SMED30027767

Overview
NameSMED30027767
Smed IDSMED30027767
Length (bp)1206
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027767 (SMED30027767) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027767 (SMED30027767) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027767

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027767SMESG000065100.1 SmedASXL_007305SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30027767SMESG000065100.1 dd_Smed_v4_57748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027767SMESG000065100.1 dd_Smed_v4_57748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027767SMESG000065100.1 dd_Smed_v6_57748_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30027767SMESG000065100.1 SMED30027767smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30027767SMESG000065100.1 OX_Smed_1.0.11026ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30027767 vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 147.132 bits (370), Expect = 2.269e-38
Identity = 74/179 (41.34%), Postives = 108/179 (60.34%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T +E +  E ++L +N          FWVP  W + +  K ++ G I DP  + SL  E+  LR Q  +L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFT  QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  + +   +  P +
Sbjct:  163 MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRM 332          
BLAST of SMED30027767 vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 146.747 bits (369), Expect = 2.986e-38
Identity = 74/179 (41.34%), Postives = 108/179 (60.34%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T +E +  E ++L +N          FWVP  W + +  K ++ G I DP  + SL  E+  LR Q  +L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFT  QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  + +   +  P +
Sbjct:  103 MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRM 272          
BLAST of SMED30027767 vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 134.035 bits (336), Expect = 4.874e-34
Identity = 74/179 (41.34%), Postives = 102/179 (56.98%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I +PLVYTQVV IA+YSYFL  L   QF+DP Q    H++D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 134.035 bits (336), Expect = 4.874e-34
Identity = 74/179 (41.34%), Postives = 102/179 (56.98%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I +PLVYTQVV IA+YSYFL  L   QF+DP Q    H++D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 134.035 bits (336), Expect = 4.874e-34
Identity = 74/179 (41.34%), Postives = 102/179 (56.98%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I +PLVYTQVV IA+YSYFL  L   QF+DP Q    H++D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. Ensembl Celegans
Match: best-4 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17205])

HSP 1 Score: 122.479 bits (306), Expect = 2.753e-30
Identity = 63/181 (34.81%), Postives = 104/181 (57.46%), Query Frame = -2
Query:  309 EPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGH--EVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFID 845
            + ++W PIQW   ++      G I+D      L +++ E R ++ NL I+  + IPLVYTQVV +AV +YF++ LF  QF++    I G   ++D Y P+ T  Q +F++GWLKV+  ++NP G+DDEDF+T+ +++ NL + +   + +   YP+L +         D   ED  P  +D
Sbjct:  178 QSKYWQPIQWLFSLVTVAKDEGLIADSYLYVDLIDKMREFRTKILNLVIFDMVPIPLVYTQVVNLAVRTYFVLALFGRQFLENNNNIPGAKWKIDIYFPIMTSLQIVFIVGWLKVSEVMLNPLGEDDEDFETNWIIERNLQVGYAVVDQAYGRYPTLKR---------DPFWEDETPQTMD 349          
BLAST of SMED30027767 vs. Ensembl Celegans
Match: best-23 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A5JYR2])

HSP 1 Score: 117.087 bits (292), Expect = 5.427e-29
Identity = 65/166 (39.16%), Postives = 96/166 (57.83%), Query Frame = -2
Query:  423 IITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDIS 920
            ++T  E+  F++I +  +   K      +WVP+ W   ++ +CF  G ++    +  L + +E+ R     L IY  I IPLVYTQV  I+VY YFL  L   Q+  P +      VD Y+P+FTI QFLF +GWLKV   +M PFG DDEDF+ + +L+ NL++S
Sbjct:  154 LMTKEEMVMFKSILVHVDPHQK------WWVPLNWIQTMMVRCFEKGTLTHTNELRVLLDALEKYRNGFFQLFIYDWIAIPLVYTQVSTISVYGYFLFALIGRQY--PSKNENEEIVDVYVPIFTILQFLFYVGWLKVGEDLMFPFGADDEDFEFNYILERNLEVS 311          
BLAST of SMED30027767 vs. Ensembl Celegans
Match: best-2 (Bestrophin homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17529])

HSP 1 Score: 116.701 bits (291), Expect = 9.625e-29
Identity = 60/166 (36.14%), Postives = 95/166 (57.23%), Query Frame = -2
Query:  375 YNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 872
            Y T+N  R   ++W+P  WA  + +K    G+I        +  E+   R  ++ +  Y  + +PL+Y Q+V +AV  YFLV + A Q V    ++V  EVD Y PV T  QF+F MGWLKV   ++NPFG+DD+DF+T+ ++D N+ +  +  + + +  P LLK
Sbjct:  174 YTTKNNSRLGKKYWIPANWALCMTYKARKDGYIESDYFKAQMEGEIRTWRTNIEWVCNYDWVPLPLMYPQLVCLAVNLYFLVSIIARQLVIEKHKMVD-EVDVYFPVMTFLQFIFYMGWLKVIEVMLNPFGEDDDDFETNALIDRNITMGLKMVDNTMKT-PELLK 337          
BLAST of SMED30027767 vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 116.316 bits (290), Expect = 4.535e-28
Identity = 60/185 (32.43%), Postives = 102/185 (55.14%), Query Frame = -2
Query:  375 IITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVG---HEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 920
            ++T  E+  FE+I   +          ++W P+ W   +I      G IS       L E++ + R  + +L ++  + +PLVYTQVV +AV SYFL+ LF  Q++ P    +      +D Y+P+ ++ QF+F +GW+KVA  ++NP G+DD+DF+ + +LD NL +     + +   YP+L K
Sbjct:  162 LMTEKEMAEFESIPSPH---------AKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTLEK 337          
BLAST of SMED30027767 vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 114.39 bits (285), Expect = 8.450e-28
Identity = 64/206 (31.07%), Postives = 108/206 (52.43%), Query Frame = -2
Query:  327 GIRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDN 944
            G+R+ F  +  V++        L+     K RY+ ++WV   WA  +++       I       ++ +E+ + R  +  + +Y  + IPL+Y Q+V +AV++YF + +F  QF          EVD YIP  TI +F+F MGWLKVAM ++NPFG+D +DF  + ++D NL I   S + + +  P  +KP +        +D D+
Sbjct:  189 GVRRRFPTLEAVAQAGIMLPHELEKFNSIKSRYQ-KYWVSFNWALELLNVAKTEKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGLTSVDDAYDQLPE-VKPDVFTGGSVKPLDSDD 392          
BLAST of SMED30027767 vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 133.65 bits (335), Expect = 1.146e-33
Identity = 73/170 (42.94%), Postives = 101/170 (59.41%), Query Frame = -2
Query:  375 TRNKIRYEP-EFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGH-----EVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 866
            T NK    P + W+PI WA+ II +    G I D   + ++ +E+ + R Q   L  Y  I +PLVYTQVV +AVYSYFL      Q+ D   ++VG+     +VD Y PVFT  QF F MGWLKVA  ++NPFG+DD+DF+ + M+D NL +S+   +     +P LLK
Sbjct:  174 TMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of SMED30027767 vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 133.65 bits (335), Expect = 1.166e-33
Identity = 73/170 (42.94%), Postives = 101/170 (59.41%), Query Frame = -2
Query:  375 TRNKIRYEP-EFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGH-----EVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 866
            T NK    P + W+PI WA+ II +    G I D   + ++ +E+ + R Q   L  Y  I +PLVYTQVV +AVYSYFL      Q+ D   ++VG+     +VD Y PVFT  QF F MGWLKVA  ++NPFG+DD+DF+ + M+D NL +S+   +     +P LLK
Sbjct:  174 TMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of SMED30027767 vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 133.65 bits (335), Expect = 1.294e-33
Identity = 73/170 (42.94%), Postives = 101/170 (59.41%), Query Frame = -2
Query:  375 TRNKIRYEP-EFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGH-----EVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 866
            T NK    P + W+PI WA+ II +    G I D   + ++ +E+ + R Q   L  Y  I +PLVYTQVV +AVYSYFL      Q+ D   ++VG+     +VD Y PVFT  QF F MGWLKVA  ++NPFG+DD+DF+ + M+D NL +S+   +     +P LLK
Sbjct:  174 TMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of SMED30027767 vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 133.65 bits (335), Expect = 1.324e-33
Identity = 73/170 (42.94%), Postives = 101/170 (59.41%), Query Frame = -2
Query:  375 TRNKIRYEP-EFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGH-----EVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 866
            T NK    P + W+PI WA+ II +    G I D   + ++ +E+ + R Q   L  Y  I +PLVYTQVV +AVYSYFL      Q+ D   ++VG+     +VD Y PVFT  QF F MGWLKVA  ++NPFG+DD+DF+ + M+D NL +S+   +     +P LLK
Sbjct:  174 TMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTD--GKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLK 341          
BLAST of SMED30027767 vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 130.183 bits (326), Expect = 6.665e-33
Identity = 67/186 (36.02%), Postives = 109/186 (58.60%), Query Frame = -2
Query:  375 TFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 932
            T+ ++I V  + A E   +K     K    P++W+PI WA+ I+ +    G I D  ++ S+ +E+ + R     L  Y  I +PLVYTQVV +AVYSYF+  +F  Q++D   +   + V +Y P+F+  +F F MGWLKVA  ++ PFGDDD+DF+ + ++D NL +S+   +     +P L++
Sbjct:  154 TYDQLIEVGLLNANEANIMK-AMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQLVR 338          
BLAST of SMED30027767 vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 147.902 bits (372), Expect = 1.135e-40
Identity = 75/177 (42.37%), Postives = 107/177 (60.45%), Query Frame = -2
Query:  390 IITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 920
            ++T  E+R  + +   +N         +FWVP  W   +  +    G I++   MT++  E+  LR Q   L  Y  I +PLVYTQVV +AVYS+FL  L   QF+DP Q   GH +DFY+PVFT+ QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S    +EMY
Sbjct:    2 LMTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLS---VDEMY 166          
BLAST of SMED30027767 vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 148.673 bits (374), Expect = 7.938e-39
Identity = 75/177 (42.37%), Postives = 107/177 (60.45%), Query Frame = -2
Query:  390 IITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 920
            ++T  E+R  + +   +N         +FWVP  W   +  +    G I++   MT++  E+  LR Q   L  Y  I +PLVYTQVV +AVYS+FL  L   QF+DP Q   GH +DFY+PVFT+ QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S    +EMY
Sbjct:  162 LMTAEELRQLQELPSPHN---------KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLS---VDEMY 326          
BLAST of SMED30027767 vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 144.436 bits (363), Expect = 2.012e-38
Identity = 75/179 (41.90%), Postives = 105/179 (58.66%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FE++   YN         ++W+P  W + +       G I D  T   L EE+   R +   L  Y  I +PLVYTQVV +AVYS+FLV L   QF+DPGQ   GH++D Y+P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  165 MTREERKKFESLHSPYN---------KYWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMM---AVDEMYGDL 331          
BLAST of SMED30027767 vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 120.553 bits (301), Expect = 2.653e-30
Identity = 62/181 (34.25%), Postives = 99/181 (54.70%), Query Frame = -2
Query:  375 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 917
            +T  E+R   ++   +N         ++W+P+ W + +  +    G + D   +  L +E+   R +   L  Y  I IPLVYTQVV +AVYS+F   L   QFV P        +D YIP+FT+ +F F  GWLKV   ++NPFG+DD+DF+T++++D N+ +S  + +   +  P L K
Sbjct:  163 MTTDELRKLNHLYSDFN---------KYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPASS--EEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEK 332          
BLAST of SMED30027767 vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 117.087 bits (292), Expect = 2.982e-29
Identity = 58/164 (35.37%), Postives = 92/164 (56.10%), Query Frame = -2
Query:  426 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDI 917
            +T  E+R   ++   +N         ++W+P+ W + +  +    G + D   +  L +E+   R +   L  Y  I IPLVYTQVV +AVYS+F   L   QFV P        +D YIP+FT+ +F F  GWLKV   ++NPFG+DD+DF+T++++D N+ +
Sbjct:  163 MTTDELRKLNHLYSDFN---------KYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPASS--EEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of SMED30027767 vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 135.961 bits (341), Expect = 1.277e-35
Identity = 67/155 (43.23%), Postives = 94/155 (60.65%), Query Frame = -2
Query:  375 EFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 839
            +FWVP  W + +       G I D   +  + +E+  LR Q   L  Y  I +PLVYTQVV +AVYS+FL  L   QF+DP +   GH++D Y+PVFT+ QF F  GWLKVA  ++NPFG DD+DF+T+ ++D NL +S  + +   +  P L K
Sbjct:  180 KFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEK 334          
BLAST of SMED30027767 vs. Ensembl Xenopus
Match: phka1p1 (phosphorylase kinase, alpha 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-1012252])

HSP 1 Score: 137.502 bits (345), Expect = 1.393e-35
Identity = 74/176 (42.05%), Postives = 100/176 (56.82%), Query Frame = -2
Query:  390 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 917
            +T  E + FEN+   YN         ++WVP  W   +  +    G I D  +   L EE+   R     L  Y  I +PLVYTQVV IAVYS+FL  L   QF+DP +   GHE+D Y+PVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ + ++D N  +S     A +EMY
Sbjct:  115 MTRLERKKFENLQSSYN---------KYWVPCVWFCNLASQARSEGRIRDDHSFKMLMEELNTFRGNCGMLFHYDWISVPLVYTQVVTIAVYSFFLTCLIGRQFLDPARGYPGHELDLYVPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEINFLIDRNFQVSML---AVDEMY 278          
BLAST of SMED30027767 vs. Ensembl Xenopus
Match: phka1p1 (phosphorylase kinase, alpha 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-1012252])

HSP 1 Score: 137.117 bits (344), Expect = 1.504e-35
Identity = 74/176 (42.05%), Postives = 100/176 (56.82%), Query Frame = -2
Query:  390 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 917
            +T  E + FEN+   YN         ++WVP  W   +  +    G I D  +   L EE+   R     L  Y  I +PLVYTQVV IAVYS+FL  L   QF+DP +   GHE+D Y+PVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ + ++D N  +S     A +EMY
Sbjct:  114 MTRLERKKFENLQSSYN---------KYWVPCVWFCNLASQARSEGRIRDDHSFKMLMEELNTFRGNCGMLFHYDWISVPLVYTQVVTIAVYSFFLTCLIGRQFLDPARGYPGHELDLYVPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEINFLIDRNFQVSML---AVDEMY 277          
BLAST of SMED30027767 vs. Ensembl Xenopus
Match: phka1p1 (phosphorylase kinase, alpha 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-1012252])

HSP 1 Score: 137.117 bits (344), Expect = 1.630e-35
Identity = 74/176 (42.05%), Postives = 100/176 (56.82%), Query Frame = -2
Query:  390 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 917
            +T  E + FEN+   YN         ++WVP  W   +  +    G I D  +   L EE+   R     L  Y  I +PLVYTQVV IAVYS+FL  L   QF+DP +   GHE+D Y+PVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ + ++D N  +S     A +EMY
Sbjct:  114 MTRLERKKFENLQSSYN---------KYWVPCVWFCNLASQARSEGRIRDDHSFKMLMEELNTFRGNCGMLFHYDWISVPLVYTQVVTIAVYSFFLTCLIGRQFLDPARGYPGHELDLYVPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEINFLIDRNFQVSML---AVDEMY 277          
BLAST of SMED30027767 vs. Ensembl Xenopus
Match: phka1p1 (phosphorylase kinase, alpha 1 pseudogene 1 [Source:Xenbase;Acc:XB-GENE-1012252])

HSP 1 Score: 137.117 bits (344), Expect = 1.630e-35
Identity = 74/176 (42.05%), Postives = 100/176 (56.82%), Query Frame = -2
Query:  390 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 917
            +T  E + FEN+   YN         ++WVP  W   +  +    G I D  +   L EE+   R     L  Y  I +PLVYTQVV IAVYS+FL  L   QF+DP +   GHE+D Y+PVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ + ++D N  +S     A +EMY
Sbjct:  114 MTRLERKKFENLQSSYN---------KYWVPCVWFCNLASQARSEGRIRDDHSFKMLMEELNTFRGNCGMLFHYDWISVPLVYTQVVTIAVYSFFLTCLIGRQFLDPARGYPGHELDLYVPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEINFLIDRNFQVSML---AVDEMY 277          
BLAST of SMED30027767 vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 151.369 bits (381), Expect = 3.537e-41
Identity = 78/179 (43.58%), Postives = 107/179 (59.78%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E +  + + L +NT         FWVP  W + +  K ++ G I D   + SL  EV  LR Q   L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFTI QFLF MGWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S +   +  P +
Sbjct:  163 MTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPM 332          
BLAST of SMED30027767 vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 152.525 bits (384), Expect = 1.099e-40
Identity = 78/179 (43.58%), Postives = 107/179 (59.78%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E +  + + L +NT         FWVP  W + +  K ++ G I D   + SL  EV  LR Q   L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFTI QFLF MGWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S +   +  P +
Sbjct:  163 MTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPM 332          
BLAST of SMED30027767 vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 135.191 bits (339), Expect = 1.090e-34
Identity = 76/179 (42.46%), Postives = 101/179 (56.42%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I IPLVYTQVV IAVYSYFL  L   QF+DP Q    H +D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 135.191 bits (339), Expect = 1.090e-34
Identity = 76/179 (42.46%), Postives = 101/179 (56.42%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I IPLVYTQVV IAVYSYFL  L   QF+DP Q    H +D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 135.191 bits (339), Expect = 1.090e-34
Identity = 76/179 (42.46%), Postives = 101/179 (56.42%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I IPLVYTQVV IAVYSYFL  L   QF+DP Q    H +D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. UniProt/SwissProt
Match: sp|O88870|BEST1_MOUSE (Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=2 SV=3)

HSP 1 Score: 152.525 bits (384), Expect = 7.690e-40
Identity = 78/179 (43.58%), Postives = 107/179 (59.78%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E +  + + L +NT         FWVP  W + +  K ++ G I D   + SL  EV  LR Q   L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFTI QFLF MGWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S +   +  P +
Sbjct:  163 MTHGEHKQLQKLGLPHNT---------FWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPM 332          
BLAST of SMED30027767 vs. UniProt/SwissProt
Match: sp|Q8WMR7|BEST1_PIG (Bestrophin-1 (Fragment) OS=Sus scrofa OX=9823 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.779e-38
Identity = 74/176 (42.05%), Postives = 109/176 (61.93%), Query Frame = -2
Query:  390 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 917
            +T SE +  E ++L +N+         FW+P  W + +  K +I G I DP  + SL +E+  LR Q  +L  Y  I +PLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +P+FT  QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D +L +S     A +EM+
Sbjct:   10 MTPSEHKHLEKLSLPHNS---------FWMPWVWFANLSTKAWIGGRIRDPVLLQSLLDEMNTLRTQCGHLYAYDWISVPLVYTQVVTVAVYSFFLACLVGRQFLNPAKAYPGHEMDLVVPLFTFLQFFFYAGWLKVAEQLINPFGEDDDDFETNWIVDRSLQVSL---SAVDEMH 173          
BLAST of SMED30027767 vs. UniProt/SwissProt
Match: sp|O76090|BEST1_HUMAN (Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.090e-37
Identity = 74/179 (41.34%), Postives = 108/179 (60.34%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T +E +  E ++L +N          FWVP  W + +  K ++ G I DP  + SL  E+  LR Q  +L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFT  QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  + +   +  P +
Sbjct:  163 MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRM 332          
BLAST of SMED30027767 vs. UniProt/SwissProt
Match: sp|Q6UY87|BEST1_MACFA (Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BEST1 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.203e-37
Identity = 77/179 (43.02%), Postives = 109/179 (60.89%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T +E +  E ++L +N          FWVP  W + +  K ++ G I DP  + SL  E+  LR Q  +L  Y  I IPLVYTQVV +AVYS+FL  L   QF++P +   GHE+D  +PVFT  QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S     A +EM+  L
Sbjct:  163 MTPAEHKQLEKLSLPHNM---------FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLL---AVDEMHQDL 329          
BLAST of SMED30027767 vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 8.846e-34
Identity = 76/179 (42.46%), Postives = 101/179 (56.42%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FEN+   YN         ++WVP  W S +  +    G I D   +  L EE+   R +   L  Y  I IPLVYTQVV IAVYSYFL  L   QF+DP Q    H +D  +P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFENLNSSYN---------KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSML---AVDEMYDDL 329          
BLAST of SMED30027767 vs. TrEMBL
Match: A0A5K3G0L9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.642e-74
Identity = 115/213 (53.99%), Postives = 155/213 (72.77%), Query Frame = -2
Query:  303 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDV 941
            IR+TF KIIT SEI+AFE IA  Y  + + RY PE+WVP+QWA R++ K  +HG + DPR +  + +E+ + R Q+Q L++YS+I++PLVYTQVV+IAVYSYF   + A+QF++  +      VDF+IPVF+IF FLF+MGWLKVA+CVMNPFGDDDEDF+TS++LDYNLD+S+RS    E  +P  L  A  + +    V+ DNL DFI  V
Sbjct:   44 IRETFGKIITESEIKAFEAIAQYYFKQTRQRYLPEYWVPLQWAVRLVQKAGLHGNLPDPRMIGYMFKEIGDFRHQLQTLEVYSSIMMPLVYTQVVIIAVYSYFGCEILASQFLEMPKVKGEAVVDFFIPVFSIFYFLFLMGWLKVALCVMNPFGDDDEDFETSDILDYNLDVSYRSVLMEEATFPETLHEATFETKPMKGVENDNLNDFIQSV 256          
BLAST of SMED30027767 vs. TrEMBL
Match: A0A068WLT0 (Bestrophin homolog OS=Echinococcus granulosus OX=6210 GN=EgrG_001141800 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.201e-73
Identity = 116/223 (52.02%), Postives = 159/223 (71.30%), Query Frame = -2
Query:  285 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVD----PGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYK 941
            +R+TF KIIT  EIRAFE IA  Y  + + RY PE+WVP+QWA R++ K  +HG I DPR +  + +E+ E R Q+Q L++YS+I++PLVYTQVV+IAVYSYF   + A+QF++    PG+ +    VDF++P+F+IF FLF+MGWLKVA+CVMNPFGDDDEDF+TS +L+YNLD+S+RS    E  YP  L  A  +      V++DNL +FI  V + L +
Sbjct:  273 VRETFGKIITEPEIRAFEAIAKYYFKQTRQRYLPEYWVPLQWAVRLVQKAGLHGNIPDPRMIGVMFKEIGEFRTQLQTLEVYSSIMMPLVYTQVVIIAVYSYFGCEILASQFLEVAKVPGEAV----VDFFVPIFSIFYFLFLMGWLKVALCVMNPFGDDDEDFETSAILNYNLDVSYRSVLMDESTYPEGLSAATFETSTMKGVEDDNLAEFIKSVSDELAR 491          
BLAST of SMED30027767 vs. TrEMBL
Match: A0A068YGF1 (Bestrophin homolog OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001141800 PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.179e-73
Identity = 116/223 (52.02%), Postives = 159/223 (71.30%), Query Frame = -2
Query:  285 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVD----PGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYK 941
            +R+TF KIIT  EIRAFE IA  Y  + + RY PE+WVP+QWA R++ K  +HG I DPR +  + +E+ E R Q+Q L++YS+I++PLVYTQVV+IAVYSYF   + A+QF++    PG+ +    VDF++P+F+IF FLF+MGWLKVA+CVMNPFGDDDEDF+TS +L+YNLD+S+RS    E  YP  L  A  +      V++DNL +FI  V + L +
Sbjct:  273 VRETFGKIITEPEIRAFEAIAKYYFKQTRQRYLPEYWVPLQWAVRLVQKAGLHGNIPDPRMIGVMFKEIGEFRTQLQTLEVYSSIMMPLVYTQVVIIAVYSYFGCEILASQFLEVAKVPGEAV----VDFFVPIFSIFYFLFLMGWLKVALCVMNPFGDDDEDFETSAILNYNLDVSYRSVLMDESTYPEGLSAATFETSTMKGVEDDNLAEFIKSVSDELAR 491          
BLAST of SMED30027767 vs. TrEMBL
Match: A0A0R3WKE4 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1183 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.096e-72
Identity = 119/219 (54.34%), Postives = 159/219 (72.60%), Query Frame = -2
Query:  285 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYK 941
            +R+TF KIIT  EIRAFE IA  Y  + + RY PE+WVP+QWA R++ K  +HG I DPR +  L +E+ E R Q+Q L++YS+I++PLVYTQVV+IAVYSYF   + A+QF++  +      VDF++PVF+IF FLF+MGWLKVA+CVMNPFGDDDEDF+TS +L+YNLD+S+RS    E  YP  LK A  +    + V++DNLP+FI  V + L K
Sbjct:  273 VRETFGKIITEPEIRAFEAIAKYYFKQTRQRYLPEYWVPLQWAVRLVQKAGLHGNIPDPRMIGVLFKEIGEFRSQLQTLEVYSSIMMPLVYTQVVIIAVYSYFACEILASQFLEVSKVPGEAAVDFFVPVFSIFYFLFLMGWLKVALCVMNPFGDDDEDFETSAILNYNLDVSYRSVLMDETTYPEGLKAATFETSTMNGVEDDNLPEFIKSVTDELTK 491          

HSP 2 Score: 215.698 bits (548), Expect = 1.696e-58
Identity = 101/217 (46.54%), Postives = 142/217 (65.44%), Query Frame = -2
Query:  291 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 941
            ++QTF K+IT  EIRAFE I  +Y    + RY PE+WVPIQWA R++ K  +HG I DP+ M  +  E+   R+Q+  L+ +S++ +PLVYTQV VIAVYSYF+  + A Q ++             +P+F++F F+F++GWLKVA+CVM+PFG+D EDF+TSE+LDYNLD+S+R     +  YP  LK A       D  +EDNL  F+D V  +L
Sbjct:  727 VQQTFGKLITDPEIRAFEAIGRRYFCSTRQRYLPEYWVPIQWAVRVVQKTTLHGNIPDPKIMIHVLGEIGNFRKQLGQLKRFSSLTMPLVYTQVAVIAVYSYFICQIVATQHIERAANETNPNTSMPVPLFSVFYFIFLVGWLKVALCVMSPFGEDYEDFETSEILDYNLDVSYRVVLMDDTTYPEELKRATFTPHTMDGHEEDNLRAFLDSVSRDL 943          
BLAST of SMED30027767 vs. TrEMBL
Match: A0A4E0S453 (Bestrophin homolog OS=Fasciola hepatica OX=6192 GN=D915_000472 PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.854e-72
Identity = 112/225 (49.78%), Postives = 162/225 (72.00%), Query Frame = -2
Query:  267 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYKYSEPYT 941
            +R+TF  IIT +EI AF+  A++   R K +Y PE+W+PIQWA R++ K    G+I DP+T   + +++ ++R+QMQ+LQI+S+I+IPLVYTQVV+IAVYSYF+  +FA QFV+  +   GH++D Y+P+F+IF FLF+MGWLKVA+CVMNPFGDDDEDFQTS +LDYNL++SFRS       +P  +   + K+   D    D+LP F++ ++ +L K  +  T
Sbjct:  270 VRRTFGVIITEAEIEAFQRTAIECYRRTKTKYTPEYWIPIQWAQRLVLKALQSGYILDPKTAYYIIDQIGDVRKQMQDLQIFSSIMIPLVYTQVVIIAVYSYFMCQIFACQFVEHRRDEAGHKIDLYVPIFSIFSFLFLMGWLKVALCVMNPFGDDDEDFQTSSILDYNLEVSFRSVYMDPRSFPDNMSMPLGKHNQNDK--PDDLPAFLEQIDCDLNKQCDQIT 492          
BLAST of SMED30027767 vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 145.976 bits (367), Expect = 6.618e-38
Identity = 74/177 (41.81%), Postives = 109/177 (61.58%), Query Frame = -2
Query:  390 IITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 920
            ++TV E R  +++   +N         +FWVP  W   +  +    G I++   ++++  E+  LR Q   L  Y  I +PLVYTQVV +AVYS+FL  L   QF+DP Q   GH++DFY+PVFT+ QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S    +EMY
Sbjct:  162 LMTVEERRQLDDLPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLS---VDEMY 326          
BLAST of SMED30027767 vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 139.043 bits (349), Expect = 1.178e-35
Identity = 73/179 (40.78%), Postives = 105/179 (58.66%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FE++   YN         ++W+P  W + +       G I D  T   L EE+ + R +   L  Y  I +PLVYTQVV +AVYS+FLV L   QF+DP Q   GH++D Y+P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EM+  L
Sbjct:  163 MTREERKKFESLHSPYN---------KYWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMM---AVDEMFGDL 329          
BLAST of SMED30027767 vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 128.257 bits (321), Expect = 1.411e-32
Identity = 75/218 (34.40%), Postives = 109/218 (50.00%), Query Frame = -2
Query:  264 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYKYSEPYTR 917
            +T  E + FEN+   +          ++W+P  W + +  K    G I D   + ++  E+   R     L  Y  + IPLVYTQVV +AVY++F   +   QF+DP Q   GH++D Y+PVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ +  +D NL +S     A +EM+                    N+P    DV  N      PYTR
Sbjct:   85 MTPEEKKIFENLKSPHL---------KYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLM---AVDEMH-------------------MNIPRMTKDVYWNDPDVRPPYTR 271          
BLAST of SMED30027767 vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 115.546 bits (288), Expect = 1.365e-28
Identity = 66/195 (33.85%), Postives = 105/195 (53.85%), Query Frame = -2
Query:  375 FSGIRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQ-VVVIAVYSYFLVHLFAAQFVDP--GQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 950
            F  ++      +T  E+R  +++   +N         ++W+P+ W + +  K    G + D   +  L +E+   R +   L  Y  I IPLVYTQ VV +AVYS+F   L   QFV P     +  H VD Y+PVFT+ +F F  GWLKV   ++NPFG+DD+DF+T++++D N+ +S  + +   +  P L K
Sbjct:  150 FPTLQHIVDAFMTEEEMRTLDHLYSDFN---------KYWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVH-VDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEK 334          
BLAST of SMED30027767 vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 111.694 bits (278), Expect = 2.872e-26
Identity = 66/178 (37.08%), Postives = 95/178 (53.37%), Query Frame = -2
Query:  390 KIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMY 923
             ++TV E R  +++   +N         +FWVP  W   +  +          RT   +N +V             S IL       VV +AVYS+FL  L   QF+DP Q   GH++DFY+PVFT+ QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S    +EMY
Sbjct:  161 GLMTVEERRQLDDLPSPHN---------KFWVPCMWFVNLALRA---------RTEGRINNDV-----------ALSAIL------NVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLS---VDEMY 300          
BLAST of SMED30027767 vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 139.813 bits (351), Expect = 4.906e-37
Identity = 74/179 (41.34%), Postives = 104/179 (58.10%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + F+ +   YN         ++WVP  W S +  +    G + D   +  L +E+   R     L  Y  I +PLVYTQVV +AVYS+FL  L   QF+DP Q   GH++D YIPVFT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S     A +EMY +L
Sbjct:  163 MTRDERKRFDGLRCSYN---------KYWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSML---AVDEMYQNL 329          
BLAST of SMED30027767 vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 124.79 bits (312), Expect = 1.388e-32
Identity = 70/179 (39.11%), Postives = 100/179 (55.87%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T +E R F+ +   +N         +FWVP  W + +  +    G I D  ++  +  ++   R     L  Y  + IPLVYTQVV +AVYS+FL  L   QF+ P Q   GH++D YIPVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ +  +D NL +S       +EMY  L
Sbjct:  163 MTPAERRKFDGLRSPHN---------KFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGP-QGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVSLM---GVDEMYRDL 328          
BLAST of SMED30027767 vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 150.599 bits (379), Expect = 1.572e-39
Identity = 78/190 (41.05%), Postives = 112/190 (58.95%), Query Frame = -2
Query:  381 FSGIRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 950
            F       + ++T  E+R FE +   +N         +FWVP  W   +  +    G I++   +T++  E+  LR +   L  Y  I +PLVYTQV  +AVYS+FL  L   QF+DP Q   GH+VDFY+PVFT+ QF F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL +S  S    +EMY SL
Sbjct:  149 FPTTEHLVQALMTSEELRHFEELPSPHN---------KFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLS---VDEMYDSL 326          
BLAST of SMED30027767 vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 139.813 bits (351), Expect = 5.662e-36
Identity = 72/179 (40.22%), Postives = 103/179 (57.54%), Query Frame = -2
Query:  381 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSL 917
            +T  E + FE +   YN         ++W+P  W + +       G I D   +  L EE+   R +   L  Y  + +PLVYTQVV +AVYS+FLV L   QF+DP Q   GH++D Y+P+FT+ QF F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  +S     A +EMY  L
Sbjct:  163 MTREERKKFEGLHSPYN---------KYWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMM---AVDEMYGDL 329          
BLAST of SMED30027767 vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 130.568 bits (327), Expect = 1.114e-32
Identity = 66/181 (36.46%), Postives = 101/181 (55.80%), Query Frame = -2
Query:  375 ITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLK 917
            +T  E + FENI   +          ++W+P+ W S +  +    G I D   + ++  E+   R     L  Y  + IPLVYTQVV +AVY++F   +   QF+DP Q   GH++D Y+PVFT+ QF F  GWLKVA  ++NPFG+DD+DF+ + ++D NL +S  + +      P + K
Sbjct:  163 MTPEERKVFENIRSPHL---------KYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAVDEMHMNLPHMTK 334          
BLAST of SMED30027767 vs. Planmine SMEST
Match: SMESG000065100.1 (SMESG000065100.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 268/269 (99.63%), Postives = 269/269 (100.00%), Query Frame = -2
Query:  135 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYKYSEPYTRKRNFSSSYSSKVFANLHQFFRKTSLPFIENDSDCIIHSNDQKV 941
            IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYKYSEPYTRKRNFSSSYS+KVFANLHQFFRKTSLPFIENDSDCIIHSNDQKV
Sbjct:  182 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNLYKYSEPYTRKRNFSSSYSTKVFANLHQFFRKTSLPFIENDSDCIIHSNDQKV 450          
BLAST of SMED30027767 vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 303.138 bits (775), Expect = 6.445e-99
Identity = 138/217 (63.59%), Postives = 173/217 (79.72%), Query Frame = -2
Query:  291 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 941
            I+ TF+KIIT +E+RAFENIA K  ++ K ++ PEFWVPIQW+SR++ K F+HGFISDPRT+ S+  +++ LR QM  LQI+S I+IPLVYTQV++IAVYSYFL  LFA+QFVDP  +I GHEVD Y+P+FTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTS++LD NLD++FRS  A   MYP  L P  M Y+ Q   DED L DF+ D++++L
Sbjct:  180 IQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDL 396          
BLAST of SMED30027767 vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 303.138 bits (775), Expect = 6.585e-99
Identity = 138/217 (63.59%), Postives = 173/217 (79.72%), Query Frame = -2
Query:  291 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 941
            I+ TF+KIIT +E+RAFENIA K  ++ K ++ PEFWVPIQW+SR++ K F+HGFISDPRT+ S+  +++ LR QM  LQI+S I+IPLVYTQV++IAVYSYFL  LFA+QFVDP  +I GHEVD Y+P+FTIFQFLF MGWLKVAMCVMNPFGDDDEDFQTS++LD NLD++FRS  A   MYP  L P  M Y+ Q   DED L DF+ D++++L
Sbjct:  180 IQSTFRKIITDAEVRAFENIAAKNYSKTKSKFPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDL 396          
BLAST of SMED30027767 vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 289.271 bits (739), Expect = 1.531e-93
Identity = 130/217 (59.91%), Postives = 169/217 (77.88%), Query Frame = -2
Query:  291 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 941
            I+ T+ KIIT +EIRAFE IA+K ++  K  Y PE+WVPIQWASR+I K FIH ++SDPRT+  + EE++ +R  MQNLQ++  I+IPLVYTQVV+IAVYS+FL  LFA+QF+DP +++ GHE+DFY+P+FTIFQFLF+MGWLKVAMCVMNPFGDDDEDFQTSE+LD NLD ++RS     EM+P  L P  M Y      + DNL  F+D+++ +L
Sbjct:  165 IQNTYGKIITDAEIRAFEAIAIKSDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLLKTEPDNLETFLDEIDYDL 381          
BLAST of SMED30027767 vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 288.886 bits (738), Expect = 3.174e-93
Identity = 130/217 (59.91%), Postives = 169/217 (77.88%), Query Frame = -2
Query:  291 IRQTFKKIITVSEIRAFENIALKYNTRNKIRYEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 941
            I+ T+ KIIT +EIRAFE IA+K ++  K  Y PE+WVPIQWASR+I K FIH ++SDPRT+  + EE++ +R  MQNLQ++  I+IPLVYTQVV+IAVYS+FL  LFA+QF+DP +++ GHE+DFY+P+FTIFQFLF+MGWLKVAMCVMNPFGDDDEDFQTSE+LD NLD ++RS     EM+P  L P  M Y      + DNL  F+D+++ +L
Sbjct:  182 IQNTYGKIITDAEIRAFEAIAIKSDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLLKTEPDNLETFLDEIDYDL 398          
The following BLAST results are available for this feature:
BLAST of SMED30027767 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST12.269e-3841.34bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST12.986e-3841.34bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST24.874e-3441.34bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST24.874e-3441.34bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST24.874e-3441.34bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of SMED30027767 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-42.753e-3034.81Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-235.427e-2939.16Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:A... [more]
best-29.625e-2936.14Bestrophin homolog 2 [Source:UniProtKB/Swiss-Prot... [more]
best-34.535e-2832.43Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-58.450e-2831.07Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of SMED30027767 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best11.146e-3342.94gene:FBgn0040238 transcript:FBtr0082183[more]
Best11.166e-3342.94gene:FBgn0040238 transcript:FBtr0114590[more]
Best11.294e-3342.94gene:FBgn0040238 transcript:FBtr0337020[more]
Best11.324e-3342.94gene:FBgn0040238 transcript:FBtr0306023[more]
Best36.665e-3336.02gene:FBgn0036492 transcript:FBtr0075618[more]
back to top
BLAST of SMED30027767 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.135e-4042.37bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best17.938e-3942.37bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best22.012e-3841.90bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best42.653e-3034.25bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best42.982e-2935.37bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
back to top
BLAST of SMED30027767 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.277e-3543.23bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
phka1p11.393e-3542.05phosphorylase kinase, alpha 1 pseudogene 1 [Source... [more]
phka1p11.504e-3542.05phosphorylase kinase, alpha 1 pseudogene 1 [Source... [more]
phka1p11.630e-3542.05phosphorylase kinase, alpha 1 pseudogene 1 [Source... [more]
phka1p11.630e-3542.05phosphorylase kinase, alpha 1 pseudogene 1 [Source... [more]
back to top
BLAST of SMED30027767 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best13.537e-4143.58bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best11.099e-4043.58bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best21.090e-3442.46bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best21.090e-3442.46bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best21.090e-3442.46bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
back to top
BLAST of SMED30027767 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88870|BEST1_MOUSE7.690e-4043.58Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=... [more]
sp|Q8WMR7|BEST1_PIG2.779e-3842.05Bestrophin-1 (Fragment) OS=Sus scrofa OX=9823 GN=B... [more]
sp|O76090|BEST1_HUMAN1.090e-3741.34Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1... [more]
sp|Q6UY87|BEST1_MACFA1.203e-3743.02Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BES... [more]
sp|Q8BGM5|BEST2_MOUSE8.846e-3442.46Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
back to top
BLAST of SMED30027767 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3G0L92.642e-7453.99Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WLT07.201e-7352.02Bestrophin homolog OS=Echinococcus granulosus OX=6... [more]
A0A068YGF18.179e-7352.02Bestrophin homolog OS=Echinococcus multilocularis ... [more]
A0A0R3WKE41.096e-7254.34Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A4E0S4531.854e-7249.78Bestrophin homolog OS=Fasciola hepatica OX=6192 GN... [more]
back to top
BLAST of SMED30027767 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best16.618e-3841.81bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best21.178e-3540.78bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
BEST31.411e-3234.40bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
best41.365e-2833.85bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best12.872e-2637.08bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
back to top
BLAST of SMED30027767 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best24.906e-3741.34bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best11.388e-3239.11bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of SMED30027767 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027767 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027767 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
best11.572e-3941.05bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
best25.662e-3640.22bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
BEST31.114e-3236.46bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
back to top
BLAST of SMED30027767 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065100.10.000e+099.63SMESG000065100.1[more]
SMESG000070057.16.445e-9963.59SMESG000070057.1[more]
SMESG000070057.16.585e-9963.59SMESG000070057.1[more]
SMESG000055094.11.531e-9359.91SMESG000055094.1[more]
SMESG000055094.13.174e-9359.91SMESG000055094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027767 ID=SMED30027767|Name=SMED30027767|organism=Schmidtea mediterranea sexual|type=transcript|length=1206bp
TTTTTTTATCATTAATACTAAATAAATGACAATGACAAATACAGAATGCG
ATCACATATTTCCAAACATCAATATATATAATTATCTTTATCTTCAAGAA
GTCCTGATTCGACGTCTTCAAACTTTGTTAGTTTGACTTTTTGGTCATTG
CTATGGATAATACAATCGGAATCGTTTTCAATAAATGGAAGAGAAGTCTT
TCTGAAGAATTGGTGTAAATTTGCAAAAACTTTTGACGAATATGAACTTG
AGAAATTTCTTTTCCTCGTATATGGTTCTGAATATTTGTACAAATTATTC
TCAACATCATCTATAAAATCCGGCAAATTATCCTCGTCAACGGCATCTTG
CAATCGGTATTTCATAATTGCTGGTTTTAATAAAGAGGGATACATTTCTT
CACTGGCTTCGGACGACCTGAAGGATATATCGAGATTGTAATCCAACATT
TCACTTGTCTGGAAATCTTCGTCATCATCACCAAAAGGATTCATTACACA
CATTGCGACCTTCAGCCAGCCCATCATGAAAAGAAACTGGAAAATCGTAA
AAACTGGTATATAAAAGTCAACTTCATGTCCAACAATTCTCTGGCCAGGA
TCTACAAATTGTGCGGCAAACAAATGCACCAAAAAATATGAGTAGACAGC
AATAACGACTACCTGAGTGTAAACTAATGGAATGAGGATGTTGCTGTAAA
TCTGTAAATTTTGCATTTGTTCTCTTAGCTCTTCGACCTCCTCGTTCAAA
CTGGTCATTGTTCGTGGGTCACTGATGAAGCCATGTATAAAGCATTTGTG
AATAATTCTTGACGCCCATTGTATTGGGACCCAGAATTCTGGCTCGTATC
GGATCTTATTTCTAGTATTATATTTTAATGCGATATTTTCGAACGCCCGA
ATCTCTGACACGGTGATTATTTTTTTAAATGTTTGACGAATTCCTGAAAA
GAATTAACAATTATATGTGTTTATATGAATTCCTTGAATCGAATGTGACC
TCTTACCTATTAATTATAATAGGTACAGTTCCGGAGACTTAATAACCTTT
ACTGTTTTATGAAAATAAAAACACAATAACGTTAAAAATTACTAGACCAG
TTCATTCAACGGAATTATAAATTAACATTTAAAGGTCCGGGTTCCATTGC
GCCAGGTTAATTACATATGCTATGAAAACTTAATTTCTTTAAAACTTAAA
GGTGAA
back to top

protein sequence of SMED30027767-orf-1

>SMED30027767-orf-1 ID=SMED30027767-orf-1|Name=SMED30027767-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=230bp
MTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQ
FVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQ
TSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFID
DVENNLYKYSEPYTRKRNFSSSYSSKVFANLHQFFRKTSLPFIENDSDCI
IHSNDQKVKLTKFEDVESGLLEDKDNYIY*
back to top
Aliases
The feature 'SMED30027767' has the following synonyms
Synonym
best-b
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..21
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 3..109
e-value: 7.8E-32
score: 110.8
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 2..175