NAD-dependent protein deacetylase

Overview
NameNAD-dependent protein deacetylase
Smed IDSMED30027733
Length (bp)3133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NAD-dependent protein deacetylase (SMED30027733) t-SNE clustered cells

Violin plots show distribution of expression levels for NAD-dependent protein deacetylase (SMED30027733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NAD-dependent protein deacetylase (SMED30027733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NAD-dependent protein deacetylase (SMED30027733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30027733SMESG000079800.1 SmedASXL_007306SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027733SMESG000079800.1 dd_Smed_v4_21545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027733SMESG000079803.1 dd_Smed_v6_10955_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027733SMESG000079800.1 dd_Smed_v6_21545_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027733SMESG000079800.1 dd_Smed_v6_21545_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027733SMESG000079803.1 dd_Smed_v4_10955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NAD-dependent protein deacetylase vs. Ensembl Human
Match: SIRT3 (sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931])

HSP 1 Score: 191.045 bits (484), Expect = 2.209e-53
Identity = 93/168 (55.36%), Postives = 116/168 (69.05%), Query Frame = 2
Query:  290 SGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
             G DD     D+ + I     + +V+M GAGIS PSGIPDFRSPG+GLY NL+QY +PYPEAIF++ +F  NPKPFF LAKEL+P G Y+PN  HYF RLL +K LL R+YTQNIDGLER++G+  + LVEAHGTFASA+C  C     GED  A  +  +     +C
Sbjct:   41 GGRDD-----DVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP-GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVC 202          

HSP 2 Score: 96.6709 bits (239), Expect = 6.004e-21
Identity = 52/99 (52.53%), Postives = 61/99 (61.62%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQT----SVSELAG 1390
            C  C G+VKPDIVFFGE LP +F L   DF  ADLLL++GTSLEVEPFAS+ ++ R   PR+LINR  VG      R  D   LG       S+ EL G
Sbjct:  199 CPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLG 297          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Human
Match: SIRT3 (sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931])

HSP 1 Score: 191.045 bits (484), Expect = 5.248e-53
Identity = 85/146 (58.22%), Postives = 110/146 (75.34%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK 757
            D+ + I     + +V+M GAGIS PSGIPDFRSPG+GLY NL+QY +PYPEAIF++ +F  NPKPFF LAKEL+P G Y+PN  HYF RLL +K LL R+YTQNIDGLER++G+  + LVEAHGTFASA+C  C   +    ++++
Sbjct:  127 DVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP-GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRVE 271          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Human
Match: SIRT3 (sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931])

HSP 1 Score: 191.045 bits (484), Expect = 1.919e-52
Identity = 90/158 (56.96%), Postives = 113/158 (71.52%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            D+ + I     + +V+M GAGIS PSGIPDFRSPG+GLY NL+QY +PYPEAIF++ +F  NPKPFF LAKEL+P G Y+PN  HYF RLL +K LL R+YTQNIDGLER++G+  + LVEAHGTFASA+C  C     GED  A  +  +     +C
Sbjct:  127 DVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP-GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVC 283          

HSP 2 Score: 96.2857 bits (238), Expect = 2.396e-20
Identity = 48/85 (56.47%), Postives = 56/85 (65.88%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLG 1360
            C  C G+VKPDIVFFGE LP +F L   DF  ADLLL++GTSLEVEPFAS+ ++ R   PR+LINR  VG      R  D   LG
Sbjct:  280 CPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLG 364          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Human
Match: SIRT3 (sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931])

HSP 1 Score: 182.57 bits (462), Expect = 3.026e-51
Identity = 87/142 (61.27%), Postives = 105/142 (73.94%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            M GAGIS PSGIPDFRSPG+GLY NL+QY +PYPEAIF++ +F  NPKPFF LAKEL+P G Y+PN  HYF RLL +K LL R+YTQNIDGLER++G+  + LVEAHGTFASA+C  C     GED  A  +  +     +C
Sbjct:    1 MVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP-GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVC 141          

HSP 2 Score: 97.4413 bits (241), Expect = 9.497e-22
Identity = 52/99 (52.53%), Postives = 61/99 (61.62%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQT----SVSELAG 1390
            C  C G+VKPDIVFFGE LP +F L   DF  ADLLL++GTSLEVEPFAS+ ++ R   PR+LINR  VG      R  D   LG       S+ EL G
Sbjct:  138 CPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLG 236          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Human
Match: SIRT2 (sirtuin 2 [Source:HGNC Symbol;Acc:HGNC:10886])

HSP 1 Score: 176.792 bits (447), Expect = 1.639e-49
Identity = 87/176 (49.43%), Postives = 123/176 (69.89%), Query Frame = 2
Query:  245 MIYLSSTFGRYLSTPSGTD---DQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCV--RCGEDYSATQLKLK 757
            M +L + F + LS  S  +   D+  +  + + + + + + ++ + GAGIS  +GIPDFRSP TGLYDNL++Y +PYPEAIF+I YF ++P+PFFALAKEL+P G+++P   HYF RLL++K LL R YTQNID LER+AGL   +LVEAHGTF ++ CV   C  +Y  + +K K
Sbjct:    1 MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYP-GQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEK 175          

HSP 2 Score: 60.4622 bits (145), Expect = 2.548e-9
Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSK-FHLFRSDFQQADLLLVMGTSLE 1237
            C  C+ +VKPDIVFFGE LP++ F   +SDF + DLLLVMGTSL+
Sbjct:  184 CEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQ 228          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 119.398 bits (298), Expect = 1.420e-27
Identity = 58/135 (42.96%), Postives = 85/135 (62.96%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            K+I+++ GAG+S   GIPDFRS   G+Y  L+     +P P A+FDI YF +NP PF+  A+E+FP G++ P+  H F + L+    L R YTQNID LE   G+    +VE HG+F+  +C RCG+ Y   +++
Sbjct:  116 KHILVLTGAGVSVSCGIPDFRSKD-GIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFP-GQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIK--RVVECHGSFSKCTCTRCGQKYDGNEIR 246          

HSP 2 Score: 71.633 bits (174), Expect = 1.588e-12
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  998 IINC-GSLSKNSLSNISGPKASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNC 1351
            ++ C GS SK + +   G K       E +    + +C +C G++KP+IVFFGEDL  +FH     D  + DL++V+G+SL+V P A I        P++LINR+ +  + +   +  NC
Sbjct:  221 VVECHGSFSKCTCTRC-GQKYDGNEIREEVLAMRVAHCKRCEGVIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNC 339          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 119.398 bits (298), Expect = 1.420e-27
Identity = 58/135 (42.96%), Postives = 85/135 (62.96%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            K+I+++ GAG+S   GIPDFRS   G+Y  L+     +P P A+FDI YF +NP PF+  A+E+FP G++ P+  H F + L+    L R YTQNID LE   G+    +VE HG+F+  +C RCG+ Y   +++
Sbjct:  116 KHILVLTGAGVSVSCGIPDFRSKD-GIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFP-GQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIK--RVVECHGSFSKCTCTRCGQKYDGNEIR 246          

HSP 2 Score: 71.633 bits (174), Expect = 1.588e-12
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  998 IINC-GSLSKNSLSNISGPKASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNC 1351
            ++ C GS SK + +   G K       E +    + +C +C G++KP+IVFFGEDL  +FH     D  + DL++V+G+SL+V P A I        P++LINR+ +  + +   +  NC
Sbjct:  221 VVECHGSFSKCTCTRC-GQKYDGNEIREEVLAMRVAHCKRCEGVIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNC 339          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 119.398 bits (298), Expect = 1.420e-27
Identity = 58/135 (42.96%), Postives = 85/135 (62.96%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            K+I+++ GAG+S   GIPDFRS   G+Y  L+     +P P A+FDI YF +NP PF+  A+E+FP G++ P+  H F + L+    L R YTQNID LE   G+    +VE HG+F+  +C RCG+ Y   +++
Sbjct:  116 KHILVLTGAGVSVSCGIPDFRSKD-GIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFP-GQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIK--RVVECHGSFSKCTCTRCGQKYDGNEIR 246          

HSP 2 Score: 71.633 bits (174), Expect = 1.588e-12
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  998 IINC-GSLSKNSLSNISGPKASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNC 1351
            ++ C GS SK + +   G K       E +    + +C +C G++KP+IVFFGEDL  +FH     D  + DL++V+G+SL+V P A I        P++LINR+ +  + +   +  NC
Sbjct:  221 VVECHGSFSKCTCTRC-GQKYDGNEIREEVLAMRVAHCKRCEGVIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNC 339          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 119.398 bits (298), Expect = 1.534e-27
Identity = 58/135 (42.96%), Postives = 85/135 (62.96%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            K+I+++ GAG+S   GIPDFRS   G+Y  L+     +P P A+FDI YF +NP PF+  A+E+FP G++ P+  H F + L+    L R YTQNID LE   G+    +VE HG+F+  +C RCG+ Y   +++
Sbjct:  146 KHILVLTGAGVSVSCGIPDFRSKD-GIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFP-GQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIK--RVVECHGSFSKCTCTRCGQKYDGNEIR 276          

HSP 2 Score: 71.633 bits (174), Expect = 1.699e-12
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  998 IINC-GSLSKNSLSNISGPKASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNC 1351
            ++ C GS SK + +   G K       E +    + +C +C G++KP+IVFFGEDL  +FH     D  + DL++V+G+SL+V P A I        P++LINR+ +  + +   +  NC
Sbjct:  251 VVECHGSFSKCTCTRC-GQKYDGNEIREEVLAMRVAHCKRCEGVIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNC 369          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 119.398 bits (298), Expect = 1.534e-27
Identity = 58/135 (42.96%), Postives = 85/135 (62.96%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            K+I+++ GAG+S   GIPDFRS   G+Y  L+     +P P A+FDI YF +NP PF+  A+E+FP G++ P+  H F + L+    L R YTQNID LE   G+    +VE HG+F+  +C RCG+ Y   +++
Sbjct:  146 KHILVLTGAGVSVSCGIPDFRSKD-GIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFP-GQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIK--RVVECHGSFSKCTCTRCGQKYDGNEIR 276          

HSP 2 Score: 71.633 bits (174), Expect = 1.699e-12
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  998 IINC-GSLSKNSLSNISGPKASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNC 1351
            ++ C GS SK + +   G K       E +    + +C +C G++KP+IVFFGEDL  +FH     D  + DL++V+G+SL+V P A I        P++LINR+ +  + +   +  NC
Sbjct:  251 VVECHGSFSKCTCTRC-GQKYDGNEIREEVLAMRVAHCKRCEGVIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNC 369          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Fly
Match: Sirt2 (gene:FBgn0038788 transcript:FBtr0083882)

HSP 1 Score: 171.014 bits (432), Expect = 2.651e-46
Identity = 77/133 (57.89%), Postives = 101/133 (75.94%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            + IV M GAGIS  +GIPDFRSPG+GLY NLK+Y++P+P AIFD+DYF +NP PFFALAKEL+P G + P   HYF RLL +K LL+R YTQNID L+RL GL +  ++EAHG+F +  C++C ++Y    +K
Sbjct:   48 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYP-GSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMK 179          

HSP 2 Score: 84.7297 bits (208), Expect = 4.001e-17
Identity = 42/71 (59.15%), Postives = 52/71 (73.24%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLF-RSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            C KC+G+VKPDIVFFGE+LP +F+     DFQ  DLL++MGTSLEV+PFAS+V        R+LINR  VG
Sbjct:  190 CQKCQGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVG 260          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Fly
Match: Sirt2 (gene:FBgn0038788 transcript:FBtr0344243)

HSP 1 Score: 171.014 bits (432), Expect = 2.651e-46
Identity = 77/133 (57.89%), Postives = 101/133 (75.94%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            + IV M GAGIS  +GIPDFRSPG+GLY NLK+Y++P+P AIFD+DYF +NP PFFALAKEL+P G + P   HYF RLL +K LL+R YTQNID L+RL GL +  ++EAHG+F +  C++C ++Y    +K
Sbjct:   48 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYP-GSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMK 179          

HSP 2 Score: 84.7297 bits (208), Expect = 4.001e-17
Identity = 42/71 (59.15%), Postives = 52/71 (73.24%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLF-RSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            C KC+G+VKPDIVFFGE+LP +F+     DFQ  DLL++MGTSLEV+PFAS+V        R+LINR  VG
Sbjct:  190 CQKCQGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVG 260          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Fly
Match: Sirt1 (gene:FBgn0024291 transcript:FBtr0080434)

HSP 1 Score: 124.02 bits (310), Expect = 1.920e-28
Identity = 58/130 (44.62%), Postives = 90/130 (69.23%), Query Frame = 2
Query:  338 LTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            L  K + I+++ GAG+S   GIPDFRS   G+Y  L      +P P+A+FDI+YF ++P+PF+  A+E++P G+++P+  H F ++L+ K  L R YTQNID LER+AG+    ++E HG+F++ASC +C
Sbjct:  217 LVKKSQKIIVLTGAGVSVSCGIPDFRS-TNGIYARLAHDFPDLPDPQAMFDINYFKRDPRPFYKFAREIYP-GEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAGIQ--RVIECHGSFSTASCTKC 342          

HSP 2 Score: 65.4698 bits (158), Expect = 2.515e-10
Identity = 32/63 (50.79%), Postives = 44/63 (69.84%), Query Frame = 2
Query: 1121 GIVKPDIVFFGEDLPSKFH-LFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQ 1306
            GI+KPDIVFFGE LP ++H +  +D    DLL+V+G+SL+V P A I  S     P++LINR+
Sbjct:  392 GIMKPDIVFFGEGLPDEYHTVMATDKDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQILINRE 454          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Fly
Match: Sirt6 (gene:FBgn0037802 transcript:FBtr0305358)

HSP 1 Score: 66.2402 bits (160), Expect = 3.827e-11
Identity = 48/173 (27.75%), Postives = 78/173 (45.09%), Query Frame = 2
Query:  278 LSTPSGTDDQKFIVDICQKI--LTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDY---SATQLKLKHSISEICE 781
            L  P   D  + + + CQ++  L  K  ++V+  GAGIS  +GIPDFR P                + ++ ++   +  KP F ++ +     + RP K H     L E   ++ V +QNIDGL   +GL+   L E HG      C +C   +   SA +   + S+   C+
Sbjct:   18 LGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGP----------------KGVWTLEE--KGEKPDFNVSFD-----EARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACK 167          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Fly
Match: Sirt4 (gene:FBgn0029783 transcript:FBtr0070852)

HSP 1 Score: 65.855 bits (159), Expect = 5.511e-11
Identity = 48/149 (32.21%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  287 PSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNP---KPFFALAKELFPS-GKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            P   DD K + D     L SK  N++++ GAGIS  SGIPD+RS G GLY       + + E       F+++    K ++A     +P     +PN  H+     + ++ ++ V TQN+D L   AG    N+VE HG+     C+ C
Sbjct:   29 PVVEDDIKRLEDF----LLSK-PNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHME-------FVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVHGSGYVVKCLSC 163          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Zebrafish
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 203.371 bits (516), Expect = 2.146e-57
Identity = 95/149 (63.76%), Postives = 116/149 (77.85%), Query Frame = 2
Query:  305 QKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            Q+ + DI +KI   K K IV+MAGAGIS PSGIPDFRSPG+GLYDNL+QY +PY EAIF+I+YF  NP PFFALAKEL+P G Y+PN  HYF R+L +K+ L R+YTQNIDGLER+AG+    LVEAHGTFA+A+C  C  DY   +L+
Sbjct:   85 QQTLEDIAEKIRERKFKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYNLPYAEAIFEINYFHHNPNPFFALAKELYP-GNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELR 232          

HSP 2 Score: 100.523 bits (249), Expect = 3.905e-22
Identity = 51/94 (54.26%), Postives = 62/94 (65.96%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELA 1387
            C  C+GI+KPDIVFFGE+LP  F  + +DF  ADLL+VMGTSLEVEPFAS+  + R   PR+LINR  VG F S  + H        T V+EL 
Sbjct:  243 CPTCKGIIKPDIVFFGEELPQHFFTYLTDFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGPFASGSQRH--------TDVAELG 328          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Zebrafish
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 203.371 bits (516), Expect = 2.184e-57
Identity = 95/149 (63.76%), Postives = 116/149 (77.85%), Query Frame = 2
Query:  305 QKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            Q+ + DI +KI   K K IV+MAGAGIS PSGIPDFRSPG+GLYDNL+QY +PY EAIF+I+YF  NP PFFALAKEL+P G Y+PN  HYF R+L +K+ L R+YTQNIDGLER+AG+    LVEAHGTFA+A+C  C  DY   +L+
Sbjct:   85 QQTLEDIAEKIRERKFKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYNLPYAEAIFEINYFHHNPNPFFALAKELYP-GNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELR 232          

HSP 2 Score: 100.523 bits (249), Expect = 4.113e-22
Identity = 51/94 (54.26%), Postives = 62/94 (65.96%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELA 1387
            C  C+GI+KPDIVFFGE+LP  F  + +DF  ADLL+VMGTSLEVEPFAS+  + R   PR+LINR  VG F S  + H        T V+EL 
Sbjct:  243 CPTCKGIIKPDIVFFGEELPQHFFTYLTDFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGPFASGSQRH--------TDVAELG 328          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Zebrafish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 196.052 bits (497), Expect = 1.067e-54
Identity = 92/159 (57.86%), Postives = 120/159 (75.47%), Query Frame = 2
Query:  278 LSTPSGTDDQKFIVDICQKILT-SKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            LS+PSG    +  ++   +++   +++NIV++AGAGIS  SGIPDFR+PGTGLY NL +Y IPYPEA+F+IDYF  NP PFF+LAKEL+P G +RPN VHYF R+L +K LL R+YTQNIDGLE+L G+ D  LVEAHG+FA+A+C  C   Y A + K
Sbjct:   67 LSSPSGRSVSRGALETIGRLMKLGRVRNIVVVAGAGISTASGIPDFRTPGTGLYANLAKYDIPYPEAVFNIDYFSDNPHPFFSLAKELYP-GHHRPNYVHYFIRMLHQKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATAACHLCYTPYPAEEAK 224          

HSP 2 Score: 90.1225 bits (222), Expect = 1.301e-18
Identity = 60/171 (35.09%), Postives = 90/171 (52.63%), Query Frame = 2
Query:  929 HHRSFHPQLWVKNLNG--KMC*FP*IINCGSLSKNSLSNISGPKASLIIYL-----------ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEV---EPFASIVDSTRFGTPRVLINRQPVGVF-RSKRRVHDNCVLGK-QTSVSELA 1387
            H +    +++ +N++G  K+C  P          + L    G  A+   +L           ++I    +  C+ C G VKP++VFFGEDLP K+     DF +ADLL++MGTSL+V   EPFAS++++ +   PR+L+NR  VG F R   R  D   LG    SV +LA
Sbjct:  172 HQKGLLLRMYTQNIDGLEKLCGIP---------DDKLVEAHGSFATAACHLCYTPYPAEEAKQAIMNGSVPICTFCAGAVKPNVVFFGEDLPEKYFQHAEDFPKADLLIIMGTSLKVGLIEPFASLINTVKSTVPRLLLNRDAVGPFERRPLRRADYMELGDLSESVRKLA 333          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Zebrafish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 196.438 bits (498), Expect = 1.279e-54
Identity = 92/159 (57.86%), Postives = 120/159 (75.47%), Query Frame = 2
Query:  278 LSTPSGTDDQKFIVDICQKILT-SKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            LS+PSG    +  ++   +++   +++NIV++AGAGIS  SGIPDFR+PGTGLY NL +Y IPYPEA+F+IDYF  NP PFF+LAKEL+P G +RPN VHYF R+L +K LL R+YTQNIDGLE+L G+ D  LVEAHG+FA+A+C  C   Y A + K
Sbjct:   89 LSSPSGRSVSRGALETIGRLMKLGRVRNIVVVAGAGISTASGIPDFRTPGTGLYANLAKYDIPYPEAVFNIDYFSDNPHPFFSLAKELYP-GHHRPNYVHYFIRMLHQKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATAACHLCYTPYPAEEAK 246          

HSP 2 Score: 94.7449 bits (234), Expect = 4.098e-20
Identity = 59/168 (35.12%), Postives = 91/168 (54.17%), Query Frame = 2
Query:  929 HHRSFHPQLWVKNLNG--KMC*FP*IINCGSLSKNSLSNISGPKASLIIYL-----------ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVF-RSKRRVHDNCVLGKQT-SVSELA 1387
            H +    +++ +N++G  K+C  P          + L    G  A+   +L           ++I    +  C+ C G VKP++VFFGEDLP K+     DF +ADLL++MGTSL++EPFAS++++ +   PR+L+NR  VG F R   R  D   LG  + SV +LA
Sbjct:  194 HQKGLLLRMYTQNIDGLEKLCGIP---------DDKLVEAHGSFATAACHLCYTPYPAEEAKQAIMNGSVPICTFCAGAVKPNVVFFGEDLPEKYFQHAEDFPKADLLMIMGTSLKIEPFASLINTVKSTVPRLLLNRDAVGPFERRPLRRADYMELGDLSESVRKLA 352          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Zebrafish
Match: sirt2 (sirtuin 2 (silent mating type information regulation 2, homolog) 2 (S. cerevisiae) [Source:NCBI gene;Acc:322309])

HSP 1 Score: 191.045 bits (484), Expect = 6.093e-53
Identity = 93/175 (53.14%), Postives = 125/175 (71.43%), Query Frame = 2
Query:  239 NEMIYLSSTFGRYLSTPSGTD--DQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLK 751
             EM +L S F R L    G    D+  +  + + IL+ K KNI+ M GAGIS  +GIPDFRSPGTGLY NL++Y +PYPEAIF IDYF ++P+PFFALA+EL+P G+++P   HYF ++L++K LLRR Y+QNID LER+AGL   +L+EAHGTF ++ CV   C ++YS   +K
Sbjct:   35 TEMDFLRSLFSRTLGLSPGDKVLDELTLDSVARYILSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFALARELYP-GQFKPTVCHYFIKMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSFLCRKEYSMDWMK 208          

HSP 2 Score: 85.1149 bits (209), Expect = 5.892e-17
Identity = 41/75 (54.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query: 1094 EICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            EI  C  C  +VKPDIVFFGE LPS+F    ++DF Q DLL++MGTSL+V+PFAS+V       PR+LIN +  G
Sbjct:  215 EIPKCDSCGSLVKPDIVFFGESLPSRFFTSMKADFPQCDLLIIMGTSLQVQPFASLVSRVSNRCPRLLINMEKTG 289          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Xenopus
Match: SIRT2 (sirtuin 2 [Source:NCBI gene;Acc:100489469])

HSP 1 Score: 196.052 bits (497), Expect = 6.536e-56
Identity = 100/177 (56.50%), Postives = 126/177 (71.19%), Query Frame = 2
Query:  239 NEMIYLSSTFGRYLS--TPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            +EM YL + F R L   TP    D+  I  I + +L+ K KN+V M GAGIS  +GIPDFRSPG+GLY NL++Y +PYPEAIF I YF +NP+PFFALA+ELFP G+++P   HYF RLL+EK LL R Y+QNID LER+AGL   +LVEAHGTF S+ CV   C  +YS + +K K
Sbjct:   12 SEMDYLRNLFSRTLGIGTPEKVLDELSIEGISRFMLSEKCKNVVCMVGAGISTSAGIPDFRSPGSGLYSNLQKYNLPYPEAIFQIGYFKENPEPFFALARELFP-GQFKPTICHYFIRLLKEKGLLLRCYSQNIDTLERVAGLTSDDLVEAHGTFHSSHCVDTFCRAEYSLSWMKEK 187          

HSP 2 Score: 54.6842 bits (130), Expect = 2.652e-7
Identity = 27/53 (50.94%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 1157 DLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            +L S+F    +DF + DLL+VMGTSL+V+PFAS+V      TPR+LIN++  G
Sbjct:  201 NLKSRF----TDFPKVDLLIVMGTSLQVQPFASLVSKVSSKTPRLLINKELAG 249          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Xenopus
Match: SIRT2 (sirtuin 2 [Source:NCBI gene;Acc:100489469])

HSP 1 Score: 194.512 bits (493), Expect = 7.773e-55
Identity = 100/177 (56.50%), Postives = 126/177 (71.19%), Query Frame = 2
Query:  239 NEMIYLSSTFGRYLS--TPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            +EM YL + F R L   TP    D+  I  I + +L+ K KN+V M GAGIS  +GIPDFRSPG+GLY NL++Y +PYPEAIF I YF +NP+PFFALA+ELFP G+++P   HYF RLL+EK LL R Y+QNID LER+AGL   +LVEAHGTF S+ CV   C  +YS + +K K
Sbjct:   12 SEMDYLRNLFSRTLGIGTPEKVLDELSIEGISRFMLSEKCKNVVCMVGAGISTSAGIPDFRSPGSGLYSNLQKYNLPYPEAIFQIGYFKENPEPFFALARELFP-GQFKPTICHYFIRLLKEKGLLLRCYSQNIDTLERVAGLTSDDLVEAHGTFHSSHCVDTFCRAEYSLSWMKEK 187          

HSP 2 Score: 74.7146 bits (182), Expect = 9.215e-14
Identity = 40/70 (57.14%), Postives = 48/70 (68.57%), Query Frame = 2
Query: 1058 SLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSK-FHLFRSDFQQADLLLVMGTSLEVEPFASIVD 1264
            SL    E I    I  C KC  +VKPDIVFFGE LPS+ F   +SDF + DLL+VMGTSL+V+PFAS+ D
Sbjct:  180 SLSWMKEKIFSDLIPKCEKCNNLVKPDIVFFGESLPSRFFSAIKSDFPKVDLLIVMGTSLQVQPFASLGD 249          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Xenopus
Match: SIRT2 (sirtuin 2 [Source:NCBI gene;Acc:100489469])

HSP 1 Score: 196.052 bits (497), Expect = 4.137e-54
Identity = 100/177 (56.50%), Postives = 126/177 (71.19%), Query Frame = 2
Query:  239 NEMIYLSSTFGRYLS--TPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            +EM YL + F R L   TP    D+  I  I + +L+ K KN+V M GAGIS  +GIPDFRSPG+GLY NL++Y +PYPEAIF I YF +NP+PFFALA+ELFP G+++P   HYF RLL+EK LL R Y+QNID LER+AGL   +LVEAHGTF S+ CV   C  +YS + +K K
Sbjct:   66 SEMDYLRNLFSRTLGIGTPEKVLDELSIEGISRFMLSEKCKNVVCMVGAGISTSAGIPDFRSPGSGLYSNLQKYNLPYPEAIFQIGYFKENPEPFFALARELFP-GQFKPTICHYFIRLLKEKGLLLRCYSQNIDTLERVAGLTSDDLVEAHGTFHSSHCVDTFCRAEYSLSWMKEK 241          

HSP 2 Score: 90.1225 bits (222), Expect = 2.387e-18
Identity = 47/87 (54.02%), Postives = 58/87 (66.67%), Query Frame = 2
Query: 1058 SLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKF-HLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            SL    E I    I  C KC  +VKPDIVFFGE LPS+F    +SDF + DLL+VMGTSL+V+PFAS+V      TPR+LIN++  G
Sbjct:  234 SLSWMKEKIFSDLIPKCEKCNNLVKPDIVFFGESLPSRFFSAIKSDFPKVDLLIVMGTSLQVQPFASLVSKVSSKTPRLLINKELAG 320          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Xenopus
Match: SIRT2 (sirtuin 2 [Source:NCBI gene;Acc:100489469])

HSP 1 Score: 191.815 bits (486), Expect = 3.780e-53
Identity = 98/173 (56.65%), Postives = 123/173 (71.10%), Query Frame = 2
Query:  251 YLSSTFGRYLS--TPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            YL + F R L   TP    D+  I  I + +L+ K KN+V M GAGIS  +GIPDFRSPG+GLY NL++Y +PYPEAIF I YF +NP+PFFALA+ELFP G+++P   HYF RLL+EK LL R Y+QNID LER+AGL   +LVEAHGTF S+ CV   C  +YS + +K K
Sbjct:   67 YLRNLFSRTLGIGTPEKVLDELSIEGISRFMLSEKCKNVVCMVGAGISTSAGIPDFRSPGSGLYSNLQKYNLPYPEAIFQIGYFKENPEPFFALARELFP-GQFKPTICHYFIRLLKEKGLLLRCYSQNIDTLERVAGLTSDDLVEAHGTFHSSHCVDTFCRAEYSLSWMKEK 238          

HSP 2 Score: 75.485 bits (184), Expect = 1.163e-13
Identity = 40/70 (57.14%), Postives = 48/70 (68.57%), Query Frame = 2
Query: 1058 SLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSK-FHLFRSDFQQADLLLVMGTSLEVEPFASIVD 1264
            SL    E I    I  C KC  +VKPDIVFFGE LPS+ F   +SDF + DLL+VMGTSL+V+PFAS+ D
Sbjct:  231 SLSWMKEKIFSDLIPKCEKCNNLVKPDIVFFGESLPSRFFSAIKSDFPKVDLLIVMGTSLQVQPFASLGD 300          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Xenopus
Match: hoga1 (4-hydroxy-2-oxoglutarate aldolase 1 [Source:Xenbase;Acc:XB-GENE-957775])

HSP 1 Score: 190.66 bits (483), Expect = 2.737e-52
Identity = 93/144 (64.58%), Postives = 109/144 (75.69%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            DI   I  +   NI++MAGAGIS  SGIPDFR+PG+GLYDNL++Y IPYPEAIFDI+YF+ NP PFF LAKELFP GKY+PN VHYF +LL +K LL R YTQNIDGLERLAG+    +VE HGTF SASC  C   + A + K
Sbjct:  116 DILDLITKNCCTNIIVMAGAGISTASGIPDFRTPGSGLYDNLQKYDIPYPEAIFDINYFVCNPNPFFHLAKELFP-GKYKPNLVHYFIKLLHDKGLLLRCYTQNIDGLERLAGIPVEKIVEVHGTFFSASCSLCYTPFPANEAK 258          

HSP 2 Score: 97.0561 bits (240), Expect = 1.284e-20
Identity = 53/100 (53.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKR-RVHDNCVLGK-----QTSVSELA 1387
            C  C G VKPDIVFFGEDLP  F     DF +ADLL++MGTSL++EPFAS+V++ +   PR+LINR+ VG F  KR R  D   LG       T VS L+
Sbjct:  269 CKFCAGPVKPDIVFFGEDLPQTFTQAYQDFPKADLLIIMGTSLKIEPFASLVNTVKPSIPRLLINREKVGPFAKKRLRRRDVAELGDLCDIIHTMVSRLS 368          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Mouse
Match: Sirt3 (sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665])

HSP 1 Score: 190.66 bits (483), Expect = 3.294e-54
Identity = 92/165 (55.76%), Postives = 117/165 (70.91%), Query Frame = 2
Query:  302 DQKF-IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            ++KF + D+ + + T     +V+M GAGIS PSGIPDFRSPG+GLY NL+QY IPYPEAIF++ +F  NPKPFF LAKEL+P G YRPN  HYF RLL +K+LL R+YTQNIDGLER +G+  + LVEAHGTF +A+C  C     GED  A  +  +     +C
Sbjct:   55 EKKFSLQDVAELLRTRACSRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYP-GHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVC 218          

HSP 2 Score: 65.855 bits (159), Expect = 3.407e-11
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLE 1237
            C  C G+VKPDIVFFGE LP++F L  +DF  ADLLL++GTSLE
Sbjct:  215 CPVCTGVVKPDIVFFGEQLPARFLLHMADFALADLLLILGTSLE 258          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Mouse
Match: Sirt3 (sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665])

HSP 1 Score: 181.415 bits (459), Expect = 5.553e-52
Identity = 85/140 (60.71%), Postives = 105/140 (75.00%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK--HSISEICE 781
            M GAGIS PSGIPDFRSPG+GLY NL+QY IPYPEAIF++ +F  NPKPFF LAKEL+P G YRPN  HYF RLL +K+LL R+YTQNIDGLER +G+  + LVEAHGTF +A+C  C   +    + ++   S+SE  +
Sbjct:    1 MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYP-GHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWVEPFASLSEAVQ 139          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Mouse
Match: Sirt3 (sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665])

HSP 1 Score: 181.03 bits (458), Expect = 9.744e-52
Identity = 87/142 (61.27%), Postives = 104/142 (73.24%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            M GAGIS PSGIPDFRSPG+GLY NL+QY IPYPEAIF++ +F  NPKPFF LAKEL+P G YRPN  HYF RLL +K+LL R+YTQNIDGLER +G+  + LVEAHGTF +A+C  C     GED  A  +  +     +C
Sbjct:    1 MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYP-GHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVC 141          

HSP 2 Score: 65.855 bits (159), Expect = 1.064e-11
Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEV 1240
            C  C G+VKPDIVFFGE LP++F L  +DF  ADLLL++GTSLE+
Sbjct:  138 CPVCTGVVKPDIVFFGEQLPARFLLHMADFALADLLLILGTSLEM 182          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Mouse
Match: Sirt3 (sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665])

HSP 1 Score: 182.185 bits (461), Expect = 3.679e-51
Identity = 87/142 (61.27%), Postives = 104/142 (73.24%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            M GAGIS PSGIPDFRSPG+GLY NL+QY IPYPEAIF++ +F  NPKPFF LAKEL+P G YRPN  HYF RLL +K+LL R+YTQNIDGLER +G+  + LVEAHGTF +A+C  C     GED  A  +  +     +C
Sbjct:    1 MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYP-GHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVC 141          

HSP 2 Score: 98.2117 bits (243), Expect = 3.618e-22
Identity = 53/110 (48.18%), Postives = 66/110 (60.00%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELAGTDCGRRSSALTLLQQ 1435
            C  C G+VKPDIVFFGE LP++F L  +DF  ADLLL++GTSLEVEPFAS+ ++ +   PR+LINR  VG F    R  D   LG      E      G     L L+Q+
Sbjct:  138 CPVCTGVVKPDIVFFGEQLPARFLLHMADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLGDVVHGVERLVDLLGWTQELLDLMQR 247          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Mouse
Match: Sirt3 (sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665])

HSP 1 Score: 182.185 bits (461), Expect = 3.679e-51
Identity = 87/142 (61.27%), Postives = 104/142 (73.24%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            M GAGIS PSGIPDFRSPG+GLY NL+QY IPYPEAIF++ +F  NPKPFF LAKEL+P G YRPN  HYF RLL +K+LL R+YTQNIDGLER +G+  + LVEAHGTF +A+C  C     GED  A  +  +     +C
Sbjct:    1 MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYP-GHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVC 141          

HSP 2 Score: 98.2117 bits (243), Expect = 3.618e-22
Identity = 53/110 (48.18%), Postives = 66/110 (60.00%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELAGTDCGRRSSALTLLQQ 1435
            C  C G+VKPDIVFFGE LP++F L  +DF  ADLLL++GTSLEVEPFAS+ ++ +   PR+LINR  VG F    R  D   LG      E      G     L L+Q+
Sbjct:  138 CPVCTGVVKPDIVFFGEQLPARFLLHMADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLGDVVHGVERLVDLLGWTQELLDLMQR 247          
BLAST of NAD-dependent protein deacetylase vs. UniProt/SwissProt
Match: sp|Q8R104|SIR3_MOUSE (NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus OX=10090 GN=Sirt3 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 1.469e-52
Identity = 92/165 (55.76%), Postives = 117/165 (70.91%), Query Frame = 2
Query:  302 DQKF-IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            ++KF + D+ + + T     +V+M GAGIS PSGIPDFRSPG+GLY NL+QY IPYPEAIF++ +F  NPKPFF LAKEL+P G YRPN  HYF RLL +K+LL R+YTQNIDGLER +G+  + LVEAHGTF +A+C  C     GED  A  +  +     +C
Sbjct:   55 EKKFSLQDVAELLRTRACSRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYP-GHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVC 218          

HSP 2 Score: 97.8265 bits (242), Expect = 1.692e-20
Identity = 53/110 (48.18%), Postives = 66/110 (60.00%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELAGTDCGRRSSALTLLQQ 1435
            C  C G+VKPDIVFFGE LP++F L  +DF  ADLLL++GTSLEVEPFAS+ ++ +   PR+LINR  VG F    R  D   LG      E      G     L L+Q+
Sbjct:  215 CPVCTGVVKPDIVFFGEQLPARFLLHMADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLGDVVHGVERLVDLLGWTQELLDLMQR 324          
BLAST of NAD-dependent protein deacetylase vs. UniProt/SwissProt
Match: sp|Q7ZVK3|SIR2_DANRE (NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio OX=7955 GN=sirt2 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.264e-52
Identity = 93/175 (53.14%), Postives = 125/175 (71.43%), Query Frame = 2
Query:  239 NEMIYLSSTFGRYLSTPSGTD--DQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLK 751
             EM +L S F R L    G    D+  +  + + IL+ K KNI+ M GAGIS  +GIPDFRSPGTGLY NL++Y +PYPEAIF IDYF ++P+PFFALA+EL+P G+++P   HYF ++L++K LLRR Y+QNID LER+AGL   +L+EAHGTF ++ CV   C ++YS   +K
Sbjct:   35 TEMDFLRSLFSRTLGLSPGDKVLDELTLDSVARYILSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFALARELYP-GQFKPTVYHYFIKMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSFLCRKEYSMDWMK 208          

HSP 2 Score: 85.1149 bits (209), Expect = 4.174e-16
Identity = 41/75 (54.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query: 1094 EICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            EI  C  C  +VKPDIVFFGE LPS+F    ++DF Q DLL++MGTSL+V+PFAS+V       PR+LIN +  G
Sbjct:  215 EIPKCDSCGSLVKPDIVFFGESLPSRFFTSMKADFPQCDLLIIMGTSLQVQPFASLVSRVSNRCPRLLINMEKTG 289          
BLAST of NAD-dependent protein deacetylase vs. UniProt/SwissProt
Match: sp|Q9NTG7|SIR3_HUMAN (NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT3 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 9.218e-52
Identity = 90/158 (56.96%), Postives = 113/158 (71.52%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC-----GEDYSATQLKLKHSISEIC 778
            D+ + I     + +V+M GAGIS PSGIPDFRSPG+GLY NL+QY +PYPEAIF++ +F  NPKPFF LAKEL+P G Y+PN  HYF RLL +K LL R+YTQNIDGLER++G+  + LVEAHGTFASA+C  C     GED  A  +  +     +C
Sbjct:  127 DVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP-GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVC 283          

HSP 2 Score: 96.2857 bits (238), Expect = 1.151e-19
Identity = 48/85 (56.47%), Postives = 56/85 (65.88%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLG 1360
            C  C G+VKPDIVFFGE LP +F L   DF  ADLLL++GTSLEVEPFAS+ ++ R   PR+LINR  VG      R  D   LG
Sbjct:  280 CPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLG 364          
BLAST of NAD-dependent protein deacetylase vs. UniProt/SwissProt
Match: sp|Q5RBF1|SIR2_PONAB (NAD-dependent protein deacetylase sirtuin-2 OS=Pongo abelii OX=9601 GN=SIRT2 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.832e-47
Identity = 89/186 (47.85%), Postives = 127/186 (68.28%), Query Frame = 2
Query:  245 MIYLSSTFGRYLSTPSGTD---DQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCV--RCGEDYSATQLKLK--HSISEICE 781
            M +L + F + LS  S  +   D+  +  + + + + + + ++ + GAGIS  +GIPDFRSP TGLYDNL++Y +PYPEAIF+I YF ++P+PFFALAKEL+P G+++P   HYF RLL++K LL R YTQNID LER+AGL   +LVEAHGTF ++ CV   C  +Y  + +K K    ++  CE
Sbjct:    1 MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYP-GQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCE 185          

HSP 2 Score: 88.9669 bits (219), Expect = 1.996e-17
Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKF-HLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            C  C+ +VKPDIVFFGE LP++F    +SDF + DLLLVMGTSL+V+PFAS++      TPR+LIN++  G
Sbjct:  184 CEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAG 254          
BLAST of NAD-dependent protein deacetylase vs. UniProt/SwissProt
Match: sp|Q5RJQ4|SIR2_RAT (NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus OX=10116 GN=Sirt2 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.654e-47
Identity = 87/176 (49.43%), Postives = 124/176 (70.45%), Query Frame = 2
Query:  245 MIYLSSTFGRYLSTPSGTD---DQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            M +L + F + L   S  +   D+  +  + + + + + + ++ + GAGIS  +GIPDFRSP TGLY NL++Y +PYPEAIF+I YF ++P+PFFALAKEL+P G+++P   HYF RLL+EK LL R YTQNID LER+AGL   +LVEAHGTF ++ CV   CG++Y+ + +K K
Sbjct:    1 MDFLRNLFTQTLGLGSQKERLLDELTLEGVTRYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYANLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYP-GQFKPTICHYFIRLLKEKGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCGKEYTMSWMKEK 175          

HSP 2 Score: 90.8929 bits (224), Expect = 4.333e-18
Identity = 39/71 (54.93%), Postives = 54/71 (76.06%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKF-HLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            C KC+ +VKPDIVFFGE+LP +F    +SDF + DLL++MGTSL+V+PFAS++      TPR+LIN++  G
Sbjct:  184 CEKCQNVVKPDIVFFGENLPPRFFSCMQSDFSKVDLLIIMGTSLQVQPFASLISKAPLATPRLLINKEKTG 254          
BLAST of NAD-dependent protein deacetylase vs. TrEMBL
Match: C3Z1Z2 (Deacetylase sirtuin-type domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_223028 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.955e-60
Identity = 102/146 (69.86%), Postives = 121/146 (82.88%), Query Frame = 2
Query:  314 IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            I D+ + IL +K KN+V+MAGAGIS PSGIPDFRSPGTGLYDNL+QY IPYPEAIFDIDYF  + +PF+ LAKEL+P G YRPN VHYF RLL EK LL R+YTQNIDGLER++G+ ++ LVEAHGTFA+ASC+RC   YS  Q+K
Sbjct:    1 IDDVARYILANKCKNVVVMAGAGISTPSGIPDFRSPGTGLYDNLQQYNIPYPEAIFDIDYFHMDSRPFYTLAKELYP-GNYRPNYVHYFIRLLHEKGLLLRMYTQNIDGLERMSGIPESKLVEAHGTFATASCIRCNAKYSGKQIK 145          

HSP 2 Score: 103.219 bits (256), Expect = 1.889e-20
Identity = 57/98 (58.16%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 1079 SIDKSEICYCSK---CRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVF-RSKRRVHDNCVLG 1360
            +I K +I  C+    C+G +KPDIVFFGEDLP +F+ +  DF   DLLLVMGTSLEVEPFASIV+S+R   PRVL NR PVG F R   R  D   LG
Sbjct:  147 AIMKGDIPKCTNSKWCKGKIKPDIVFFGEDLPRRFYYYLKDFPLCDLLLVMGTSLEVEPFASIVNSSRGYVPRVLFNRDPVGPFGRVPLRDTDCAELG 244          
BLAST of NAD-dependent protein deacetylase vs. TrEMBL
Match: H2ZB27 (NAD-dependent protein deacetylase OS=Ciona savignyi OX=51511 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.299e-60
Identity = 100/148 (67.57%), Postives = 119/148 (80.41%), Query Frame = 2
Query:  314 IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK 757
            I D+ + I +  +KNI++MAGAGIS  SGIPDFRSPGTGLYDNL++YK+PYP A+FD+DYF  NPKPFF LAKEL+PSGKYRPN VHYF R L E+ LL R+YTQNIDGLERLAG+    LVEAHGTF SASC +CG+ Y+   +K K
Sbjct:   16 IEDVARIIKSEGVKNIIVMAGAGISTASGIPDFRSPGTGLYDNLQKYKVPYPTAVFDLDYFHSNPKPFFELAKELYPSGKYRPNAVHYFVRCLHERGLLLRMYTQNIDGLERLAGIPPMKLVEAHGTFTSASCTKCGKKYNGETIKDK 163          

HSP 2 Score: 103.605 bits (257), Expect = 1.725e-20
Identity = 53/92 (57.61%), Postives = 64/92 (69.57%), Query Frame = 2
Query: 1115 CRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGK-QTSVSELA 1387
            C GI+KPDIVFFGEDLP +F+ +  DF   DLLLVMGTSL+VEPFAS+VDSTR  TPR+L+N   VG F    R  D  + G    S+ +LA
Sbjct:  178 CYGIIKPDIVFFGEDLPKRFYYYLKDFPACDLLLVMGTSLQVEPFASLVDSTRATTPRLLLNMVKVGPFTKPSRRTDLSITGDISDSIHKLA 269          
BLAST of NAD-dependent protein deacetylase vs. TrEMBL
Match: A0A1S3JTY3 (NAD-dependent protein deacetylase sirtuin-3 OS=Lingula unguis OX=7574 GN=LOC106176139 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.014e-60
Identity = 100/144 (69.44%), Postives = 120/144 (83.33%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            D+ + I   + KNIV+MAGAGIS PSGIPDFRSPGTGLYDNL+QY IPYPEAIFDIDYF  NP+PFFAL+KEL+PSGKYRPN +HYF RLL +K LL R+YTQNIDGLERLAG+    LVEAHGTF++A+C+RC  ++   ++K
Sbjct:  101 DVSRYIREGRAKNIVVMAGAGISTPSGIPDFRSPGTGLYDNLQQYNIPYPEAIFDIDYFHMNPRPFFALSKELYPSGKYRPNYIHYFMRLLHDKGLLHRMYTQNIDGLERLAGIPSEKLVEAHGTFSTATCIRCNLEHRGDEIK 244          

HSP 2 Score: 114.005 bits (284), Expect = 1.128e-22
Identity = 55/87 (63.22%), Postives = 67/87 (77.01%), Query Frame = 2
Query: 1085 DKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHD 1345
            DK   C  + C GIVKPDIVFFGE+LP +F+ +  DF QADL+LV+GTSLEVEPFASIVD++R   PRVL NR+ VG F+ KRR +D
Sbjct:  250 DKLPKCKKTNCLGIVKPDIVFFGEELPRRFYYYLKDFPQADLVLVLGTSLEVEPFASIVDASRSYIPRVLFNREAVGPFKRKRRNND 336          
BLAST of NAD-dependent protein deacetylase vs. TrEMBL
Match: W4XPP2 (Deacetylase sirtuin-type domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 5.543e-60
Identity = 108/166 (65.06%), Postives = 128/166 (77.11%), Query Frame = 2
Query:  257 SSTFGRYLSTPSGTDDQ-KFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            S+T  R  S+ +G     K I D+ ++IL  K KNIV+MAGAGIS PSGIPDFRSPG+GLYDNL+QY+IPYPEAIFDID+F +NPKPFF LAKEL+PSGKYRPN VHYF R+L EK LL R+YTQNIDGLERLAG+    LVEAHGTF   +C +CG  +    +K
Sbjct:  166 SATPKRRQSSSAGNSSTFKTIEDVARRILQKKSKNIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYRIPYPEAIFDIDFFRKNPKPFFTLAKELYPSGKYRPNYVHYFVRMLYEKGLLLRMYTQNIDGLERLAGIPGDKLVEAHGTFTRCTCTKCGYQHEGEDVK 331          

HSP 2 Score: 97.0561 bits (240), Expect = 6.841e-17
Identity = 52/94 (55.32%), Postives = 61/94 (64.89%), Query Frame = 2
Query: 1085 DKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFR--SKRRVHDNCVLG 1360
            DK   C   +C G+VKP+IVFFGEDLP +F  +  D    DLL+VMGTSLEV PFA IVDS R   PR+LINR+ VG F   S  R +D  V G
Sbjct:  337 DKIPRCMRPRCTGVVKPNIVFFGEDLPKRFFYYMKDMPLCDLLIVMGTSLEVYPFAGIVDSVRPFVPRLLINREVVGPFSRPSSSRHNDLAVTG 430          
BLAST of NAD-dependent protein deacetylase vs. TrEMBL
Match: H2ZB26 (NAD-dependent protein deacetylase OS=Ciona savignyi OX=51511 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 9.113e-60
Identity = 100/148 (67.57%), Postives = 119/148 (80.41%), Query Frame = 2
Query:  314 IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK 757
            I D+ + I +  +KNI++MAGAGIS  SGIPDFRSPGTGLYDNL++YK+PYP A+FD+DYF  NPKPFF LAKEL+PSGKYRPN VHYF R L E+ LL R+YTQNIDGLERLAG+    LVEAHGTF SASC +CG+ Y+   +K K
Sbjct:    1 IEDVARIIKSEGVKNIIVMAGAGISTASGIPDFRSPGTGLYDNLQKYKVPYPTAVFDLDYFHSNPKPFFELAKELYPSGKYRPNAVHYFVRCLHERGLLLRMYTQNIDGLERLAGIPPMKLVEAHGTFTSASCTKCGKKYNGETIKDK 148          

HSP 2 Score: 90.5077 bits (223), Expect = 6.087e-16
Identity = 53/115 (46.09%), Postives = 65/115 (56.52%), Query Frame = 2
Query: 1115 CRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLE-----------------------VEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQT-SVSELA 1387
            C GI+KPDIVFFGEDLP +F+ +  DF   DLLLVMGTSL+                       VEPFAS+VDSTR  TPR+L+N   VG F    R  D  + G  + S+ +LA
Sbjct:  163 CYGIIKPDIVFFGEDLPKRFYYYLKDFPACDLLLVMGTSLQVRCYSLYFTAARITQCDFILSYFVEPFASLVDSTRATTPRLLLNMVKVGPFTKPSRRTDLSITGDISDSIHKLA 277          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Cavefish
Match: sirt3 (sirtuin 3 [Source:NCBI gene;Acc:103044645])

HSP 1 Score: 199.134 bits (505), Expect = 4.662e-56
Identity = 94/144 (65.28%), Postives = 112/144 (77.78%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            DI + I   + K IV+MAGAGIS PSGIPDFRSPG+GLYDNL+QY +PY EAIF+I+YF  NPKPFFALAKEL+P G Y+PN  HYF RLL +K  L R+YTQNIDGLER+AG+    LVEAHGTFA+A+C  C  DY   +L+
Sbjct:   79 DIAKGIRDREYKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYNLPYAEAIFEINYFHHNPKPFFALAKELYP-GNYQPNLTHYFIRLLHDKGQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELR 221          

HSP 2 Score: 99.7525 bits (247), Expect = 5.097e-22
Identity = 54/114 (47.37%), Postives = 68/114 (59.65%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELAGTDCGRRSSALTLLQQPILE 1447
            C  C+G++KPDIVFFGE+LP  F L+ +DF  ADL++VMGTSLEVEPFAS+  + R    R+LINR  VG F      H++        V+EL     G R  A  L   P LE
Sbjct:  232 CPHCKGVIKPDIVFFGEELPQHFFLYLTDFPIADLVIVMGTSLEVEPFASLAGAVRGSVSRLLINRDLVGPFAWGSPRHND--------VAELGDVVSGVRRLAEALGWMPELE 337          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Cavefish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 185.267 bits (469), Expect = 3.479e-52
Identity = 85/156 (54.49%), Postives = 117/156 (75.00%), Query Frame = 2
Query:  347 KIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLKHSIS--EICEIFFIASVVL 808
            +++N+V++AGAGIS  SGIPDFR+PGTGLY NL++Y +PYPEA+F+IDYF  +P+PFF+LAKEL+P G++RPN +HYF R+L +K LL R+YTQNIDGLE++ G+ D  LVEAHG+FA+ASC  C   + + +  +  +I     C      SVV 
Sbjct:    5 RLRNVVVVAGAGISTASGIPDFRTPGTGLYANLEKYNVPYPEAVFNIDYFSDDPRPFFSLAKELYP-GRHRPNYIHYFIRMLHQKGLLLRMYTQNIDGLEKMCGIPDDKLVEAHGSFATASCHLCYTPFPSEEAIMSDNIPTCSFCSATVKPSVVF 159          

HSP 2 Score: 96.6709 bits (239), Expect = 1.255e-21
Identity = 63/160 (39.38%), Postives = 87/160 (54.37%), Query Frame = 2
Query:  929 HHRSFHPQLWVKNLNG--KMC*FP*---IINCGSLSKNSLSNISGPKASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVF-RSKRRVHDNCVLGKQT-SVSELA 1387
            H +    +++ +N++G  KMC  P    +   GS +  S      P  S     E+I    I  CS C   VKP +VFFGEDLP  +     DF +ADLL++MGTSL++EPFAS+V++ +   PR+L+NR  VG F R   R  D   LG    SV +LA
Sbjct:   86 HQKGLLLRMYTQNIDGLEKMCGIPDDKLVEAHGSFATASCHLCYTPFPSE----EAIMSDNIPTCSFCSATVKPSVVFFGEDLPETYFQHAQDFPKADLLIIMGTSLQIEPFASLVNTVKSTVPRLLLNRHAVGPFERKPLRRRDYLELGDLVHSVRKLA 241          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Cavefish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 187.963 bits (476), Expect = 1.704e-51
Identity = 81/135 (60.00%), Postives = 111/135 (82.22%), Query Frame = 2
Query:  347 KIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            +++N+V++AGAGIS  SGIPDFR+PGTGLY NL++Y +PYPEA+F+IDYF  +P+PFF+LAKEL+P G++RPN +HYF R+L +K LL R+YTQNIDGLE++ G+ D  LVEAHG+FA+ASC  C   + + + K
Sbjct:  120 RLRNVVVVAGAGISTASGIPDFRTPGTGLYANLEKYNVPYPEAVFNIDYFSDDPRPFFSLAKELYP-GRHRPNYIHYFIRMLHQKGLLLRMYTQNIDGLEKMCGIPDDKLVEAHGSFATASCHLCYTPFPSEEAK 253          

HSP 2 Score: 95.1301 bits (235), Expect = 4.038e-20
Identity = 54/147 (36.73%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  929 HHRSFHPQLWVKNLNG--KMC*FP*IINCGSLSKNSLSNISGPKASLIIYL-----------ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSK 1330
            H +    +++ +N++G  KMC  P          + L    G  A+   +L           E+I    I  CS C   VKP +VFFGEDLP  +     DF +ADLL++MGTSL++EPFAS+V++ +   PR+L+NR  VG F  K
Sbjct:  201 HQKGLLLRMYTQNIDGLEKMCGIP---------DDKLVEAHGSFATASCHLCYTPFPSEEAKEAIMSDNIPTCSFCSATVKPSVVFFGEDLPETYFQHAQDFPKADLLIIMGTSLQIEPFASLVNTVKSTVPRLLLNRHAVGPFERK 338          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Cavefish
Match: sirt2 (sirtuin 2 [Source:NCBI gene;Acc:103038996])

HSP 1 Score: 185.652 bits (470), Expect = 5.015e-51
Identity = 92/177 (51.98%), Postives = 125/177 (70.62%), Query Frame = 2
Query:  239 NEMIYLSSTFGRYL--STPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            +EM +L + F R L  S      D   +  + + I + K KNI+ M GAGIS  +GIPDFRSPGTGLY NL++Y +PYPEAIF IDYF ++P+PFFALA+EL+P G+++P   HYF R+L++K LLRR Y+QNID LER+AGL   +L+EAHGTF ++ CV   C ++Y+   +K K
Sbjct:   37 SEMDFLRNLFSRTLGLSPEEKVLDDLSLEGVARYIQSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFALARELYP-GQFKPTVCHYFIRMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSLFCRKEYTMDWMKEK 212          

HSP 2 Score: 82.4185 bits (202), Expect = 3.614e-16
Identity = 40/81 (49.38%), Postives = 53/81 (65.43%), Query Frame = 2
Query: 1076 ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKF-HLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            E I   +I  C  C  +VKPDIVFFGE+LP++F    + DF   DLL++MGTSL+V+PFAS+V       PR+LIN +  G
Sbjct:  211 EKIFSEDIPKCDACNNLVKPDIVFFGENLPARFFTTMKKDFPHCDLLIIMGTSLQVQPFASLVSRVPNSCPRLLINMEKTG 291          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Cavefish
Match: ENSAMXT00000003809.2 (pep primary_assembly:Astyanax_mexicanus-2.0:25:45151234:45158481:-1 gene:ENSAMXG00000003731.2 transcript:ENSAMXT00000003809.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 2.738e-27
Identity = 59/125 (47.20%), Postives = 88/125 (70.40%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQ--YKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            K I+++ GAG+S   GIPDFRS   G+Y  L      +P P+A+FDIDYF ++P+PFF  AKE++P G+++P+  H F  +L +K+ L R YTQNID LE++AG+    +++ HG+FA+ASC+ C
Sbjct:  290 KKILVLTGAGVSVSCGIPDFRS-RDGIYARLAVDFPDLPDPQAMFDIDYFRRDPRPFFKFAKEIYP-GQFQPSLCHRFISMLDKKEKLLRNYTQNIDTLEQVAGVQ--KIIQCHGSFATASCLVC 410          

HSP 2 Score: 72.4034 bits (176), Expect = 1.643e-12
Identity = 39/84 (46.43%), Postives = 52/84 (61.90%), Query Frame = 2
Query: 1076 ESIDKSEICYCSKCR----GIVKPDIVFFGEDLPSKFH-LFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPV 1312
            E I +  + +C KC      I+KPDIVFFGE+LP  FH   + D    DLL+V+G+SL+V P A I  S     P+VLINR+P+
Sbjct:  421 EDIFRQVVPHCPKCPDIPFAIMKPDIVFFGENLPESFHRAMKQDKDAVDLLIVIGSSLKVRPVALIPSSVPHDVPQVLINREPL 504          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Sea Lamprey
Match: sirt2 (sirtuin 2 (silent mating type information regulation 2, homolog) 2 (S. cerevisiae) [Source:NCBI gene;Acc:322309])

HSP 1 Score: 187.963 bits (476), Expect = 8.791e-53
Identity = 89/171 (52.05%), Postives = 120/171 (70.18%), Query Frame = 2
Query:  254 LSSTFGRYLSTPSGTDDQKFIVD-----ICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            L     R L   S +  ++ + +     + + IL  K KNIV M GAGIS  +GIPDFRSPGTGLYDNL++Y +P+P+A+FDI YF +NP+PFFALAKEL+P G+++P   HYF RLL++K+ L R YTQNID LER+AGL +  LVEAHGTF ++ C+ C  +Y  + +K
Sbjct:    4 LREMLARKLELGSASGHERVLEELTLGGVAKHILAGKCKNIVCMVGAGISTAAGIPDFRSPGTGLYDNLQKYNLPHPQAVFDIGYFRENPEPFFALAKELYP-GQFKPTVSHYFIRLLKDKECLLRCYTQNIDTLERVAGLENNELVEAHGTFHTSHCLGCRHEYCLSWMK 173          

HSP 2 Score: 83.1889 bits (204), Expect = 3.541e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 2
Query: 1076 ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKF-HLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            E I   ++  C KC+ +VKPDIVFFGE LP KF    +SDF + DLL++MGTSL V+PFAS+       TPR+LIN +  G
Sbjct:  174 EQIFSDKVPRCEKCKSVVKPDIVFFGEALPEKFFTCVQSDFPKCDLLIIMGTSLVVQPFASLTSRVPDSTPRLLINLEKSG 254          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Sea Lamprey
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 171.785 bits (434), Expect = 4.948e-48
Identity = 88/144 (61.11%), Postives = 112/144 (77.78%), Query Frame = 2
Query:  320 DICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            D+ + I     KNIV+MAGAG+S  SGIPDFR+PGTGLYDNL++Y +P+PEA+FD+D+F  +PKPFF LA+EL+P G  RPN  HYF RLL E++LL R+YTQNIDGLER+AGL    LVEAHGTFASA+C +C +     Q++
Sbjct:   16 DVARLIRDGHCKNIVLMAGAGMSTASGIPDFRTPGTGLYDNLQRYHLPFPEAVFDLDFFAVDPKPFFTLAQELYP-GNCRPNDAHYFARLLHERRLLLRLYTQNIDGLERVAGLPPDMLVEAHGTFASATCTQCRKPQPGDQVR 158          

HSP 2 Score: 103.605 bits (257), Expect = 1.774e-24
Identity = 50/112 (44.64%), Postives = 70/112 (62.50%), Query Frame = 2
Query: 1076 ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRR-----VHDNCVLGKQTSVSELAGTD 1396
             ++   +I +C  C  +VKPDIVFFGEDLP +F+ +  DF  ADLL+V+GTSLEV PFA +V + R G PR+L+NR+ VG+FR          H + V+     ++ L G D
Sbjct:  159 RTVMSGKIPHCGACSAVVKPDIVFFGEDLPRRFYAYDQDFSMADLLIVIGTSLEVMPFAGLVSAVRPGVPRLLLNREAVGLFRRAASSPTDVAHLDDVVAGVRRLTNLVGWD 270          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Sea Lamprey
Match: sirt4 (sirtuin 4 [Source:ZFIN;Acc:ZDB-GENE-041010-65])

HSP 1 Score: 67.781 bits (164), Expect = 2.421e-12
Identity = 51/176 (28.98%), Postives = 79/176 (44.89%), Query Frame = 2
Query:  272 RYLSTPSGTDDQKFIVDICQKILTSK----------IKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPE----AIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK 757
            R+ S+P+ + D  F V  C    T +           + + ++AGAG+S  SGIPD+RS G GLY    +  + + E    A+    Y+ +N   F    +  F S   RPN  H      +++  L  + TQN+D L   AG     + E HG      C+ C E    T+L+ +
Sbjct:   15 RWCSSPAASPDLAF-VPACAPAGTQQRGQLQDFLANSRRLFVLAGAGLSTESGIPDYRSEGVGLYARTSRRPMQHAEFARSAVARRRYWARN---FTGWPR--FSS--RRPNAAHLALGRWEQQGRLHWLVTQNVDALHAKAG--SRRITELHGCSHRVVCLDCKEVTQRTELQQR 180          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Sea Lamprey
Match: sirt6 (sirtuin 6 [Source:ZFIN;Acc:ZDB-GENE-031007-2])

HSP 1 Score: 59.3066 bits (142), Expect = 1.537e-9
Identity = 44/154 (28.57%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  338 LTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGE----DYSATQLKLKHSISEICEIF 787
            L    K +VI  GAG+S  +GIPDF   G              P  ++ ++     PK  F +  E       RP   H     L  + LL+ + +QN+DGL   +G     L E HG      C RCG+    D++   + LK++  +IC++ 
Sbjct:   40 LVRASKYMVIHTGAGVSTAAGIPDFSYRG--------------PNGVWTMEQKGLTPK--FNITFE-----DARPTATHMAMLGLYREGLLKHLVSQNVDGLHIRSGFPRDKLSELHGNMFIEECERCGKQYVRDHTVGTMGLKYT-GKICDVV 171          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Yeast
Match: HST2 (Cytoplasmic NAD(+)-dependent protein deacetylase; deacetylation targets are primarily cytoplasmic proteins; member of the silencing information regulator 2 (Sir2) family of NAD(+)-dependent protein deacetylases; modulates nucleolar (rDNA) and telomeric silencing; possesses NAD(+)-dependent histone deacetylase activity in vitro; contains a nuclear export signal (NES); function regulated by its nuclear export [Source:SGD;Acc:S000005936])

HSP 1 Score: 170.244 bits (430), Expect = 8.004e-47
Identity = 76/133 (57.14%), Postives = 98/133 (73.68%), Query Frame = 2
Query:  359 IVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK 757
            ++ M GAGIS   GIPDFRSPGTGLY NL + K+PYPEA+FD+D+F  +P PF+ LAKEL+P G +RP+K HY  +L Q+K +L+RVYTQNID LER AG+ D  ++EAHG+FA   C+ CG+ Y     K K
Sbjct:   27 VIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYP-GNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSK 158          

HSP 2 Score: 60.077 bits (144), Expect = 6.267e-10
Identity = 37/94 (39.36%), Postives = 50/94 (53.19%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKF-HLFRSDFQ-------------QADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHD 1345
            C  C  +VKP IVFFGEDLP  F   + +D +             Q  L++V+GTSL V PFAS+ +       RVL N + VG F++ +R  D
Sbjct:  170 CDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTD 263          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Yeast
Match: HST1 (NAD(+)-dependent histone deacetylase; essential subunit of the Sum1p/Rfm1p/Hst1p complex required for ORC-dependent silencing and meiotic repression; non-essential subunit of the Set3C deacetylase complex; involved in telomere maintenance; HST1 has a paralog, SIR2, that arose from the whole genome duplication [Source:SGD;Acc:S000005429])

HSP 1 Score: 112.079 bits (279), Expect = 3.704e-26
Identity = 55/124 (44.35%), Postives = 79/124 (63.71%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFP-SGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            K I+++ GAG+S   GIPDFRS   G Y  ++   +  P+ +F++D FLQ+P  F+ +A  + P    Y P  +H F ++LQ+K  L R YTQNID LE  AG++   LV+ HG+FA+ASCV C
Sbjct:  201 KKILVLTGAGVSTSLGIPDFRS-SEGFYSKIRHLGLEDPQDVFNLDIFLQDPSVFYNIAHMVLPPENMYSP--LHSFIKMLQDKGKLLRNYTQNIDNLESYAGIDPDKLVQCHGSFATASCVTC 321          

HSP 2 Score: 68.5514 bits (166), Expect = 2.590e-12
Identity = 33/68 (48.53%), Postives = 45/68 (66.18%), Query Frame = 2
Query: 1112 KCRGIVKPDIVFFGEDLPSKFH-LFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPV 1312
            K  G++KPD+ FFGE LPS+FH   R D  + DLL+ +GTSL+V P + IV+      P++LINR  V
Sbjct:  374 KSYGVLKPDMTFFGEALPSRFHKTIRKDILECDLLICIGTSLKVAPVSEIVNMVPSHVPQILINRDMV 441          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Yeast
Match: SIR2 (Conserved NAD+ dependent histone deacetylase of the Sirtuin family; deacetylation targets are primarily nuclear proteins; required for telomere hypercluster formation in quiescent yeast cells; involved in regulation of lifespan; plays roles in silencing at HML, HMR, telomeres, and rDNA; negatively regulates initiation of DNA replication; functions as regulator of autophagy like mammalian homolog SIRT1, and also of mitophagy [Source:SGD;Acc:S000002200])

HSP 1 Score: 105.916 bits (263), Expect = 4.835e-24
Identity = 57/139 (41.01%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  311 FIVD-ICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGK-YRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            F +D   QK+ T++   I+++ GAG+S   GIPDFRS   G Y  +K   +  P+ +F+ + F+ +P  F+ +A  + P  K Y P  +H F ++LQ K  L R YTQNID LE  AG++   LV+ HG+FA+A+CV C
Sbjct:  242 FTIDHFIQKLHTAR--KILVLTGAGVSTSLGIPDFRS-SEGFYSKIKHLGLDDPQDVFNYNIFMHDPSVFYNIANMVLPPEKIYSP--LHSFIKMLQMKGKLLRNYTQNIDNLESYAGISTDKLVQCHGSFATATCVTC 375          

HSP 2 Score: 76.2554 bits (186), Expect = 9.954e-15
Identity = 42/101 (41.58%), Postives = 56/101 (55.45%), Query Frame = 2
Query: 1103 YCSKCRGIVKPDIVFFGEDLPSKFH-LFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGKQTSVSELAGTDCG 1402
            Y     G++KPDI FFGE LP+KFH   R D  + DLL+ +GTSL+V P + IV+      P+VLINR PV     K    D  +LG    ++ +    CG
Sbjct:  430 YILNSYGVLKPDITFFGEALPNKFHKSIREDILECDLLICIGTSLKVAPVSEIVNMVPSHVPQVLINRDPV-----KHAEFDLSLLGYCDDIAAMVAQKCG 525          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Yeast
Match: HST3 (Member of the Sir2 family of NAD(+)-dependent protein deacetylases; involved along with Hst4p in telomeric silencing, cell cycle progression, radiation resistance, genomic stability and short-chain fatty acid metabolism [Source:SGD;Acc:S000005551])

HSP 1 Score: 80.8777 bits (198), Expect = 2.378e-16
Identity = 53/154 (34.42%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  344 SKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQ-----YKIPYPEAIFDIDYFLQNPKP--FFALAKELFPSGKY-RPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTN----------------LVEAHGTFASASCVRCGEDY 733
            S+ + I  + GAGISC +GIPDFRS   GLYD +K+     + I     +FDI  F  + K   F    + L+ + +  +P K H F   L+++  L R YTQNIDGLE   GL  +N                +V+ HG   + SC +C + +
Sbjct:   50 SRSRRIACLTGAGISCNAGIPDFRS-SDGLYDLVKKDCSQYWSIKSGREMFDISLFRDDFKISIFAKFMERLYSNVQLAKPTKTHKFIAHLKDRNKLLRCYTQNIDGLEESIGLTLSNRKLPLTSFSSHWKNLDVVQLHGDLKTLSCTKCFQTF 202          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Yeast
Match: HST4 (NAD(+)-dependent protein deacetylase; deacetylation targets are primarily mitochondrial proteins; involved along with Hst3p in silencing at telomeres, cell cycle progression, radiation resistance, genomic stability and short-chain fatty acid metabolism; accumulates in mitochondria in response to biotin starvation and may link biotin metabolism with energy homeostasis; member of the Sir2 family and may be the functional equivalent of human SIRT3 [Source:SGD;Acc:S000002599])

HSP 1 Score: 52.7582 bits (125), Expect = 1.813e-7
Identity = 43/139 (30.94%), Postives = 59/139 (42.45%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSP-------GTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNL---------VEAHGTFASASCVRC 721
            K +V+++GAGIS  +GIPDFRS          G   +L  Y   Y +    +  F Q     F L+K        +P K H           L R+YTQNIDGL+       TN+         V+ HG+     C +C
Sbjct:   93 KRMVVVSGAGISVAAGIPDFRSSEGIFSTVNGGSGKDLFDYNRVYGDESMSLK-FNQLMVSLFRLSKNC------QPTKFHEMLNEFARDGRLLRLYTQNIDGLDTQLPHLSTNVPLAKPIPSTVQLHGSIKHMECNKC 224          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Nematostella
Match: EDO47672 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD5])

HSP 1 Score: 184.111 bits (466), Expect = 2.009e-51
Identity = 85/128 (66.41%), Postives = 101/128 (78.91%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            MAGAGIS PSGIPDFR+PGTGLYDNL++Y IP P AIFDI+YF  +P+PFF LAK L+P G Y+PN VHYF +LL +K  L R+YTQNIDGLERLAGL    LVEAHGTF++ASC+ C   Y   Q++
Sbjct:    1 MAGAGISTPSGIPDFRTPGTGLYDNLQEYNIPEPTAIFDIEYFWYDPRPFFCLAKTLYP-GNYQPNYVHYFVKLLHDKGFLLRMYTQNIDGLERLAGLPAEKLVEAHGTFSTASCISCHHSYDGEQIR 127          

HSP 2 Score: 108.227 bits (269), Expect = 1.939e-25
Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 2
Query: 1076 ESIDKSEICYCS--KCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRS--KRRVHDNCVLGK-QTSVSELA 1387
            ++I+  +I  C   KC+G++KPD+VFFGEDLP +F+ F  DF++ DLLLVMGTSLEVEPFA IV+     TPRVLINR+ VG F    +RR  D  + G   +SV  LA
Sbjct:  128 KTIENGDIPRCETIKCKGVIKPDVVFFGEDLPKRFYSFEIDFRKCDLLLVMGTSLEVEPFAGIVNEVSRSTPRVLINRESVGPFLHPWRRRPKDVVLKGDIVSSVKRLA 236          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Nematostella
Match: EDO46813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNW2])

HSP 1 Score: 165.622 bits (418), Expect = 2.217e-45
Identity = 81/143 (56.64%), Postives = 109/143 (76.22%), Query Frame = 2
Query:  323 ICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            +   I + K K+I++M GAGIS  +GIPDFRSPGTGLYDNL++Y +PYPE+IF+I YF  NP+PFFAL KEL+P G ++P   HYF +LL +KKLL R YTQN+D LER+AG+ D  LVEAHG+F +A C+ C ++Y+   ++
Sbjct:   33 VANYIKSGKCKHIIVMTGAGISTAAGIPDFRSPGTGLYDNLQKYNLPYPESIFEIGYFRSNPEPFFALCKELYP-GSFKPTMSHYFIKLLYDKKLLLRNYTQNVDTLERIAGVPDDLLVEAHGSFHTAHCIECKKEYTKEDVR 174          

HSP 2 Score: 87.4261 bits (215), Expect = 1.139e-18
Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 2
Query: 1106 CSKCRGIVKPDIVFFGEDLPSKFH-LFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            CS C G++KPDIVFFGE LP +FH L   D    DL+++MGTSL V+PFAS++D     TPR+LIN++  G
Sbjct:  185 CSGCEGVIKPDIVFFGESLPGRFHRLVPQDMPHCDLIIIMGTSLAVQPFASLIDRVLATTPRLLINKEKCG 255          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Nematostella
Match: EDO48459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU3])

HSP 1 Score: 158.303 bits (399), Expect = 4.364e-43
Identity = 75/153 (49.02%), Postives = 107/153 (69.93%), Query Frame = 2
Query:  299 DDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLK 757
            DD  F   I + I + K KNIV++ GAGIS  +GIPDFR+PG+GL++ L+ Y +    +IF+IDYF  NPKPFF  AK ++P G+++P   HYF +LLQ K LL R YTQNID LER+AG+   +L+EAHG+F +  C+ C ++YS   ++++
Sbjct:    2 DDVSF-EGIARYITSGKCKNIVVLTGAGISTTAGIPDFRTPGSGLFNVLQTYGLTTARSIFEIDYFQMNPKPFFVAAKAVYP-GQFKPTISHYFIKLLQNKGLLLRHYTQNIDTLERVAGITGDHLMEAHGSFHTGHCMACNKEYSQDWIRVE 152          

HSP 2 Score: 83.1889 bits (204), Expect = 2.544e-17
Identity = 41/79 (51.90%), Postives = 55/79 (69.62%), Query Frame = 2
Query: 1082 IDKSEICYCSKCRGIVKPDIVFFGEDLPSKFH-LFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            I   +I  C++C G+VKPDI FFG+ +P KF+ L   DF + DLL+VMGTSL V+PFAS++      TPR+LINR+  G
Sbjct:  153 IMADKIPRCTECDGVVKPDIGFFGDPMPDKFYQLAAEDFPKCDLLIVMGTSLIVQPFASLIARVSVDTPRLLINREKCG 231          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Nematostella
Match: EDO31684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX90])

HSP 1 Score: 128.642 bits (322), Expect = 1.231e-32
Identity = 66/140 (47.14%), Postives = 94/140 (67.14%), Query Frame = 2
Query:  338 LTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLK-QY-KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            L  K KNI+++ GAG+S   GIPDFRS   G+Y  L  +Y  +P P+A+FDI YF QNPKPFF  AKE++P G+++P+  H F   L+E   L R Y+QNID LE++AG+  T +++ HG+F++ASC+RC        +K
Sbjct:   65 LIKKCKNIIVLTGAGVSVSCGIPDFRS-RDGIYAKLSVEYPDLPDPQAMFDITYFNQNPKPFFKFAKEIYP-GQFKPSLCHRFIHQLEEHGHLLRNYSQNIDTLEQVAGI--TRVIQCHGSFSTASCMRCKHKVPCEAIK 200          

HSP 2 Score: 68.5514 bits (166), Expect = 2.397e-12
Identity = 39/86 (45.35%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 1076 ESIDKSEICYCSKCR------GIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPV 1312
            E I +  I  CS C        I+KPDIVFFGE LPS F+     D  +ADLL+V+G+SL+V P A I        P++LINR+P+
Sbjct:  201 EDIFRKNIPVCSTCSPDEEFPSIMKPDIVFFGESLPSNFYTHLGDDSNKADLLIVIGSSLKVRPVALIPSHISPEVPQILINREPL 286          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Nematostella
Match: EDO35866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK95])

HSP 1 Score: 66.2402 bits (160), Expect = 1.477e-11
Identity = 44/137 (32.12%), Postives = 65/137 (47.45%), Query Frame = 2
Query:  359 IVIMAGAGISCPSGIPDFRSPGTGLY----DNLKQYKIPYPEAIFDIDYFLQN--PKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            I ++ GAGIS  SGI D+RS G GLY    D   +Y++    A+    Y+ +N    P F         G  +PN+ HY    L+    +  + TQN+D L   AG    N++E HG      C+ C +  + T L+
Sbjct:   63 IFVITGAGISTESGIRDYRSEGKGLYAITNDRPMEYQVFLKSAVMRQRYWARNYVGWPEF---------GSRQPNEAHYALAKLETLGSVHSLVTQNVDALHTKAG--SKNVIELHGCSHRVICLGCNQITARTALQ 188          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Medaka
Match: sirt3 (sirtuin 3 [Source:NCBI gene;Acc:101161471])

HSP 1 Score: 192.971 bits (489), Expect = 4.232e-54
Identity = 90/149 (60.40%), Postives = 112/149 (75.17%), Query Frame = 2
Query:  305 QKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            Q  + DI + +   + K +V+MAGAGIS PSGIPDFRSPG+GLYDNL+QY +PY EAIF+I +F +NP PFFALAKEL+P G YRPN  H+F  LL +K  L R+YTQNIDGLERLAG+    LVEAHGTFA+A+C  C + Y   +L+
Sbjct:   65 QLTLQDIARSLRDRQHKRVVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYDLPYAEAIFEIGFFHRNPAPFFALAKELYP-GNYRPNPTHFFVHLLHQKGQLLRMYTQNIDGLERLAGIPPEKLVEAHGTFATATCTSCLQKYKGEELR 212          

HSP 2 Score: 107.842 bits (268), Expect = 6.645e-25
Identity = 51/95 (53.68%), Postives = 64/95 (67.37%), Query Frame = 2
Query: 1079 SIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGK 1363
            ++    +  CS C G+VKPDIVFFGE+LP  F  + +DF  ADLL++MGTSLEVEPFAS+  + R   PR+LINR PVG F   RR  D   LG+
Sbjct:  214 AVMSGSVPKCSACGGVVKPDIVFFGEELPPHFLKYLTDFPLADLLIIMGTSLEVEPFASLAGAVRSSVPRLLINRDPVGPFVWGRRPQDVLQLGE 308          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Medaka
Match: si:dkey-103i16.6 (NAD-dependent protein deacetylase sirtuin-3, mitochondrial [Source:NCBI gene;Acc:101165477])

HSP 1 Score: 187.963 bits (476), Expect = 1.607e-51
Identity = 85/146 (58.22%), Postives = 112/146 (76.71%), Query Frame = 2
Query:  314 IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            ++ + + +   + KN+V++AGAGIS  SGIPDFR+PGTGLY NL++Y +PYPEAIF+IDYF  NP+PFF+LAK L+P G +RPN +HYF R+L  K LL R+YTQNIDGLE+L G+ D  LVEAHG+FA+ASC  C   Y A + +
Sbjct:  107 LLSVARLVKLGRCKNVVVVAGAGISTASGIPDFRTPGTGLYSNLEKYNVPYPEAIFNIDYFSDNPQPFFSLAKVLYP-GSHRPNYIHYFIRVLHHKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATASCHLCYTPYPAEEAR 251          

HSP 2 Score: 103.99 bits (258), Expect = 4.374e-23
Identity = 64/151 (42.38%), Postives = 88/151 (58.28%), Query Frame = 2
Query:  929 HHRSFHPQLWVKNLNG--KMC*FP*---IINCGSLSKNSLSNISGP-KASLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVF-RSKRRVHDNCVLG 1360
            HH+    +++ +N++G  K+C  P    +   GS +  S      P  A    Y  +I    +  CS C   VKPD+VFFGEDLP K+ L R DF +ADLL++MGTSL++EPFAS+V+S R   PR+L+NR  VG F R   R  D+  LG
Sbjct:  199 HHKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATASCHLCYTPYPAEEARY--AIMHDRVPTCSFCTATVKPDVVFFGEDLPRKYFLHRKDFPKADLLIIMGTSLKIEPFASLVNSVRSTVPRLLLNRNAVGPFERVPLRRGDHMELG 347          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Medaka
Match: sirt3 (sirtuin 3 [Source:NCBI gene;Acc:101161471])

HSP 1 Score: 182.956 bits (463), Expect = 2.054e-51
Identity = 85/128 (66.41%), Postives = 101/128 (78.91%), Query Frame = 2
Query:  368 MAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            MAGAGIS PSGIPDFRSPG+GLYDNL+QY +PY EAIF+I +F +NP PFFALAKEL+P G YRPN  H+F  LL +K  L R+YTQNIDGLERLAG+    LVEAHGTFA+A+C  C + Y   +L+
Sbjct:    1 MAGAGISTPSGIPDFRSPGSGLYDNLQQYDLPYAEAIFEIGFFHRNPAPFFALAKELYP-GNYRPNPTHFFVHLLHQKGQLLRMYTQNIDGLERLAGIPPEKLVEAHGTFATATCTSCLQKYKGEELR 127          

HSP 2 Score: 107.842 bits (268), Expect = 1.778e-25
Identity = 51/95 (53.68%), Postives = 64/95 (67.37%), Query Frame = 2
Query: 1079 SIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGK 1363
            ++    +  CS C G+VKPDIVFFGE+LP  F  + +DF  ADLL++MGTSLEVEPFAS+  + R   PR+LINR PVG F   RR  D   LG+
Sbjct:  129 AVMSGSVPKCSACGGVVKPDIVFFGEELPPHFLKYLTDFPLADLLIIMGTSLEVEPFASLAGAVRSSVPRLLINRDPVGPFVWGRRPQDVLQLGE 223          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Medaka
Match: sirt2 (sirtuin 2 [Source:NCBI gene;Acc:101155450])

HSP 1 Score: 181.415 bits (459), Expect = 1.080e-49
Identity = 93/176 (52.84%), Postives = 120/176 (68.18%), Query Frame = 2
Query:  242 EMIYLSSTFGRYLSTPSGTD--DQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
            EM +L + F   L   S     D   +  + Q I + K KNI+ M GAGIS  +GIPDFRSP TGLY NL++Y +PYPEAIF IDYF ++P+PFF LAKEL+P G+++P   HYF +LL+ K LLRR YTQNID LER+AGL   +L+EAHGTF ++ CV   C ++YS   +K K
Sbjct:   37 EMDFLRNLFSSTLGLGSAEKVLDALTLEGVAQYIKSGKCKNIICMVGAGISTSAGIPDFRSPETGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFTLAKELYP-GQFKPTICHYFIKLLKNKGLLRRCYTQNIDTLERVAGLEKEDLIEAHGTFYTSHCVSFCCRKEYSLDWMKEK 211          

HSP 2 Score: 83.1889 bits (204), Expect = 1.884e-16
Identity = 43/87 (49.43%), Postives = 55/87 (63.22%), Query Frame = 2
Query: 1058 SLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVG 1315
            SL    E I    I  C KC  +VKPDIVFFGE+LP++F    + DF + DLL+VMGTSL+V+PFA +V       PR+LIN +  G
Sbjct:  204 SLDWMKEKIFSDAIPKCEKCNSLVKPDIVFFGENLPARFFTSVKMDFPRCDLLIVMGTSLQVQPFAGLVGRVSKSCPRLLINMEKAG 290          
BLAST of NAD-dependent protein deacetylase vs. Ensembl Medaka
Match: sirt2 (sirtuin 2 [Source:NCBI gene;Acc:101155450])

HSP 1 Score: 180.259 bits (456), Expect = 2.679e-49
Identity = 92/170 (54.12%), Postives = 118/170 (69.41%), Query Frame = 2
Query:  254 LSSTFGRYLSTPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVR--CGEDYSATQLKLK 757
             SST G  L +     D   +  + Q I + K KNI+ M GAGIS  +GIPDFRSP TGLY NL++Y +PYPEAIF IDYF ++P+PFF LAKEL+P G+++P   HYF +LL+ K LLRR YTQNID LER+AGL   +L+EAHGTF ++ CV   C ++YS   +K K
Sbjct:   29 FSSTLG--LGSAEKVLDALTLEGVAQYIKSGKCKNIICMVGAGISTSAGIPDFRSPETGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFTLAKELYP-GQFKPTICHYFIKLLKNKGLLRRCYTQNIDTLERVAGLEKEDLIEAHGTFYTSHCVSFCCRKEYSLDWMKEK 195          

HSP 2 Score: 75.8702 bits (185), Expect = 4.814e-14
Identity = 41/75 (54.67%), Postives = 51/75 (68.00%), Query Frame = 2
Query: 1058 SLIIYLESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGT 1282
            SL    E I    I  C KC  +VKPDIVFFGE+LP++F  F SDF + DLL+VMGTSL+V+PFA +V   R+G 
Sbjct:  188 SLDWMKEKIFSDAIPKCEKCNSLVKPDIVFFGENLPARF--FTSDFPRCDLLIVMGTSLQVQPFAGLVG--RYGV 258          
BLAST of NAD-dependent protein deacetylase vs. Planmine SMEST
Match: SMESG000079800.1 (SMESG000079800.1)

HSP 1 Score: 486.878 bits (1252), Expect = 7.686e-162
Identity = 274/309 (88.67%), Postives = 275/309 (89.00%), Query Frame = 2
Query: 2207 DIVKAQTQLEVIAVDXXXXXXXXXXXXXXXXXXXSINSDFLSKLILYEEKFQIIEKSMKQYGKSNDQKASKSGNDQTKWENEMIKSLKLMYENQINFLTEEKERMNKIIFGLKHELEIVKEEARQAVHEFMIKKNMFEELQFNF*TKYRKTRLLFIDSFAPVQV*LRSK*YEYLNIKYEGLEMNFIKNLDQLNSIQISVTVNNLELKNLRHKEAHWKSQCNQAQLSFSRLSNDWILLQADNNEIKRQIEILKNSLEKSESHNKSLQTEIFKLQSKINCLENEKKIESFNSRCANRPKIYESPLITTFDQ 3133
            DIVKAQTQLEVIAVDLKEKEEELNNIILENIELKSINSDFLSKLILYEEKFQIIEKSMKQYGKSNDQKASKSGNDQTKWENEMIKSLKLMYENQINFLTEEKERMNKIIFGLKHELEIVKEEARQAVHEFMIKKNMFEELQ                                  IKYEGLEMNFIKNLDQLNSIQISVTVNNLELKNLRHKEAHWKSQCNQAQLSFS+LSNDWILLQADNNEIKRQIEILKNSLEKSESHNKSLQTEIFKLQSKINCLENEKKIESFNSRCANRPKIYESPLITTFDQ
Sbjct:   35 DIVKAQTQLEVIAVDLKEKEEELNNIILENIELKSINSDFLSKLILYEEKFQIIEKSMKQYGKSNDQKASKSGNDQTKWENEMIKSLKLMYENQINFLTEEKERMNKIIFGLKHELEIVKEEARQAVHEFMIKKNMFEELQ----------------------------------IKYEGLEMNFIKNLDQLNSIQISVTVNNLELKNLRHKEAHWKSQCNQAQLSFSKLSNDWILLQADNNEIKRQIEILKNSLEKSESHNKSLQTEIFKLQSKINCLENEKKIESFNSRCANRPKIYESPLITTFDQ 309          
BLAST of NAD-dependent protein deacetylase vs. Planmine SMEST
Match: SMESG000079803.1 (SMESG000079803.1)

HSP 1 Score: 351.673 bits (901), Expect = 2.613e-110
Identity = 168/173 (97.11%), Postives = 168/173 (97.11%), Query Frame = 2
Query:  260 STFGRYLSTPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKLKHSISEIC 778
            STFGRYLSTPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK     SEIC
Sbjct:  125 STFGRYLSTPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKESIDKSEIC 297          

HSP 2 Score: 203.756 bits (517), Expect = 1.931e-56
Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 2
Query: 1076 ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLG 1360
            ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLG
Sbjct:  289 ESIDKSEICYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLG 383          
BLAST of NAD-dependent protein deacetylase vs. Planmine SMEST
Match: SMESG000079103.1 (SMESG000079103.1)

HSP 1 Score: 126.331 bits (316), Expect = 6.613e-30
Identity = 62/125 (49.60%), Postives = 89/125 (71.20%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            KNI+++ GAGIS P G+PDFRS   G+Y  L      +  P+++FDI YF +NPKPFF  AKE++P GK+ P+  H F ++L++K  L R Y+QNID LE++AG+   N++  HG+FASA+C+RC
Sbjct:  107 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYP-GKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRC 227          

HSP 2 Score: 59.6918 bits (143), Expect = 7.745e-9
Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 2
Query: 1124 IVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQ 1306
            I+KPD+VFFGE LP  FH     D  Q DLL+V+G+SL+V P A I        P++LIN++
Sbjct:  278 IMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKE 339          
BLAST of NAD-dependent protein deacetylase vs. Planmine SMEST
Match: SMESG000079103.1 (SMESG000079103.1)

HSP 1 Score: 125.946 bits (315), Expect = 6.780e-30
Identity = 62/125 (49.60%), Postives = 89/125 (71.20%), Query Frame = 2
Query:  353 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRC 721
            KNI+++ GAGIS P G+PDFRS   G+Y  L      +  P+++FDI YF +NPKPFF  AKE++P GK+ P+  H F ++L++K  L R Y+QNID LE++AG+   N++  HG+FASA+C+RC
Sbjct:   98 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYP-GKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRC 218          

HSP 2 Score: 59.6918 bits (143), Expect = 7.906e-9
Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 2
Query: 1124 IVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQ 1306
            I+KPD+VFFGE LP  FH     D  Q DLL+V+G+SL+V P A I        P++LIN++
Sbjct:  269 IMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKE 330          
BLAST of NAD-dependent protein deacetylase vs. Planmine SMEST
Match: SMESG000062887.1 (SMESG000062887.1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.486e-22
Identity = 65/147 (44.22%), Postives = 89/147 (60.54%), Query Frame = 2
Query:  314 IVDICQKILTSKIKNIVIMAGAGISCPSGIPDFRSPGTGLYDNLK-QYKIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLK 751
            ++DI + I +++ K IV   GAGIS  +GIPDFRS   GLY+ +K +  +P PE IFDI YF  +P  F  +AK+ F    Y P   H F +LL  KKLL R +TQNIDGL+   G+ D   +E HG F +  C+ C + YS  ++K
Sbjct:   30 LIDIIEIIRSNESK-IVTFTGAGISTSAGIPDFRSEN-GLYNIVKSKLNMPNPELIFDISYFEIDPTMFCCIAKQ-FIQNDYYPTLTHCFLKLLHNKKLLLRNFTQNIDGLDSKVGIPDDINIECHGHFKTGHCLSCEKLYSYEEMK 173          

HSP 2 Score: 68.5514 bits (166), Expect = 3.838e-12
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = 2
Query: 1100 CYCSKCRGIVKPDIVFFGEDLPSKFHLFRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLI-NRQPVG 1315
            C    C G+VKPDIV FGE LP K     +   +ADL++VMG+SL V PF   ++  R  TP ++I N QP G
Sbjct:  184 CQAENCNGLVKPDIVLFGESLPKKVFENLNKISKADLIIVMGSSLRVTPFNQFINLARKETPLLVINNEQPSG 256          
The following BLAST results are available for this feature:
BLAST of NAD-dependent protein deacetylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIRT32.209e-5355.36sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931][more]
SIRT35.248e-5358.22sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931][more]
SIRT31.919e-5256.96sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931][more]
SIRT33.026e-5161.27sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931][more]
SIRT21.639e-4949.43sirtuin 2 [Source:HGNC Symbol;Acc:HGNC:10886][more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sir-2.11.420e-2742.96NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.11.420e-2742.96NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.11.420e-2742.96NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.11.534e-2742.96NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.11.534e-2742.96NAD-dependent protein deacetylase sir-2.1 [Source... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sirt22.651e-4657.89gene:FBgn0038788 transcript:FBtr0083882[more]
Sirt22.651e-4657.89gene:FBgn0038788 transcript:FBtr0344243[more]
Sirt11.920e-2844.62gene:FBgn0024291 transcript:FBtr0080434[more]
Sirt63.827e-1127.75gene:FBgn0037802 transcript:FBtr0305358[more]
Sirt45.511e-1132.21gene:FBgn0029783 transcript:FBtr0070852[more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sirt32.146e-5763.76sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
sirt32.184e-5763.76sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
si:dkey-103i16.61.067e-5457.86si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
si:dkey-103i16.61.279e-5457.86si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
sirt26.093e-5353.14sirtuin 2 (silent mating type information regulati... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIRT26.536e-5656.50sirtuin 2 [Source:NCBI gene;Acc:100489469][more]
SIRT27.773e-5556.50sirtuin 2 [Source:NCBI gene;Acc:100489469][more]
SIRT24.137e-5456.50sirtuin 2 [Source:NCBI gene;Acc:100489469][more]
SIRT23.780e-5356.65sirtuin 2 [Source:NCBI gene;Acc:100489469][more]
hoga12.737e-5264.584-hydroxy-2-oxoglutarate aldolase 1 [Source:Xenbas... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sirt33.294e-5455.76sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665][more]
Sirt35.553e-5260.71sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665][more]
Sirt39.744e-5261.27sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665][more]
Sirt33.679e-5161.27sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665][more]
Sirt33.679e-5161.27sirtuin 3 [Source:MGI Symbol;Acc:MGI:1927665][more]
back to top
BLAST of NAD-dependent protein deacetylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R104|SIR3_MOUSE1.469e-5255.76NAD-dependent protein deacetylase sirtuin-3 OS=Mus... [more]
sp|Q7ZVK3|SIR2_DANRE5.264e-5253.14NAD-dependent protein deacetylase sirtuin-2 OS=Dan... [more]
sp|Q9NTG7|SIR3_HUMAN9.218e-5256.96NAD-dependent protein deacetylase sirtuin-3, mitoc... [more]
sp|Q5RBF1|SIR2_PONAB1.832e-4747.85NAD-dependent protein deacetylase sirtuin-2 OS=Pon... [more]
sp|Q5RJQ4|SIR2_RAT2.654e-4749.43NAD-dependent protein deacetylase sirtuin-2 OS=Rat... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Z1Z21.955e-6069.86Deacetylase sirtuin-type domain-containing protein... [more]
H2ZB273.299e-6067.57NAD-dependent protein deacetylase OS=Ciona savigny... [more]
A0A1S3JTY34.014e-6069.44NAD-dependent protein deacetylase sirtuin-3 OS=Lin... [more]
W4XPP25.543e-6065.06Deacetylase sirtuin-type domain-containing protein... [more]
H2ZB269.113e-6067.57NAD-dependent protein deacetylase OS=Ciona savigny... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sirt34.662e-5665.28sirtuin 3 [Source:NCBI gene;Acc:103044645][more]
si:dkey-103i16.63.479e-5254.49si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
si:dkey-103i16.61.704e-5160.00si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
sirt25.015e-5151.98sirtuin 2 [Source:NCBI gene;Acc:103038996][more]
ENSAMXT00000003809.22.738e-2747.20pep primary_assembly:Astyanax_mexicanus-2.0:25:451... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sirt28.791e-5352.05sirtuin 2 (silent mating type information regulati... [more]
sirt34.948e-4861.11sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
sirt42.421e-1228.98sirtuin 4 [Source:ZFIN;Acc:ZDB-GENE-041010-65][more]
sirt61.537e-928.57sirtuin 6 [Source:ZFIN;Acc:ZDB-GENE-031007-2][more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HST28.004e-4757.14Cytoplasmic NAD(+)-dependent protein deacetylase; ... [more]
HST13.704e-2644.35NAD(+)-dependent histone deacetylase; essential su... [more]
SIR24.835e-2441.01Conserved NAD+ dependent histone deacetylase of th... [more]
HST32.378e-1634.42Member of the Sir2 family of NAD(+)-dependent prot... [more]
HST41.813e-730.94NAD(+)-dependent protein deacetylase; deacetylatio... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476722.009e-5166.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468132.217e-4556.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484594.364e-4349.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316841.231e-3247.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358661.477e-1132.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sirt34.232e-5460.40sirtuin 3 [Source:NCBI gene;Acc:101161471][more]
si:dkey-103i16.61.607e-5158.22NAD-dependent protein deacetylase sirtuin-3, mitoc... [more]
sirt32.054e-5166.41sirtuin 3 [Source:NCBI gene;Acc:101161471][more]
sirt21.080e-4952.84sirtuin 2 [Source:NCBI gene;Acc:101155450][more]
sirt22.679e-4954.12sirtuin 2 [Source:NCBI gene;Acc:101155450][more]
back to top
BLAST of NAD-dependent protein deacetylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079800.17.686e-16288.67SMESG000079800.1[more]
SMESG000079803.12.613e-11097.11SMESG000079803.1[more]
SMESG000079103.16.613e-3049.60SMESG000079103.1[more]
SMESG000079103.16.780e-3049.60SMESG000079103.1[more]
SMESG000062887.12.486e-2244.22SMESG000062887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027733 ID=SMED30027733|Name=NAD-dependent protein deacetylase|organism=Schmidtea mediterranea sexual|type=transcript|length=3133bp
TATTTAGAATAGCTTGGATTTTTATACGAAAACGTTTTTTGGACCCCTCA
TTTGAAATCCTGACTACACCGCTGTGTCACACTAACGGCTTAAACAAATA
AACCGCTTCTAACTTTCGCAATATCGGAATTTTGAGAAAATTTAAACTGA
ACTCATTTTCTATATTTCCAAAGATTAATTTATTAAATTCCAAATGACAA
TTTGATAGTTTTGTGAATGAAAAATTAATTGATTCCCTAATGAAATGATT
TACCTTTCCAGCACATTTGGCAGATATCTTTCTACTCCGTCTGGTACAGA
TGATCAGAAATTTATTGTAGACATATGCCAAAAGATTCTGACGTCAAAAA
TAAAAAACATTGTCATTATGGCCGGAGCTGGCATAAGTTGTCCGAGTGGA
ATTCCTGATTTCAGAAGCCCGGGAACTGGACTATATGACAATCTCAAGCA
ATATAAAATACCTTATCCAGAAGCAATTTTTGATATTGACTATTTTCTTC
AAAATCCAAAACCATTCTTTGCTCTGGCAAAAGAATTATTTCCATCAGGA
AAATACAGACCAAATAAAGTGCACTACTTTTTCCGACTTTTACAGGAAAA
GAAATTATTGCGCAGGGTTTATACTCAAAACATCGACGGACTTGAAAGAT
TAGCCGGACTGAATGATACAAACCTTGTTGAAGCTCATGGAACATTTGCA
TCTGCTAGCTGTGTTCGTTGTGGTGAAGATTATTCGGCAACACAATTAAA
ACTAAAACATTCGATTTCTGAGATTTGTGAAATATTCTTCATTGCTTCAG
TAGTATTGCAATTTACACTTTAAAATATCTAACCTATATAACCAATATCA
GACCGAGTATACCCTTATCTCCAATTCTCTACGTCTTTATCTCTATGCTC
AAATATATCCAGCCAGCCTCCGCTCAACCACCATCGTTCTTTCCATCCTC
AATTGTGGGTAAAGAATTTAAATGGTAAAATGTGCTAATTTCCATAAATA
ATAAACTGTGGATCTTTATCAAAAAACTCACTCAGTAACATTTCAGGCCC
GAAGGCATCTTTAATTATTTATCTTGAAAGTATCGATAAAAGTGAAATTT
GTTATTGCTCAAAATGTCGAGGAATCGTTAAACCTGATATCGTTTTCTTT
GGCGAAGACCTTCCATCTAAATTCCATCTGTTTAGAAGTGATTTTCAACA
AGCCGATTTATTATTGGTTATGGGCACATCTTTAGAAGTGGAACCATTTG
CTAGCATCGTAGACTCTACCAGATTCGGCACTCCTCGGGTTTTAATCAAC
AGGCAACCTGTTGGCGTTTTTCGTTCCAAACGACGAGTGCATGATAATTG
TGTTTTAGGCAAACAAACAAGTGTATCCGAGCTAGCTGGAACCGATTGCG
GACGCAGATCCTCAGCCCTCACTCTTCTACAGCAGCCTATATTAGAAATG
CAGAGGGGAGCGAAAAGTGGAAGCAATGGAGCAGCGCTCTCTTTGGCTGC
TACAACGAGTGGCGGAAAGTGCTTCACAAGCACTGGCCAGGATAGATATT
TTTTATATTGTAAAATATTTATTAGAAGGAGCGACGGACAGTGACCAAGC
AGAGGTCGAAAAAAGCTGGAACCGACTACGAGCTTCCTTGATTGGTCAGA
GTCGGGACACTATGACCATATGAGGAGAATTCTTTTGAACCTGCAGAAAT
ACTACGACGGAAGACACCACCAAGGCCTTCTGGAAAATATACAGAGTATG
CCGACATCAAATGGCGAAACTGCCTGCAAATGGACAGAGCTGCAGACCAG
ACAAGTCGTAAAAACGATAAAATATTGAGTGGACCCACACGCAGCTGTCG
TGTGGATGCCCACAAATACCCAGGGGATTGTAATAATATAAATGATAAAA
TTCCAAATGGAAATTATGAAAAAAATAATAACAATATTGAAAACATTTAT
TTTAACAGAAAGATCATTGAAAATGGGCCCATTGTTCCCAATCGAGTTGA
AATCCATAAACCAGCCATCCCTATAAGAGCCAATGAGAGAGCTGCCACTC
AGGATGAACCAATAACGCGGATGACGGATATAATTCTTGAGCCAGGAGTA
AATCAGTTGAGGAATTCTGACGGTGGGATCCGGATGGGGAATCTTCATGA
TGGGGCTGGCAAATCCGATTGAGCAGCTTAATATTGAGAACCTTCAAAAT
CAAAACGACATTGTTAAAGCTCAAACGCAGCTGGAAGTTATAGCGGTTGA
TTTAAAAGAAAAAGAAGAAGAGCTCAACAATATTATTCTAGAAAATATTG
AATTAAAATCCATCAATTCAGATTTTCTTTCAAAATTAATTCTCTATGAG
GAGAAATTTCAAATAATAGAGAAATCCATGAAACAATATGGGAAATCCAA
TGATCAGAAAGCATCTAAGTCAGGGAACGATCAAACAAAATGGGAAAATG
AAATGATTAAGTCATTGAAATTGATGTATGAAAACCAAATTAATTTTCTC
ACAGAAGAAAAAGAAAGGATGAATAAAATCATATTTGGATTAAAACATGA
GTTGGAAATTGTTAAGGAGGAAGCTCGTCAAGCAGTTCACGAATTTATGA
TTAAAAAGAACATGTTTGAAGAACTGCAATTCAACTTTTGAACAAAATAT
CGCAAAACGCGACTGCTCTTTATTGACAGTTTTGCGCCTGTGCAAGTGTA
ACTCAGGTCAAAGTGATATGAATATCTGAATATAAAATATGAAGGTTTGG
AAATGAACTTTATAAAAAATTTGGATCAACTGAACTCAATTCAAATTTCT
GTCACAGTTAACAATTTGGAATTAAAGAATTTGCGCCATAAAGAAGCCCA
TTGGAAATCCCAATGCAATCAAGCTCAATTATCATTTTCTAGATTATCTA
ATGATTGGATTTTATTACAAGCGGATAACAATGAGATAAAAAGACAGATA
GAAATTCTGAAGAATTCCTTAGAAAAAAGTGAATCTCATAACAAAAGTTT
ACAAACAGAGATATTCAAGTTACAATCCAAAATTAATTGCTTAGAAAACG
AAAAGAAAATTGAATCGTTCAATTCCAGATGTGCAAACAGGCCCAAAATT
TACGAATCCCCTTTGATCACGACATTTGATCAA
back to top

protein sequence of SMED30027733-orf-1

>SMED30027733-orf-1 ID=SMED30027733-orf-1|Name=SMED30027733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MMGLANPIEQLNIENLQNQNDIVKAQTQLEVIAVDLKEKEEELNNIILEN
IELKSINSDFLSKLILYEEKFQIIEKSMKQYGKSNDQKASKSGNDQTKWE
NEMIKSLKLMYENQINFLTEEKERMNKIIFGLKHELEIVKEEARQAVHEF
MIKKNMFEELQFNF*
back to top

protein sequence of SMED30027733-orf-2

>SMED30027733-orf-2 ID=SMED30027733-orf-2|Name=SMED30027733-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MNFIKNLDQLNSIQISVTVNNLELKNLRHKEAHWKSQCNQAQLSFSRLSN
DWILLQADNNEIKRQIEILKNSLEKSESHNKSLQTEIFKLQSKINCLENE
KKIESFNSRCANRPKIYESPLITTFDQ
back to top

protein sequence of SMED30027733-orf-3

>SMED30027733-orf-3 ID=SMED30027733-orf-3|Name=SMED30027733-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MIYLSSTFGRYLSTPSGTDDQKFIVDICQKILTSKIKNIVIMAGAGISCP
SGIPDFRSPGTGLYDNLKQYKIPYPEAIFDIDYFLQNPKPFFALAKELFP
SGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGT
FASASCVRCGEDYSATQLKLKHSISEICEIFFIASVVLQFTL*
back to top

protein sequence of SMED30027733-orf-4

>SMED30027733-orf-4 ID=SMED30027733-orf-4|Name=SMED30027733-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MDRAADQTSRKNDKILSGPTRSCRVDAHKYPGDCNNINDKIPNGNYEKNN
NNIENIYFNRKIIENGPIVPNRVEIHKPAIPIRANERAATQDEPITRMTD
IILEPGVNQLRNSDGGIRMGNLHDGAGKSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0017136NAD-dependent histone deacetylase activity
GO:0046872metal ion binding
GO:0070403NAD+ binding
Vocabulary: biological process
TermDefinition
GO:0016575histone deacetylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR003000Sirtuin
IPR029035DHS-like_NAD/FAD-binding_dom
IPR026591Sirtuin_cat_small_dom_sf
IPR026590Ssirtuin_cat_dom