FMRFamide receptor isoform X1 isoform 1

Overview
NameFMRFamide receptor isoform X1 isoform 1
Smed IDSMED30027736
Length (bp)2067
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide receptor isoform X1 isoform 1 (SMED30027736) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide receptor isoform X1 isoform 1 (SMED30027736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide receptor isoform X1 isoform 1 (SMED30027736) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide receptor isoform X1 isoform 1 (SMED30027736) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30027736SMESG000036502.1 dd_Smed_v4_3465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30027736SMESG000036502.1 dd_Smed_v4_3465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027736SMESG000036502.1 dd_Smed_v4_3465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027736SMESG000036502.1 dd_Smed_v4_3465_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. TrEMBL
Match: A0A4E0RWM6 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_007028 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.509e-73
Identity = 174/538 (32.34%), Postives = 267/538 (49.63%), Query Frame = 1
Query:  109 SLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENC-------------------KIPPYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQLMNVVGYNGT-CYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDL--------------------------------------MYKRKLSEASKNKRRNAELNATDENDVKSMMFPEFE-KDTAKFPSLTVDSNMPKVITSSLKDAED---------------KENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVL 1500
            +LD LPT  +ALK   + Y K A GV E +  C     E  EK++EWCV L C+ +++ C                    I PYP   + + S    ++     +     S    M V GYN + CYDDY C+Q  ++   H ILG TC I+CL GI++  + LP +N+  +R+G T+YL+A++I D  YM L  ++V  +Y+P ++++Q++ Y++F+A  +P G P +   EL+ VW+TVA+L +R LYLKFGF SK +CS+  S K I ++++  L Y   K LEY +I    + V RV+ T +G    ++N++ HWLKVP++MFLPYL+  +   +   K  +L                                       + R  S    +KR + E  AT+ N       P FE + TAK         +P  +  +L   E+               +E++ V+ ++ +G LL+ LK+PKFILH L +E Y+    T  F   +  LD  +   KP + I V  HFRQ L
Sbjct:    6 NLDELPTVTEALKMPYQTYLKHARGVLEFKEYCQMGLTESLEKVHEWCVHLKCLSAIDPCIPSRKNDTADKLVFLQSSVMITPYPTDSIGNASFLDANSSIFDKN----HSVLNFMKVFGYNKSKCYDDYLCDQVEMSGPNHGILGFTCFILCLYGIVSNLVLLPAYNIGLNRSGATIYLSAMSIFDIAYMALTLLVVTSRYMPADFSTQMETYAQFSARFVPIGAPIMLFCELVVVWLTVALLANRLLYLKFGFQSKYLCSQLQSVKSITALVLFGLAYASCKMLEYTLIKNDHMNVFRVVLTPIGNTSLYKNLMYHWLKVPLQMFLPYLSVGLLVSLVVTKMLNLHKSKWKAVASLCNDTACACVCRTGVCGNECQEGVSNPTKWSRSQSPEFGSKRYSTEKTATETN-------PVFETQPTAKL--------LPGQLCETLDHIEEELSYLYFQLPQVDETREHANVITTVCIGLLLLILKVPKFILHILSTEDYIVYNPT-IFALTDQVLDTIFAACKPTVCILVGAHFRQAL 523          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. TrEMBL
Match: G4VD86 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_128170 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.858e-73
Identity = 165/529 (31.19%), Postives = 275/529 (51.98%), Query Frame = 1
Query:   97 DSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQL-----------MNVVGYNGT-CYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEAS-------------------------------------KNKRRNAELNAT-----DENDVKSMMFPEFEKDTAKFPSLT-VDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVLKSVFCC 1518
            D    +D LP+ +D  K+S E Y   +  V +++  C    AE  +K+++WC+ L C+   + C   P  +       + LI  ++   H +  S    L           M ++  N T CYDDY C+++  +   H ILG+ CL +CL GI++  +  P +N   +R+G T+YL+A+AI DC++M L  +I VI Y+P  +  Q++MY +F+ +LIP+GLP +Q+ ELL VW+TVA+L +R LYL  G HSK +CS+  S KI+ +++ L + Y   KF EY  + YP   V+RV+ T++G  E F++++ +WLKVP+EMFLPYLA  +      +K  +L   +  + AS                                      N+ ++ ++ +T     D+ND     F    ++   F +L  ++  +  +     +  E +EN+ V+ ++ +G +L+  KIPKF+LH + +E Y+     + F+ +N  LD  +   KP+I I V  H+RQ L +   C
Sbjct:    2 DQLGRIDELPSVDDVFKNSYEVYRNYSLDVLKYKEFCQYGLAESIKKVHDWCIHLQCLSPSDPCS--PMSDEEYQKRHVGLIIPVTSSYHNVTPSVEKSLPNSSSLSVFNYMQLIANNITGCYDDYICDKQYNSYPNHCILGVVCLTLCLCGIISNIVLFPAYNFGLNRSGATVYLSAMAIFDCVFMGLSLLINVIHYLPPSFIEQMEMYGQFSGYLIPYGLPVIQICELLVVWLTVALLTNRLLYLNLGPHSKSLCSQLESVKIVTAVIFLCIAYMGCKFFEYTYVEYPDKKVVRVLLTQLGKTEMFRDIMDNWLKVPLEMFLPYLACGLLITTIVLKMVNLHTSKWKAVASLCNETACACVCRTGVCGKECREGVKSDDLSKSWSSDFNNQEKSGQVKSTKQSTPDKNDTFQKSFTGINRNNGNFTNLDPIEQELAYLFFQLPQLDETRENANVITAVCIGLILLICKIPKFLLHVISTENYITY-DPEVFRMINQLLDTMFAACKPMICILVGAHYRQALTTPSTC 527          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. TrEMBL
Match: A0A183K1F2 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8815 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 4.559e-73
Identity = 168/525 (32.00%), Postives = 273/525 (52.00%), Query Frame = 1
Query:   97 DSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKI---PPYPETGVXXXXXXXXXXXXXQP---HPLVTSSYSQLMNVVGYNGT----CYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLA--------------------DAIFSVIN-------------------SIKFYDLMYKRKLSEASKNKRRNAELNAT-----DENDVKSMMFPEFEKDTAKFPSLT-VDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVLKS 1506
            D    +D LP  +D  K S E Y   +  V +++  C    AE  EK++EWC+ L C+   + C       Y +  +   +    S +++ P     L  SS   + N + + G     CYDDY C+++  +   H ILG+ C  +CL GI++  +  P +N   +R+G T+YL+A+AI DC++M L  +I VI Y+P  +  Q++MY +F+ +LIP+GLP +Q+ ELL VW+T+A+LI+R LYL  G HSK +CS+  S KI+ ++  L + Y   KF EY  + YP   V+RV+ T++G  E F++++ +WLKVP+EMFLPYLA                     A+ S+ N                    +K  DL   +  S    N+ ++ ++  T     D+ND     F    ++   F +L  ++  +  +     +  E +EN+ V+ ++ +G +L+  KIPKF+LH + +E Y+     + F+ +N  LD  +   KPII I V  H+RQ L +
Sbjct:    2 DQLYRIDELPNVDDVFKHSYEVYRNYSLDVLKYKEFCQYGLAESIEKVHEWCIHLQCLSPSDPCSPMSGAEYEKRHIGLITPPTSSYLNVSPPVEESLPNSSSISVFNYMQHIGNNVTGCYDDYICDKQYNSYPNHCILGVVCFTLCLCGIISNIVLFPAYNFGLNRSGATVYLSAMAIFDCVFMGLSLLINVIHYLPPSFIEQMEMYGQFSGYLIPYGLPVIQICELLVVWLTIALLINRLLYLNLGPHSKSLCSQLESVKIVIAVFFLCIAYMGCKFFEYTYVEYPDKKVVRVLLTQLGKTEMFRDIMDNWLKVPLEMFLPYLACGLLITTIVLKMVNLHTSKWKAVASLCNETACACVCRTGVCGKECREGVKSEDL--SKSWSSDFNNQEKSGKVTNTKQSTPDKNDTFQKSFTSTNRNNGNFTNLDPIEQELSYLFFQLPQLDETRENANVITAVCIGLILLICKIPKFLLHVISTENYITY-DPEVFRMINQLLDTMFAACKPIICILVGAHYRQALTT 523          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. TrEMBL
Match: A0A183P0P9 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS7935 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.504e-72
Identity = 169/538 (31.41%), Postives = 272/538 (50.56%), Query Frame = 1
Query:   97 DSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQLMNV----------------------VGYNGT-CYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLA--------------------DAIFSVIN-------------------SIKFYDLMYKRKLSEASKNKRRNAELNAT-----DENDVKSMMFPEFEKDTAKFPSLT-VDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVLKS 1506
            D    +D LP  +D  K S E Y   +  V +++  C    AE   K++EWC+ L C+   + C     P +G       +          L+T + S  +NV                      +G N T CYDDY C+++  +   H ILG+ C I+CL GI++  +  P +N   +R+G T+YL+A+AI DC++M L  +I VI Y+P  +  Q++MY +F+ +LIP+GLP +Q+ ELL VW+T+A+LI+R LYL  G HSK +CS+  S KI+ ++  L + Y   KF EY  + YP   V+RV+ T++G  E F++++ +WLKVP+EMFLPYLA                     A+ S+ N                    +K  DL   +  S    N+ ++ ++  T     D+ND     F    ++   F +L  ++  +  +     +  E +EN+ V+ ++ +G +L+  KIPKF+LH + +E Y+     + F+ +N  LD  +   KP+I I V  H+RQ L +
Sbjct:    2 DQLYRIDELPNVDDVFKHSYEVYRNYSLDVLKYKEFCQYGLAESINKIHEWCIHLQCLSPSDPCS----PMSGAEYEKRHMG---------LITPATSSYLNVGPPVEESLPNSSSISVFNYMQHIGNNITGCYDDYICDKQYNSYPNHCILGVVCFILCLCGIISNIVLFPAYNFGLNRSGATVYLSAMAIFDCVFMGLSLLINVIHYLPPSFIEQMEMYGQFSGYLIPYGLPVIQICELLVVWLTIALLINRLLYLNLGPHSKSLCSQLESVKIVIAVFFLCIAYMGCKFFEYTYVEYPDKKVVRVLLTQLGKTEMFRDIMDNWLKVPLEMFLPYLACGLLITTIVLKMVNLHTSKWKAVASLCNETACACVCRTGVCGKECREGVKSEDL--SKSWSSDFNNQEKSGKVTNTKQSTPDKNDTFQKSFTSTNRNNGNFTNLDPIEQELSYLFFQLPQLDETRENANVITAVCIGLILLICKIPKFLLHVISTENYITYDP-EVFRMINHLLDTMFAACKPMICILVGAHYRQALTT 523          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. TrEMBL
Match: A0A504YFJ7 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_10830 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.128e-72
Identity = 172/524 (32.82%), Postives = 265/524 (50.57%), Query Frame = 1
Query:  109 SLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIP--------------------PYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQLMNVVGYNGT-CYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEAS----------------KNKRRNAELNATDENDVKSMMFPEFEKDTAKFPSLT--------VDSNMPKVITSSLKDAED---------------KENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVL 1500
            +LD LPT  +ALK   + Y K A GV E +  C     E  EK++EWCV L C+ + + C IP                    PYP   + + S    ++     +     S    M V GYN + CYDDY C+Q  ++   H ILG TC I+CL GI++  + LP +N+  +R+G T+YL+A++I D  YM L  ++V  +Y+P +++SQ++ Y++F+A  +P G P +   EL+ VW+TVA+L +R LYLKFGF SK +CS+  S K I ++++  L Y   K LEY +I    + V RV+ T +G    ++N++ HWLKVP++MFLPYL+  +   +   K  +L   +  + AS                 N+ +    N T  +  +S  F      T K  + T            +P  +  +L   E+               +E++ V+ ++ +G LL+ LK+PKFILH L +E Y+    T  F   +  LD  +   KP + I V  HFRQ L
Sbjct:    6 NLDELPTVTEALKMPYQTYLKHARGVLEFKEYCQMGLTESLEKVHEWCVHLKCLSASDPC-IPSRTNDTADELVFLESSAMTTPYPTDSIRNASFLDSNSSIFDKN----HSVLNFMKVFGYNKSKCYDDYLCDQVEMSGPNHGILGFTCFILCLYGIVSNLVLLPAYNIGLNRSGATIYLSAMSIFDIAYMALTLLVVTSRYMPADFSSQMETYAQFSARFVPIGAPIMLFCELVVVWLTVALLANRLLYLKFGFQSKYLCSQLQSVKSITALVLFGLAYASCKMLEYTLIKNDHMNVFRVVLTPIGNTSLYKNLMYHWLKVPLQMFLPYLSVGLLVSLVVTKMLNLHKSKWKAVASLCNDTACACVCRTGVCGNECQEGVSNPTKWSRSQSPEFGSKRYSTGKSATETNPVYETQPTAKLLPGQLCETLDHIEEELSYLYFQLPQVDETREHANVITTVCIGLLLLILKVPKFILHILSTEDYIVYNPT-IFALTDQVLDTIFAACKPTVCILVGAHFRQAL 523          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Planmine SMEST
Match: SMESG000036502.1 (SMESG000036502.1)

HSP 1 Score: 1024.62 bits (2648), Expect = 0.000e+0
Identity = 541/541 (100.00%), Postives = 541/541 (100.00%), Query Frame = 1
Query:   88 MAEDSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEASKNKRRNAELNATDENDVKSMMFPEFEKDTAKFPSLTVDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVLKSVFCCTEFDNDTVIKVCPATKMTEMANLYLQNAAEFSSNSNSHSGEEKEHSKFLEDKDEGLIMKTDVDV 1710
            MAEDSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVISTSISLISTISIQPHPLVTSSYSQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHSKIICSRKASAKIIASILILLLIYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEASKNKRRNAELNATDENDVKSMMFPEFEKDTAKFPSLTVDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVLKSVFCCTEFDNDTVIKVCPATKMTEMANLYLQNAAEFSSNSNSHSGEEKEHSKFLEDKDEGLIMKTDVDV
Sbjct:    1 MAEDSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVISTSISLISTISIQPHPLVTSSYSQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHSKIICSRKASAKIIASILILLLIYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEASKNKRRNAELNATDENDVKSMMFPEFEKDTAKFPSLTVDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHFRQVLKSVFCCTEFDNDTVIKVCPATKMTEMANLYLQNAAEFSSNSNSHSGEEKEHSKFLEDKDEGLIMKTDVDV 541          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Planmine SMEST
Match: SMESG000007358.1 (SMESG000007358.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.303e-29
Identity = 116/467 (24.84%), Postives = 209/467 (44.75%), Query Frame = 1
Query:   94 EDSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEA-SKNKRRNAELNATDENDVKSMMFPEFEKDTAKFPSLTVDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQY-VDLKSTKFFQPVNDFLDLSWVFLKPIIFICVAKHF 1488
            +  ++ LD LP  ++AL   K  + K A     +   C   +  + +K+ +WC  L C             + GV +      S      + ++T++      V      CYD ++C+    A   +Y +G+ C +  ++ ++   ++LP F +   R G  + LT++ + + I +I    I  I ++   +  QL +YS++ A  IP+ LP     + +  WI   +L +R+LY + G H+K+I S K     I   +I+L  +T+ K  E  V   P  G   V +T++G NE+F N++ +WLKVP+E F P L          I    +MY     +  S NK                      EK  A +  L    N+  V      +  ++E+ +++  L++  + I +K+PKFI H L +E+  V      +       LD  ++F+KP I+I ++ ++
Sbjct:    2 DTDTALLDKLPFLDEALSLPKSEFNKIAKAFINYSAYC--DYFLLPDKVDDWCKKLGC-------------QNGVCTYLFDDASVT----NAVITTT----PKVAALAKHCYDIFFCSPSWSAGINYYSIGVACFVFLVVALIMNIIYLPSFTLYGQRNGTDILLTSLVLCNIILIIFTIYIDCIPFVQKSHEQQLYLYSKYVALFIPYILPLQSFFQTMDSWILCLLLFERYLYQQHGKHAKLIFSTKTIIVTILCFIIVLFGFTVVKCFEMTVALKPS-GAYSVHFTDIGMNENFHNLITNWLKVPLEYFGPLLG--------FIALLSMMYTSLGEQGISMNKLT--------------------EKKCANYKKLI--KNLVIV------NESEREDRILISVLLMSTMAIVIKLPKFIHHILVNEEANVSFDRLHYIMLSYIVLDAIFIFMKPFIYIYISPNY 408          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Planmine SMEST
Match: SMESG000019555.1 (SMESG000019555.1)

HSP 1 Score: 114.39 bits (285), Expect = 1.097e-26
Identity = 124/482 (25.73%), Postives = 210/482 (43.57%), Query Frame = 1
Query:  109 SLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEKLYEWCVALNCVGSLENCKIPPYPETGVXXXXXXXXXXXXXQPHPLVTSSYSQLMN-------VVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVA-SHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPY--EYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHXXXXXXXXXXXXXXXXXXXXXXXYTIPKFLEYHVINYP-KLGVLRVMYTEVGFNESFQNMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEASKNKRRNAELNATDENDVKSMMFPEFEKDTAKFPSLTVDSNMPKVITSSLKDAEDKENSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDLSWVFLKP-IIFICVAKHFRQVLKSVFCC 1518
            SLD L    +AL   K  +YK       H + C S    + EK+ +WC  L C G    CK     E                   P++ S    L N       ++ YNG+C+D Y+C     +   HY+LG+  +++ +   + + ++L  F+     +   TL L    I D I+ +LFT+I ++    +   +T QL +YS F  + + +  P   L E LS WI + ++ DRF YL  G HSK + + K  + ++ S+ I L+ ++I K   Y +   P      R+ Y+++G +E+FQN++  WLK+P+E  LP     IF V+       + +K   + +  +K  ++E++  +    KS++F                                          I   LL+A K+PK  LH LK E  ++L     F    +F D  + F+K   ++  +   F   +++ FCC
Sbjct:    2 SLDDLIPINEALLLDKSKFYKIIKEFMPHSSYCGSML--IPEKMTDWCSYLQCDGI--TCKNEIISEA---------------LSKPILPSIVQNLCNQNITRDPILSYNGSCFDVYFCAPVWASKDYHYVLGVFGMLLAIFSFIFSMVYLTGFHREFGKKNTRTLLLITHTICD-IFYLLFTMIGLLSMYSFYSNFTDQLKIYSSFHIYFVSYLQPFTDLFESLSFWILILLIFDRFNYLHHGTHSKNLLTNKVCSVLVGSVSISLVAFSILKLFTYELEKLPISTENYRLKYSKIGKSENFQNLIRFWLKMPMESLLPLTTVFIFIVM-------VCHKLIFASSLNSKLNSSEIDFQEFRLTKSILF------------------------------------------ICCILLLA-KVPKMALHILKFEIGIELDMEIKFHLFVEFFDQIYYFIKSCFLYRYMCPKFSSFIQNAFCC 413          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Planmine SMEST
Match: SMESG000026416.1 (SMESG000026416.1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.942e-21
Identity = 53/145 (36.55%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  373 VTSSYSQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIP-YEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLK 804
            ++S  S L  +V    +CYDDYYCN   +A   H + G+  LI+ L G++   L +PV ++   R+  T Y+ A+AI D   +I+  ++VVI+Y+P  E   QL MY  F A L+P G P   + ++LS+    A++ DR+ YL+
Sbjct:   28 ISSETSSLSKIV----SCYDDYYCNNYELAHLGHVLFGVFGLILTLAGLILNILLIPVMSLVGIRSSATYYMIAMAISDSCLLIINLILVVIRYLPGAEQMDQLLMYQNFVAFLVPFGSPAKSVCQILSLCFCTALIWDRYSYLR 168          
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Planmine SMEST
Match: SMESG000026416.1 (SMESG000026416.1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.551e-21
Identity = 53/145 (36.55%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  373 VTSSYSQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLFLPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIP-YEYTSQLDMYSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLK 804
            ++S  S L  +V    +CYDDYYCN   +A   H + G+  LI+ L G++   L +PV ++   R+  T Y+ A+AI D   +I+  ++VVI+Y+P  E   QL MY  F A L+P G P   + ++LS+    A++ DR+ YL+
Sbjct:   19 ISSETSSLSKIV----SCYDDYYCNNYELAHLGHVLFGVFGLILTLAGLILNILLIPVMSLVGIRSSATYYMIAMAISDSCLLIINLILVVIRYLPGAEQMDQLLMYQNFVAFLVPFGSPAKSVCQILSLCFCTALIWDRYSYLR 159          
The following BLAST results are available for this feature:
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RWM62.509e-7332.34Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
G4VD862.858e-7331.19Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183K1F24.559e-7332.00Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A183P0P91.504e-7231.41Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A504YFJ72.128e-7232.82Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide receptor isoform X1 isoform 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036502.10.000e+0100.00SMESG000036502.1[more]
SMESG000007358.11.303e-2924.84SMESG000007358.1[more]
SMESG000019555.11.097e-2625.73SMESG000019555.1[more]
SMESG000026416.14.942e-2136.55SMESG000026416.1[more]
SMESG000026416.15.551e-2136.55SMESG000026416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027736 ID=SMED30027736|Name=FMRFamide receptor isoform X1 isoform 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2067bp
TTTCGTTTGTTTAGTTATAACATTCAATGTAAATATTCTGTAACGATATT
TCAATTTTAGATATTTAGCTGCTAATTTTGACTTATCATGGCAGAAGATA
GCTCTAGTTCATTAGATCTATTACCTACTTATGAAGATGCTCTCAAATCA
TCAAAAGAAGCATATTATAAAGCGGCAAATGGTGTTTTTGAACACCGAAC
AACTTGTTTAAGTTCTTTTGCCGAGGTTTATGAGAAACTCTATGAATGGT
GTGTAGCTCTAAATTGTGTAGGAAGCTTAGAAAATTGTAAGATTCCTCCT
TATCCCGAGACTGGGGTTATTTCAACTTCAATTTCACTAATATCCACTAT
TTCAATTCAACCACACCCATTAGTTACTTCATCTTATAGTCAATTGATGA
ATGTAGTTGGCTACAATGGAACGTGTTATGATGATTATTATTGTAATCAA
CGTTCAGTTGCTCCTTACTTGCATTACATTCTCGGAATCACGTGCTTGAT
TATGTGTCTAATTGGTATATTGACTACATCGCTGTTTTTGCCTGTTTTTA
ACGTTGCAAGCCATCGTACAGGTGTAACACTTTATCTCACTGCAATAGCA
ATAATAGATTGTATATATATGATTTTATTCACAGTCATAGTTGTTATTCA
ATATATCCCATACGAATACACAAGTCAATTGGATATGTATTCTCGCTTCA
CAGCTCATCTTATACCCCATGGATTACCCACATTGCAATTGATGGAACTT
TTATCTGTTTGGATAACAGTTGCAGTTCTTATCGATCGATTTCTCTACCT
GAAATTTGGATTCCATTCTAAAATAATCTGCTCCAGGAAGGCGAGCGCCA
AAATAATTGCATCAATTTTGATATTATTATTAATTTACACTATACCAAAG
TTTCTGGAATACCATGTTATTAATTATCCTAAATTAGGAGTATTAAGGGT
CATGTACACAGAGGTTGGGTTCAATGAATCGTTCCAGAATATGCTTCTTC
ATTGGTTAAAAGTCCCAATTGAAATGTTTCTTCCGTATTTAGCTGATGCC
ATATTTTCTGTTATTAACTCAATCAAATTCTACGATCTTATGTATAAAAG
AAAACTTTCAGAAGCCTCGAAAAATAAACGAAGAAATGCTGAATTAAATG
CAACAGATGAAAATGATGTTAAATCAATGATGTTTCCTGAATTTGAAAAA
GATACCGCCAAGTTTCCATCTCTGACAGTCGATTCTAATATGCCGAAAGT
CATAACATCCAGTTTAAAAGATGCAGAAGATAAAGAAAATTCAATGGTGG
TAATGTCTTTGATATTGGGATTTCTGTTAATTGCCCTGAAAATTCCAAAA
TTCATTTTGCATGCTCTCAAGTCAGAACAATATGTGGATTTGAAATCTAC
GAAATTTTTTCAGCCAGTAAATGATTTTCTCGATTTGAGTTGGGTGTTTT
TGAAACCGATTATATTCATTTGTGTTGCTAAACATTTCCGACAAGTTCTC
AAATCCGTATTCTGTTGTACTGAATTTGACAATGACACGGTAATTAAAGT
CTGTCCGGCTACTAAGATGACAGAAATGGCCAATTTGTATCTGCAAAATG
CGGCAGAGTTTAGCAGCAATAGCAATAGTCACAGTGGAGAAGAAAAGGAA
CACTCAAAATTTCTGGAAGATAAAGATGAAGGATTAATCATGAAAACCGA
TGTAGATGTTTGATTTTTTGGTACTAACGGAAATTAAATGGATTGAGATT
AACTTAGTCCGCATTCACAAAGATCTGTTTTTTTACTTTATTACTTATTT
ACTGGGTAATATTTGTGCTTTGTCTTTTGTTATTATTATTAATATTATTA
TTACGAAAAAGGCAAAGAATACCCGGTGATATATATTTATACATACACAT
ACATATATTTTGTTTTTTTTTCTTTTGCGACTTTTGCTTCAACAATTTAT
CGGTGAAATAAAGAAAATGACCGAAAGAAAAAAAAACCCAACAAATGCCT
TTGATATTTTTAGTACTATCTTGCTTTTTTTAAGTTGTTTACTTTTTGTT
TTTTTTCTCTAATTTAT
back to top

protein sequence of SMED30027736-orf-1

>SMED30027736-orf-1 ID=SMED30027736-orf-1|Name=SMED30027736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
MAEDSSSSLDLLPTYEDALKSSKEAYYKAANGVFEHRTTCLSSFAEVYEK
LYEWCVALNCVGSLENCKIPPYPETGVISTSISLISTISIQPHPLVTSSY
SQLMNVVGYNGTCYDDYYCNQRSVAPYLHYILGITCLIMCLIGILTTSLF
LPVFNVASHRTGVTLYLTAIAIIDCIYMILFTVIVVIQYIPYEYTSQLDM
YSRFTAHLIPHGLPTLQLMELLSVWITVAVLIDRFLYLKFGFHSKIICSR
KASAKIIASILILLLIYTIPKFLEYHVINYPKLGVLRVMYTEVGFNESFQ
NMLLHWLKVPIEMFLPYLADAIFSVINSIKFYDLMYKRKLSEASKNKRRN
AELNATDENDVKSMMFPEFEKDTAKFPSLTVDSNMPKVITSSLKDAEDKE
NSMVVMSLILGFLLIALKIPKFILHALKSEQYVDLKSTKFFQPVNDFLDL
SWVFLKPIIFICVAKHFRQVLKSVFCCTEFDNDTVIKVCPATKMTEMANL
YLQNAAEFSSNSNSHSGEEKEHSKFLEDKDEGLIMKTDVDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 96..516
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 130..366
e-value: 1.50836E-16
score: 78.4436
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 105..480
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 405..427
NoneNo IPR availableTMHMMTMhelixcoord: 309..331
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
NoneNo IPR availableTMHMMTMhelixcoord: 447..464
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 146..460
score: 8.636