPDVPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQN 170          

HSP 2 Score: 50.447 bits (119), Expect = 7.028e-7
Identity = 25/75 (33.33%), Postives = 42/75 (56.00%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYE 261
            +N  P    + Y+ +    RE+ + + PD  V F EI++I   +W  +   EK+ Y   A+ DK+RYTKE++ Y+
Sbjct:   97 DNNAPKAPLTGYVRFMNERREQLRTERPD--VPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQ 169          
BLAST of high mobility group-2 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 132.109 bits (331), Expect = 7.864e-38
Identity = 78/172 (45.35%), Postives = 107/172 (62.21%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:   21 KKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 186          
BLAST of high mobility group-2 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 132.109 bits (331), Expect = 8.488e-38
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 132.109 bits (331), Expect = 8.488e-38
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 132.109 bits (331), Expect = 8.488e-38
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 130.568 bits (327), Expect = 9.518e-38
Identity = 65/134 (48.51%), Postives = 90/134 (67.16%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS 444
            KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW+
Sbjct:    7 KKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWN 134          
BLAST of high mobility group-2 vs. UniProt/SwissProt
Match: sp|P26584|HMGB2_CHICK (High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.404e-39
Identity = 75/162 (46.30%), Postives = 99/162 (61.11%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSE--CKDKSKYEEMNKEAKEKYNLAMLEYK 525
            KP G  S+Y  + Q  REE+KKK+PD  VNF E S+  SE+WK +S KEK K+  +A+ DK RY +EM+ Y P      P  + K + KDPN PK P +AFF F +EHR  +K  +P   +GD AK LG+MWSE   KDK  YE+   + KEKY   +  Y+
Sbjct:    8 KPRGKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSRKCSERWKTMSSKEKGKFEEMAKGDKARYDREMKNYVP------PKGEKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKNDHPGLSIGDTAKKLGEMWSEQLAKDKQPYEQKAAKLKEKYEKDIAAYR 163          
BLAST of high mobility group-2 vs. UniProt/SwissProt
Match: sp|Q24537|HMG2_DROME (High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 6.155e-39
Identity = 75/165 (45.45%), Postives = 103/165 (62.42%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KP G  +AY  + Q  REE+KKK+PD  V F E S+  +E+WK + DKEK++++ +A+ DK+RY  EM+ Y P         K +++ KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+   + K KYE M +  K +Y   M EYK 
Sbjct:  176 DAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKT 340          
BLAST of high mobility group-2 vs. UniProt/SwissProt
Match: sp|P63159|HMGB1_RAT (High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 5.938e-37
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. UniProt/SwissProt
Match: sp|B1MTB0|HMGB1_PLEMO (High mobility group protein B1 OS=Plecturocebus moloch OX=9523 GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 5.938e-37
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. UniProt/SwissProt
Match: sp|A9RA84|HMGB1_PAPAN (High mobility group protein B1 OS=Papio anubis OX=9555 GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 5.938e-37
Identity = 78/174 (44.83%), Postives = 108/174 (62.07%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK-NGVPSAKK 549
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ADK RY +EM+ Y P      P  + K++ KDPN PK P +AFF F +E+R  +K ++P   +GD+AK LG+MW  +   DK  YE+   + KEKY   +  Y+  G P A K
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP------PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAK 172          
BLAST of high mobility group-2 vs. TrEMBL
Match: I1ZIA1 (High mobility group-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 5.615e-122
Identity = 176/177 (99.44%), Postives = 176/177 (99.44%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSKAHV 564
            MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNG PSAKKSKAHV
Sbjct:    1 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGAPSAKKSKAHV 177          
BLAST of high mobility group-2 vs. TrEMBL
Match: I1ZIJ2 (High mobility group-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.939e-60
Identity = 100/175 (57.14%), Postives = 128/175 (73.14%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSKA 558
            M +KKP GAK+ Y  + Q VREE+KKK+PD ++ F+E SK  SEKWK +S KEK+++  +A  DK+RY KEM+ Y+P         K KR+ KDPNKPK   TAFFFFS+EHR+ +KE+NPE+KVGD+AKVLGKMW  CKDKSKYEE  K  KE+YN  + EYK+G P +KK+K 
Sbjct:    1 MVDKKPKGAKTPYACFVQVVREEHKKKHPDEQIVFSEFSKRCSEKWKEMSPKEKQRFMDIAAKDKERYLKEMDNYQPPAGT-----KNKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKG 170          
BLAST of high mobility group-2 vs. TrEMBL
Match: A0A5J4NYU2 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014045 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.115e-42
Identity = 73/171 (42.69%), Postives = 114/171 (66.67%), Query Frame = 1
Query:   22 VTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGV 534
            ++++ +  KP GA SAY  + Q +REE+KKK+P  ++ F++ SK  +E+WK ++ KEK+++  LA  DK+R+ +EM  Y P    +K   K ++  +DP  P+   +AFFFF +EHR  VKE NPE+KV D+AK LG+MW  C+DK+KYE + ++ K++Y   M +Y  GV
Sbjct:    1 MSRTKDKNKPKGAMSAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTSKEKKRFEDLAALDKERFNREMSEYVPPEGMKK--GKKRKVPRDPGLPRRAWSAFFFFCDEHRGKVKENNPEYKVADVAKELGRMWETCQDKAKYELLAQQDKQRYEEDMAKYHAGV 169          
BLAST of high mobility group-2 vs. TrEMBL
Match: A0A2J7PFM2 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G15567 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.043e-42
Identity = 83/175 (47.43%), Postives = 111/175 (63.43%), Query Frame = 1
Query:   40 NKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKD--KSKYEEMNKEAKEKYNLAMLEY----KNGVPSAK 546
            + KP G  +AY  + Q  REE+KKK+PD  V F E SK  +E+WK + DKEK++++ +A+ DKKRY  EMEGY P    +   KK ++  KDPN PK  L+AFF+F N+ R  VK  NPEF VGDIAK LG+ WS+     KSKYE M ++ K +Y+  M  Y    K G+P A+
Sbjct:    7 DAKPRGRMTAYAFFVQTCREEHKKKHPDENVIFAEFSKKCAERWKTMLDKEKKRFHEMAEKDKKRYDSEMEGYTPAKGEKARGKK-RKHVKDPNAPKRSLSAFFWFCNDERSKVKALNPEFGVGDIAKELGRRWSDVDPELKSKYEAMAEKDKARYDREMTAYKKRPKGGMPVAQ 180          
BLAST of high mobility group-2 vs. TrEMBL
Match: A0A4S2M7M8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002095 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 8.882e-42
Identity = 72/163 (44.17%), Postives = 110/163 (67.48%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGV 534
            +P GA SAY  + Q +REE+KKK+P  ++ F++ SK  +E+WK ++ KEK+++  LA  DK+R+ +EM  Y P    +K   K ++  +DP  P+   +AFFFF +EHR  VKE NPEFKV D+AK LG+ W  C+DK+KYE + ++ K++Y   M++Y+ GV
Sbjct:    9 RPKGAMSAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTPKEKKRFEDLAALDKERFNREMSDYVPPEGMKK--GKKRKVPRDPGLPRRAWSAFFFFCDEHRGKVKENNPEFKVADVAKELGRQWEACQDKAKYELLAQQDKQRYEEDMVKYRAGV 169          
BLAST of high mobility group-2 vs. Ensembl Cavefish
Match: hmgb2a (high mobility group box 2 [Source:NCBI gene;Acc:111195933])

HSP 1 Score: 130.568 bits (327), Expect = 1.953e-37
Identity = 79/175 (45.14%), Postives = 106/175 (60.57%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSE--CKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSKAHV 564
            KP G  S+Y  + Q  REE+KKK+P   VNF E SK  +E+WK +S KEK K+  LA+ DK RY +EM+ Y P         K  ++ KDPN PK P +AFF F ++HR  VK ++P   +GDIAK LG+MWS+   KDK+ YE+   + KEKY   +  Y+     AK +KA V
Sbjct:    7 KPRGKTSSYAFFVQTCREEHKKKHPGTSVNFAEFSKKCAERWKTMSPKEKTKFEDLAKNDKVRYDREMKTYIPPK-----GAKKGKKKKDPNAPKRPPSAFFVFCSDHRPKVKSEHPGISIGDIAKKLGEMWSKQSPKDKAPYEQKAMKLKEKYEKDVAAYR-----AKGAKADV 171          
BLAST of high mobility group-2 vs. Ensembl Cavefish
Match: hmgb1a (high mobility group-T protein-like [Source:NCBI gene;Acc:103039534])

HSP 1 Score: 128.642 bits (322), Expect = 8.546e-37
Identity = 74/164 (45.12%), Postives = 101/164 (61.59%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYKNG 531
            KP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ DK RY +EM+ Y P      P  + K+  KDPN PK P +AFF F  E+R  VKE+ P   +GD+AK LG+MW  +  ++K  YE+   + KEKY   +  Y+ G
Sbjct:    7 KPRGKMSSYAYFVQTCREEHKKKHPDTSVNFSEFSKKCSERWKTMSAKEKGKFEEMARLDKARYEREMKNYVP------PRGEKKKRFKDPNAPKRPPSAFFIFCAEYRPKVKEETPGLSIGDVAKKLGEMWNKTSAEEKQPYEKKAAKLKEKYEKDIAAYRKG 164          
BLAST of high mobility group-2 vs. Ensembl Cavefish
Match: ENSAMXT00000044228.1 (high mobility group protein B2-like [Source:NCBI gene;Acc:103034313])

HSP 1 Score: 127.102 bits (318), Expect = 4.453e-36
Identity = 73/171 (42.69%), Postives = 103/171 (60.23%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKS 552
            KP G  SAY  +  + R+E KKK+P   VNF + SK  SE WK ++  EK+K+  LA+ADK RY +EM+ Y P     K   K  R+ KDPN PK P +AFF F +EHR  VK ++P   +G+IAK LG+ WS+   KD+S +++     +EKY   +  Y++G   AK+ 
Sbjct:    7 KPKGRTSAYAFFVLSSRDELKKKSPGTSVNFGKFSKKCSEDWKALTPSEKKKFEDLAKADKARYDEEMKSYVPP----KGMGKMGRKKKDPNAPKRPPSAFFIFCSEHRPAVKSEHPNLTIGEIAKKLGEKWSKLSTKDRSPFDQKAVLLREKYEKEVAAYRSGGSVAKRG 173          
BLAST of high mobility group-2 vs. Ensembl Cavefish
Match: hmgb1b (high mobility group protein B1-like [Source:NCBI gene;Acc:103041093])

HSP 1 Score: 125.561 bits (314), Expect = 1.323e-35
Identity = 63/134 (47.01%), Postives = 87/134 (64.93%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS 444
            +KP G  S+Y  + Q  REE+KKK+P+  VNF+E SK  SE+WK +S KEK K+  +A+ DK RY +EM+ Y P      P  + K+  KDPN PK P +AFF F  ++R  +K +NP   +GDIAK LG+MW+
Sbjct:    6 RKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSPKEKSKFEDMAKQDKVRYEREMKNYIP------PKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLSIGDIAKKLGEMWN 133          
BLAST of high mobility group-2 vs. Ensembl Cavefish
Match: hmgb3a (high mobility group protein B3 [Source:NCBI gene;Acc:103036962])

HSP 1 Score: 114.775 bits (286), Expect = 2.523e-31
Identity = 65/164 (39.63%), Postives = 95/164 (57.93%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK--YEEMNKEAKEKYNLAMLEYKN 528
            +KP G  SAY  + Q  REE+K K+P+  VNF E SK  S +WK +S KEK ++  +A+ DK RY +EM  Y          K+ K+  KDPN PK P + FF F ++HR  +K + P   +G++AK LG+MW+   D  K  Y   + + K+KY   + +YK+
Sbjct:    7 RKPKGKMSAYAYFVQTCREEHKLKSPEIPVNFAEFSKKCSVRWKAMSGKEKTRFEDMAKQDKVRYDQEMMHYT--------GKRGKK--KDPNAPKRPPSGFFIFCSDHRPKIKAQYPHMGIGEVAKKLGEMWNNLTDAHKQPYVMKSNKLKDKYQQDIADYKS 160          
BLAST of high mobility group-2 vs. Ensembl Sea Lamprey
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 129.798 bits (325), Expect = 8.629e-38
Identity = 69/157 (43.95%), Postives = 96/157 (61.15%), Query Frame = 1
Query:   64 SAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYKN 528
            S+Y  + Q  REE+KKKNP+  VNF E SK  SE+WK +S+KEK ++  +A+ DK RY +EM+ Y P    R       R+ KDPN PK P +AFF +  E+R  V+ +NP   +G IAK LG+MW  +   +KS YE    + KEKY+  M  Y++
Sbjct:   14 SSYAYFVQTCREEHKKKNPEASVNFAEFSKKCSERWKTMSEKEKTRFEDMAKVDKVRYDREMKTYVPPKGER-----GSRKKKDPNAPKRPPSAFFIYCAEYRSKVRAENPGLTIGSIAKKLGEMWNNAPADEKSIYERKTAKLKEKYDKDMASYRS 165          
BLAST of high mobility group-2 vs. Ensembl Sea Lamprey
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 128.642 bits (322), Expect = 1.345e-37
Identity = 64/133 (48.12%), Postives = 85/133 (63.91%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS 444
            KP G  S+Y  + Q  REE+KKK+P+  VNF E SK  SE+WK +S KEK ++  +A+ADK R+ +EM+ Y P         K KR+ KDPN PK P +AFF F +EHR  VK  +P   +G+IAK LG+MW 
Sbjct:    8 KPRGKMSSYAYFVQTCREEHKKKHPEASVNFAEFSKKCSERWKTMSPKEKARFEEMAKADKARFDREMKNYVPP--------KGKRKTKDPNAPKRPPSAFFVFCSEHRPKVKADHPGLGIGEIAKRLGEMWG 132          
BLAST of high mobility group-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005794.1 (pep scaffold:Pmarinus_7.0:GL478246:10745:21158:-1 gene:ENSPMAG00000005214.1 transcript:ENSPMAT00000005794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.613e-7
Identity = 33/121 (27.27%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  130 VNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGY-EPETDNRKPSKKAKREAKDPNK----------------PKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW 441
            V  TE     S +WK +S KEK+ Y+   +  KK+Y  + + + E  TD  +   + +  AK+  K                P+ P++A F FS E R+ +++KNP+    ++ ++L ++W
Sbjct:  318 VPSTERMHECSRQWKVLSPKEKDAYHKRCEQKKKQYEIDFQKFVENLTDEERERIQMEERAKEGGKMASLATAAALESAVDRPQRPISAMFIFSQEKRKKLRKKNPDLPESELTRLLARLW 438          

HSP 2 Score: 47.3654 bits (111), Expect = 1.169e-6
Identity = 42/165 (25.45%), Postives = 82/165 (49.70%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNK--EAKEKYNLAMLEYKNGVP 537
            P    + Y  +  A R +Y K +PD  +   +++KI S K+K +++K+K KY    Q DK+ + K M  +  +  +    + A R++  P KPK P   ++   +  ++   + +PE  + ++ + L + WS   DK + + + K  E + ++ L + EY    P
Sbjct:  113 PKKPLTPYFRFFMAKRAKYAKMHPD--LTNLDLTKILSTKYKEMTEKKKLKYMEDYQRDKEEFDKAMAKFREQHPDL--VEVAVRKSDVPEKPKTPQQLWY---HHEKKAYMKLHPEMNLKEVNETLRRQWSVLPDKKRLKWIAKALELQRQHALELKEYICTHP 270          
BLAST of high mobility group-2 vs. Ensembl Sea Lamprey
Match: smarce1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-967])

HSP 1 Score: 44.2838 bits (103), Expect = 9.640e-6
Identity = 25/73 (34.25%), Postives = 37/73 (50.68%), Query Frame = 1
Query:  310 KDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEK--YNLAMLEY 522
            K P  P  PL  +  +S +    VK  NP+ K+ +I K++G MW +  ++ K E +N    EK  YN  M  Y
Sbjct:   65 KAPKAPDKPLMPYMRYSRKVWDQVKAANPDLKLWEIGKIIGSMWRDLSEEDKQEYLNDYEAEKIEYNDLMKAY 137          
BLAST of high mobility group-2 vs. Ensembl Yeast
Match: NHP6B (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6B has a paralog, NHP6A, that arose from the whole genome duplication [Source:SGD;Acc:S000002157])

HSP 1 Score: 61.2326 bits (147), Expect = 5.946e-13
Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  283 PSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS--ECKDKSKYEEMNKEAKEKY 501
            P K+  R  KDPN PK  L+A+ FF+NE+R  V+ +NP+   G + ++LG+ W     ++K  YE   +  K++Y
Sbjct:   13 PKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRY 87          

HSP 2 Score: 53.5286 bits (127), Expect = 3.541e-10
Identity = 28/70 (40.00%), Postives = 41/70 (58.57%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGY 258
            P    SAY+ +    R+  + +NPD  V F ++ +I  E+WK ++ +EK+ Y   AQADKKRY  E E Y
Sbjct:   27 PKRGLSAYMFFANENRDIVRSENPD--VTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELY 94          
BLAST of high mobility group-2 vs. Ensembl Yeast
Match: ABF2 (Mitochondrial DNA-binding protein; involved in mitochondrial DNA replication and recombination, member of HMG1 DNA-binding protein family; activity may be regulated by protein kinase A phosphorylation; ABF2 has a paralog, IXR1, that arose from the whole genome duplication; human homolog TFAM can complement yeast abf2 mutant, rescuing the loss-of-mitochondrial DNA phenotype in a yeast abf2 strain [Source:SGD;Acc:S000004676])

HSP 1 Score: 62.7734 bits (151), Expect = 9.770e-13
Identity = 50/154 (32.47%), Postives = 76/154 (49.35%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKD--KSKYEEMNKEAKEKYN 504
            P    SAY +Y Q  R ++ K+NP  +    EISKIA EKW+N+    KEKY     +++K+   E +             KAK+E  +   PK P   F  ++NE R  V  ++P+    D+ K++G  W       K KY +  K+A ++YN
Sbjct:   43 PKRPTSAYFLYLQDHRSQFVKENPTLRP--AEISKIAGEKWQNLEADIKEKYI----SERKKLYSEYQ-------------KAKKEFDEKLPPKKPAGPFIKYANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEYN 177          
BLAST of high mobility group-2 vs. Ensembl Yeast
Match: IXR1 (Transcriptional repressor that regulates hypoxic genes during normoxia; involved in the aerobic repression of genes such as COX5b, TIR1, and HEM13; binds DNA intrastrand cross-links formed by cisplatin; HMG (high mobility group box) domain containing protein which binds and bends cisplatin-modified DNA, blocking excision repair; IXR1 has a paralog, ABF2, that arose from the whole genome duplication [Source:SGD;Acc:S000001515])

HSP 1 Score: 60.4622 bits (145), Expect = 3.294e-11
Identity = 41/143 (28.67%), Postives = 74/143 (51.75%), Query Frame = 1
Query:   43 KKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYE 471
            K+PS   SAY +++ ++R E  ++ P+ KV   E+SK+AS +WK ++D +K+ +    + + ++Y    + YE              +   P +P  P   F  F+ E R TV ++NP+  + +I K++G+ W E     K E
Sbjct:  362 KRPS---SAYFLFSMSIRNELLQQFPEAKV--PELSKLASARWKELTDDQKKPFYEEFRTNWEKYRVVRDAYE--------------KTLPPKRPSGP---FIQFTQEIRPTVVKENPDKGLIEITKIIGERWRELDPAKKAE 482          
BLAST of high mobility group-2 vs. Ensembl Yeast
Match: NHP6A (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to chromosomes; functionally redundant with Nhp6Bp; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6A has a paralog, NHP6B, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006256])

HSP 1 Score: 54.299 bits (129), Expect = 1.556e-10
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 1
Query:  277 RKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKY 501
            R+P K+  R+ KDPN PK  L+A+ FF+NE+R  V+ +NP+   G + K LG+ W     ++K  YE   +  K++Y
Sbjct:    5 REPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRY 81          

HSP 2 Score: 53.1434 bits (126), Expect = 5.232e-10
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGY 258
            P  A SAY+ +    R+  + +NPD  + F ++ K   EKWK ++ +EK+ Y   AQADKKRY  E E Y
Sbjct:   21 PKRALSAYMFFANENRDIVRSENPD--ITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELY 88          
BLAST of high mobility group-2 vs. Ensembl Nematostella
Match: EDO36028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW6])

HSP 1 Score: 119.013 bits (297), Expect = 1.055e-33
Identity = 73/173 (42.20%), Postives = 111/173 (64.16%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSKA 558
            KP GAKSAY  + Q  RE+ +++  +GK +  + SK+++EKWKN+S++EKE +   A  DK+R+ +EM+ Y P        KK K++ KDPNKPK  L+A+F F N  R  VK+ NP    G ++KVLG+MWS+    DK++Y++M K+ K +Y   M  +K+G   AK++K 
Sbjct:    2 KPKGAKSAYNFFLQDQREKLQRE--EGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSYTPPPSEESGKKKRKKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRYESEMKAFKDGKLPAKQNKT 172          
BLAST of high mobility group-2 vs. Ensembl Nematostella
Match: EDO39305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG5])

HSP 1 Score: 58.9214 bits (141), Expect = 5.684e-12
Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  325 PKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEY 522
            PK  ++A+  + N+ RQ +K+KNP   V +++KV G+MW    DKSK+EE     K+KY   M EY
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEKQKYVQRMKEY 66          

HSP 2 Score: 51.9878 bits (123), Expect = 2.000e-9
Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGY 258
            P  A SAY+++    R+E K KNP   ++ TE+SK+A E WKN++D  K K+   A  +K++Y + M+ Y
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPG--ISVTEVSKVAGEMWKNLTD--KSKWEEKAAIEKQKYVQRMKEY 66          
BLAST of high mobility group-2 vs. Ensembl Nematostella
Match: EDO41032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L8])

HSP 1 Score: 61.6178 bits (148), Expect = 1.852e-11
Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  286 SKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYK 525
             +K K+  KD N PKAPLT +  F NEHR+ V+ +NP+    ++ ++LG MWS+     K  + E  ++ KE+Y   + EY+
Sbjct:    2 GRKRKKAHKDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERYMKELEEYQ 83          
BLAST of high mobility group-2 vs. Ensembl Nematostella
Match: EDO47230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY4])

HSP 1 Score: 57.3806 bits (137), Expect = 5.524e-10
Identity = 28/82 (34.15%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  286 SKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECK--DKSKYEEMNKEAKEKYNLAMLEYK 525
             K+ ++  +D N PKAPLT +  F NE R+ V+ ++PE    ++ K+LG  WS+    DK +Y +  +  KE+Y + +  Y+
Sbjct:    8 GKRRRKTLRDTNAPKAPLTGYVQFLNEQREKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERYIIELENYQ 89          
BLAST of high mobility group-2 vs. Ensembl Nematostella
Match: EDO40495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S799])

HSP 1 Score: 48.521 bits (114), Expect = 5.520e-7
Identity = 33/88 (37.50%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  310 KDPNKPKAPLTAFFFFSNEHRQTVKE--KNPEFKVG--DIAKVLGKMWSEC--KDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSK 555
            KDPN PK P  AFF F  + R  ++E  K+    +G  ++ K L K W+     +K  Y EM +  KE+Y L M +Y +  P +KK K
Sbjct:  109 KDPNAPKKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNLLPDEKKVYYEMYERDKERYELEMKQYSSDKPPSKKQK 196          
BLAST of high mobility group-2 vs. Ensembl Medaka
Match: hmgb2a (high mobility group protein B2 [Source:NCBI gene;Acc:101157589])

HSP 1 Score: 133.265 bits (334), Expect = 1.891e-38
Identity = 77/170 (45.29%), Postives = 102/170 (60.00%), Query Frame = 1
Query:   22 VTKSMNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWS--ECKDKSKYEEMNKEAKEKYNLAMLEYK 525
            +TK  N  KP G  SAY  +    REE+KKK+P   VNF E SK  SE+WK +S KEK K++ LA+ DK RY +EM+ Y P         K  ++ KDPN PK P +AFF F ++HR  +KE NP   +GDIAK LG++W+    KDK+ YE    + KEKY   +  Y+
Sbjct:    1 MTKDPN--KPRGKTSAYAYFVATCREEHKKKHPGTSVNFAEFSKKCSERWKTMSSKEKVKFDELAKTDKARYDREMKTYVPPK-----GAKKVKKKKDPNAPKRPPSAFFVFCSDHRPKIKEDNPGISIGDIAKKLGELWATQSAKDKAPYEAKAAKLKEKYEKDVAAYR 163          
BLAST of high mobility group-2 vs. Ensembl Medaka
Match: hmgb1b (high mobility group protein B1 [Source:NCBI gene;Acc:101156596])

HSP 1 Score: 125.561 bits (314), Expect = 1.025e-35
Identity = 72/166 (43.37%), Postives = 102/166 (61.45%), Query Frame = 1
Query:   37 NNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYKN 528
            + KKP G  S+Y  + Q  REE+KKK+PD  VNF+E SK  SE+WK +S KEK K+  +A+ DK RY +EM+ Y P      P  + K+  KDPN PK P +AFF F  + R  +K ++P   +GD AK LG+MW  S  ++K  YE+   + KEKY+  ++ Y+ 
Sbjct:    4 DPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFEDMAKQDKVRYEREMKNYVP------PKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLSIGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRT 163          
BLAST of high mobility group-2 vs. Ensembl Medaka
Match: hmgb1a (high mobility group-T protein [Source:NCBI gene;Acc:101165167])

HSP 1 Score: 124.02 bits (310), Expect = 7.030e-35
Identity = 74/163 (45.40%), Postives = 100/163 (61.35%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAK-REAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMW--SECKDKSKYEEMNKEAKEKYNLAMLEYK 525
            KP G  S+Y  + Q  REE+KKK+PD  VNF E SK  SE+WK +S KEK K+  +A+ DK RY +EM  Y        P+K AK ++ KDPN PK P +AFF F +E R  VK ++P   +GD+AK LG+MW  +  +DK  YE+   + KEKY   +  Y+
Sbjct:    7 KPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKFEDMARQDKVRYDREMMSYV-------PAKGAKTKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLTIGDVAKRLGEMWNSTSAEDKQPYEKKAAKLKEKYGKDIAAYR 162          
BLAST of high mobility group-2 vs. Ensembl Medaka
Match: ubtf (upstream binding transcription factor [Source:NCBI gene;Acc:101156013])

HSP 1 Score: 57.3806 bits (137), Expect = 3.149e-9
Identity = 39/139 (28.06%), Postives = 63/139 (45.32%), Query Frame = 1
Query:  130 VNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGY---------------------------EPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK 465
            V  TE   + S++WK +   EK+ Y    +  KK Y  EM  +                            P T  +KP+ KAK    +P KPK P++A F F+ E RQ ++++ P+    ++ + L +MW++  DK K
Sbjct:  313 VPSTERMMMCSQRWKLLKQHEKDAYQKRCEQRKKEYEIEMNRFLSSLSEEEQRRVLGEDKGGFKRGGRANSPAT--KKPASKAK---ANPEKPKRPISAMFIFAEEKRQKLQQERPDLSDSEVTRCLARMWNDLPDKKK 446          
BLAST of high mobility group-2 vs. Ensembl Medaka
Match: ubtf (upstream binding transcription factor [Source:NCBI gene;Acc:101156013])

HSP 1 Score: 54.299 bits (129), Expect = 2.676e-8
Identity = 34/128 (26.56%), Postives = 64/128 (50.00%), Query Frame = 1
Query:  130 VNFTEISKIASEKWKNISDKEKEKY-----NVL----------AQADKKRYTKEMEG-YEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSK 465
            V  TE   + S++WK +   EK+ Y     N+L          ++ +++R   E +G ++       P+ K      +P KPK P++A F F+ E RQ ++++ P+    ++ + L +MW++  DK K
Sbjct:  317 VPSTERMMMCSQRWKLLKQHEKDAYQKRCENILYLPFGPLQSLSEEEQRRVLGEDKGGFKRGGRANSPATKKPASKANPEKPKRPISAMFIFAEEKRQKLQQERPDLSDSEVTRCLARMWNDLPDKKK 444          

HSP 2 Score: 46.9802 bits (110), Expect = 8.457e-6
Identity = 41/166 (24.70%), Postives = 82/166 (49.40%), Query Frame = 1
Query:   49 PSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNK--EAKEKYNLAMLEYKNGVPS 540
            P    + Y  +    R +Y K +P+  ++  +++KI S+K++ + DK+K+KY      DK+ +   M  +  E  +   +   K+ +  P KPK P   ++   N  ++   + +P+    DI   LGK W++  DK + + ++K  E ++ Y + +L   N  P+
Sbjct:  112 PKKPLTPYFRFFMEKRAKYAKLHPE--MSNLDLTKILSKKYRELPDKKKKKYVEDFLRDKETFVHSMSKFREEHPDLVETI-TKKGSNVPEKPKTPQQLWY---NHEKKAFLKTHPDATTKDIKDSLGKQWTQLPDKKRLKWISKSLEQQKAYEVRVLVVLNHSPA 271          
BLAST of high mobility group-2 vs. Planmine SMEST
Match: SMESG000020771.1 (SMESG000020771.1)

HSP 1 Score: 353.599 bits (906), Expect = 1.562e-125
Identity = 176/177 (99.44%), Postives = 176/177 (99.44%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSKAHV 564
            MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNG PSAKKSKAHV
Sbjct:    1 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGAPSAKKSKAHV 177          
BLAST of high mobility group-2 vs. Planmine SMEST
Match: SMESG000068286.1 (SMESG000068286.1)

HSP 1 Score: 197.208 bits (500), Expect = 8.174e-64
Identity = 100/175 (57.14%), Postives = 128/175 (73.14%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGVPSAKKSKA 558
            M +KKP GAK+ Y  + Q VREE+KKK+PD ++ F+E SK  SEKWK +S KEK+++  +A  DK+RY KEM+ Y+P         K KR+ KDPNKPK   TAFFFFS+EHR+ +KE+NPE+KVGD+AKVLGKMW  CKDKSKYEE  K  KE+YN  + EYK+G P +KK+K 
Sbjct:    1 MVDKKPKGAKTPYACFVQVVREEHKKKHPDEQIVFSEFSKRCSEKWKEMSPKEKQRFMDIAAKDKERYLKEMDNYQPPAGT-----KNKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKG 170          

HSP 2 Score: 45.4394 bits (106), Expect = 8.133e-6
Identity = 30/84 (35.71%), Postives = 50/84 (59.52%), Query Frame = 1
Query:   46 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKA 297
            KP GA +A+  ++   R++ K++NP+ KV   +++K+  + W+   DK K  Y   A+ DK+RY KE+E Y+  T   K +K A
Sbjct:   92 KPKGAWTAFFFFSDEHRKKIKEENPEYKVG--DVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEYKSGTPVSKKTKGA 171          
BLAST of high mobility group-2 vs. Planmine SMEST
Match: SMESG000012056.1 (SMESG000012056.1)

HSP 1 Score: 171.014 bits (432), Expect = 1.148e-53
Identity = 92/159 (57.86%), Postives = 113/159 (71.07%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEP---ETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKY 501
            M NKKP+G+KSAY  + ++  E+YK +NPD K+N  EISK+ S+KWKN+S+ EK ++  LA  DKKRY  EME YEP   +    K  KK KR AKDPNKPK P+TAF FFSNE R +VKE NPEFK+GDIAK LG+ W EC +K KYE + K AK  Y
Sbjct:    1 MTNKKPTGSKSAYNCFMKSFIEKYKTENPDIKMNLGEISKLVSKKWKNLSEFEKNEFIELAAIDKKRYVDEMESYEPSEKDITKLKNKKKEKRAAKDPNKPKRPMTAFLFFSNEFRLSVKESNPEFKIGDIAKELGRKWKECIEKDKYENLAKSAKANY 159          
BLAST of high mobility group-2 vs. Planmine SMEST
Match: SMESG000012070.1 (SMESG000012070.1)

HSP 1 Score: 160.614 bits (405), Expect = 2.206e-49
Identity = 90/169 (53.25%), Postives = 121/169 (71.60%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE------TDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEY 522
            M NKKPSG+KSAYI + Q+ RE+YK +NP+ K NF  ISK+ +E+WK +S+ +K+++N +A  DKKRY +EM  YEP+        ++K +K+AKR  +DPNKPK  ++AF  FSN+ R +VKE NPEFK+GD+AK LGKMW +  +K KYE M K AKEKY   M EY
Sbjct:    1 MTNKKPSGSKSAYICFQQSFREKYKTENPEIKPNFINISKLGAEEWKKLSESDKKEFNEMATIDKKRYAEEMANYEPDEKDVKDIKDKKKAKRAKRAKRDPNKPKRFMSAFILFSNDFRLSVKESNPEFKIGDVAKELGKMWKDYSEKDKYENMAKSAKEKYENEMREY 169          
BLAST of high mobility group-2 vs. Planmine SMEST
Match: SMESG000012065.1 (SMESG000012065.1)

HSP 1 Score: 160.614 bits (405), Expect = 2.206e-49
Identity = 90/169 (53.25%), Postives = 121/169 (71.60%), Query Frame = 1
Query:   34 MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPE------TDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEY 522
            M NKKPSG+KSAYI + Q+ RE+YK +NP+ K NF  ISK+ +E+WK +S+ +K+++N +A  DKKRY +EM  YEP+        ++K +K+AKR  +DPNKPK  ++AF  FSN+ R +VKE NPEFK+GD+AK LGKMW +  +K KYE M K AKEKY   M EY
Sbjct:    1 MTNKKPSGSKSAYICFQQSFREKYKTENPEIKPNFINISKLGAEEWKKLSESDKKEFNEMATIDKKRYAEEMANYEPDEKDVKDIKDKKKAKRAKRAKRDPNKPKRFMSAFILFSNDFRLSVKESNPEFKIGDVAKELGKMWKDYSEKDKYENMAKSAKEKYENEMREY 169          
The following BLAST results are available for this feature:
BLAST of high mobility group-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMGB18.162e-3848.51high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB18.162e-3848.51high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB11.236e-3744.83high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB11.236e-3744.83high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB11.236e-3744.83high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmg-1.21.586e-3039.31High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.586e-3039.31High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.29.780e-2938.86High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.055e-2838.86High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.055e-2838.86High mobility group protein 1.2 [Source:UniProtKB... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsp15.565e-4045.45gene:FBgn0278608 transcript:FBtr0089259[more]
Dsp15.565e-4045.45gene:FBgn0278608 transcript:FBtr0089260[more]
Dsp15.565e-4045.45gene:FBgn0278608 transcript:FBtr0089261[more]
Dsp15.672e-4045.45gene:FBgn0278608 transcript:FBtr0089262[more]
Dsp15.672e-4045.45gene:FBgn0278608 transcript:FBtr0339766[more]
back to top
BLAST of high mobility group-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2a2.113e-3945.93high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b6.444e-3942.11high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b6.444e-3942.11high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2a8.290e-3948.05high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb3b1.135e-3545.00high mobility group box 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb23.881e-3846.91high mobility group box 2 [Source:NCBI gene;Acc:39... [more]
cep170b4.837e-3845.45centrosomal protein 170B [Source:Xenbase;Acc:XB-GE... [more]
hmgb31.353e-3445.22high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
hmgb37.371e-3446.62high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
abcb62.960e-832.53ATP binding cassette subfamily B member 6 (Langere... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmgb17.864e-3845.35high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb18.488e-3844.83high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb18.488e-3844.83high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb18.488e-3844.83high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb19.518e-3848.51high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of high mobility group-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26584|HMGB2_CHICK1.404e-3946.30High mobility group protein B2 OS=Gallus gallus OX... [more]
sp|Q24537|HMG2_DROME6.155e-3945.45High mobility group protein DSP1 OS=Drosophila mel... [more]
sp|P63159|HMGB1_RAT5.938e-3744.83High mobility group protein B1 OS=Rattus norvegicu... [more]
sp|B1MTB0|HMGB1_PLEMO5.938e-3744.83High mobility group protein B1 OS=Plecturocebus mo... [more]
sp|A9RA84|HMGB1_PAPAN5.938e-3744.83High mobility group protein B1 OS=Papio anubis OX=... [more]
back to top
BLAST of high mobility group-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIA15.615e-12299.44High mobility group-2 OS=Schmidtea mediterranea OX... [more]
I1ZIJ22.939e-6057.14High mobility group-1 OS=Schmidtea mediterranea OX... [more]
A0A5J4NYU23.115e-4242.69Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A2J7PFM24.043e-4247.43Uncharacterized protein OS=Cryptotermes secundus O... [more]
A0A4S2M7M88.882e-4244.17Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2a1.953e-3745.14high mobility group box 2 [Source:NCBI gene;Acc:11... [more]
hmgb1a8.546e-3745.12high mobility group-T protein-like [Source:NCBI ge... [more]
ENSAMXT00000044228.14.453e-3642.69high mobility group protein B2-like [Source:NCBI g... [more]
hmgb1b1.323e-3547.01high mobility group protein B1-like [Source:NCBI g... [more]
hmgb3a2.523e-3139.63high mobility group protein B3 [Source:NCBI gene;A... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hmgb2b8.629e-3843.95high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2a1.345e-3748.12high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000005794.11.613e-727.27pep scaffold:Pmarinus_7.0:GL478246:10745:21158:-1 ... [more]
smarce19.640e-634.25SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
NHP6B5.946e-1337.33High-mobility group (HMG) protein; binds to and re... [more]
ABF29.770e-1332.47Mitochondrial DNA-binding protein; involved in mit... [more]
IXR13.294e-1128.67Transcriptional repressor that regulates hypoxic g... [more]
NHP6A1.556e-1038.96High-mobility group (HMG) protein; binds to and re... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360281.055e-3342.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393055.684e-1242.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410321.852e-1137.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472305.524e-1034.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404955.520e-737.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of high mobility group-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2a1.891e-3845.29high mobility group protein B2 [Source:NCBI gene;A... [more]
hmgb1b1.025e-3543.37high mobility group protein B1 [Source:NCBI gene;A... [more]
hmgb1a7.030e-3545.40high mobility group-T protein [Source:NCBI gene;Ac... [more]
ubtf3.149e-928.06upstream binding transcription factor [Source:NCBI... [more]
ubtf2.676e-826.56upstream binding transcription factor [Source:NCBI... [more]
back to top
BLAST of high mobility group-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020771.11.562e-12599.44SMESG000020771.1[more]
SMESG000068286.18.174e-6457.14SMESG000068286.1[more]
SMESG000012056.11.148e-5357.86SMESG000012056.1[more]
SMESG000012070.12.206e-4953.25SMESG000012070.1[more]
SMESG000012065.12.206e-4953.25SMESG000012065.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027770
GenBankAFJ24755.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027770 ID=SMED30027770|Name=high mobility group-2|organism=Schmidtea mediterranea sexual|type=transcript|length=686bp
AATTTTTAAGGTTATAATTTAGTGACAAAGTCAATGAACAACAAAAAGCC
ATCTGGAGCCAAGTCGGCTTATATTATTTATACACAAGCAGTAAGAGAGG
AATACAAAAAGAAAAATCCCGATGGCAAAGTAAATTTTACAGAAATTTCT
AAAATTGCATCCGAGAAATGGAAGAACATTTCCGATAAAGAAAAGGAAAA
ATATAATGTTTTGGCTCAAGCTGATAAAAAGAGATACACGAAAGAAATGG
AAGGTTATGAGCCCGAAACCGACAATAGGAAGCCTTCAAAAAAAGCTAAA
CGCGAAGCTAAGGATCCTAATAAGCCGAAGGCTCCTTTGACTGCATTTTT
TTTCTTTTCAAATGAACACCGACAAACAGTTAAGGAAAAGAATCCTGAAT
TTAAAGTCGGTGATATTGCAAAAGTTTTGGGTAAAATGTGGAGTGAATGC
AAGGATAAATCTAAGTACGAAGAAATGAACAAAGAGGCTAAAGAGAAATA
TAATTTGGCAATGCTAGAGTACAAAAATGGAGTTCCATCTGCCAAGAAAT
CTAAAGCTCATGTCAGTGATGAAGGAGATGAGGAAGAATATGAAAGCGAA
GAAGAAGAATAAACTGCTGTCATGAGATTTAGTAAAGCACAAACTTTTTG
TGCTATTATCAAATAAATTTGCATTTATGTGTTTTT
back to top

protein sequence of SMED30027770-orf-1

>SMED30027770-orf-1 ID=SMED30027770-orf-1|Name=SMED30027770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MNNKKPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNIS
DKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKA
PLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNK
EAKEKYNLAMLEYKNGVPSAKKSKAHVSDEGDEEEYESEEEE*
back to top
Aliases
The feature 'high mobility group-2' has the following synonyms
Synonym
hmg-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 142..162
NoneNo IPR availableCOILSCoilCoilcoord: 189..192
NoneNo IPR availablePRINTSPR00886HIGHMOBLTY12coord: 131..150
score: 32.96
coord: 113..131
score: 41.91
coord: 37..59
score: 48.95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 68..98
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 68..97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 165..192
NoneNo IPR availablePANTHERPTHR13711:SF302HIGH MOBILITY GROUP PROTEIN DSP1-RELATEDcoord: 80..188
NoneNo IPR availablePANTHERPTHR13711SWI/SNF-RELATED CHROMATIN BINDING PROTEINcoord: 80..188
NoneNo IPR availablePANTHERPTHR13711SWI/SNF-RELATED CHROMATIN BINDING PROTEINcoord: 5..87
NoneNo IPR availablePANTHERPTHR13711:SF302HIGH MOBILITY GROUP PROTEIN DSP1-RELATEDcoord: 5..87
NoneNo IPR availableCDDcd01390HMGB-UBF_HMG-boxcoord: 6..73
e-value: 2.44283E-14
score: 62.6453
NoneNo IPR availableCDDcd01390HMGB-UBF_HMG-boxcoord: 98..160
e-value: 9.07255E-14
score: 61.1045
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 97..165
e-value: 2.5E-21
score: 86.9
coord: 5..77
e-value: 1.9E-22
score: 90.5
IPR009071High mobility group box domainPFAMPF09011HMG_box_2coord: 4..75
e-value: 1.4E-19
score: 70.4
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 98..164
e-value: 1.8E-18
score: 66.7
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 98..164
score: 16.865
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 6..76
score: 18.034
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 1..77
e-value: 1.4E-25
score: 91.4
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 91..165
e-value: 9.3E-23
score: 82.5
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 89..168
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 2..78