Niemann-Pick disease, type C1

Overview
NameNiemann-Pick disease, type C1
Smed IDSMED30027726
Length (bp)4069
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Niemann-Pick disease, type C1 (SMED30027726) t-SNE clustered cells

Violin plots show distribution of expression levels for Niemann-Pick disease, type C1 (SMED30027726) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Niemann-Pick disease, type C1 (SMED30027726) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Niemann-Pick disease, type C1 (SMED30027726) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027726

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30027726SMESG000005000.1 dd_Smed_v4_5175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027726SMESG000005000.1 dd_Smed_v4_5175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30027726SMESG000005000.1 SMESG000000520.1 Contig37979newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027726SMESG000005000.1 SMESG000000520.1 Contig37979uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Human
Match: NPC1 (NPC intracellular cholesterol transporter 1 [Source:HGNC Symbol;Acc:HGNC:7897])

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 544/1277 (42.60%), Postives = 775/1277 (60.69%), Query Frame = 1
Query:  103 NDKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGY--------GGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDA-TSNAPFQINYL------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY------DKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARR--CLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFT----WINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKF-KEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRL-YPDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLG-NSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKK 3834
            +  C+WYG+C  +  +K  NC Y+GPPKPL    G+  + +LCP +     N SLCC+  QL TL   L         CP+C  N + L+C LTC P Q  F  VT    Y          +++ + Y + ++F   ++N+C +V   S+N  A+  +CG   + C+   + + + +     APF I  +      + ++ MN     C+ +  E     CSCQDC   C   P P  P   +TILG+D    I+ I + AF ++    +  ++  + +Y        D          +  + S  D   A  E  L   F RWG F  R   C+I  S+  I A   S G++  +VTT+PV+LWS+PSS AR  K+YFD++FGPF+RTEQ+II    R P T    +  Y  S  ++ +GP  +I +L +V  L   I N+   +   N    L+DIC  PLSP    C ++SV+ YFQN+ + LD    D+F    A Y    + C++ P ++  T    + C G FGGPVFP+L  GG+ D +NY ++TALVITF VNN  + ++++++ A  WEK F+N V+N+   N +L IS+TAERS++DE++R+S++D+FT+ +SY IMF Y+++ LG   + +++ VDSKV+LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FILVQ YQR DE    + L  +Q++ RV+ +V PSM LSS SE++AFF G ++ MPAV  FSL+A  AV  DFLLQIT  +++L LD KR E  R+D+ CCVR     T V A           L   F   Y+P+L K  +R +V+  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +++ YL  GPPVYF++++G++Y S   QNM+CG  GCN  SL+ Q+F A+Q  N T I  + +SW+DD+F W K   +  CCR+      FC ASVV+  C  C P     K RP    F  +L  FL++NP+ +C KGGHAAY  AVNI       H    +GATYFMTYHT+L+T +D+ +ALK +  IA++VTE    T+G N + + V PYSVFYVFYEQYLT+       LGV LG + LVT VLLG +  + +I+   I +++ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HI RA+ V    +R+ERA E L  MGSSV SGITLTK GGI+VLAF+KSQ+FQIFYFRMYL +V+ GA H +IFLPV LS+ GP++N+ K
Sbjct:   22 SQSCVWYGECGIAYGDKRYNCEYSGPPKPLPK-DGYDLVQELCPGF--FFGNVSLCCDVRQLQTLKDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQFLNVTATEDYVDPVTNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTA-PCSCQDCSIVCGPKPQPPPPPAPWTILGLDAMYVIMWITYMAFLLVFFGAFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLFTRWGSFCVRNPGCVIFFSLVFITA--CSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLII----RAPLTDKHIYQPYP-SGADVPFGPPLDIQILHQVLDLQIAIENIT--ASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDF-FVYADYHTHFLYCVRAPASLNDTSLLHDPCLGTFGGPVFPWLVLGGY-DDQNYNNATALVITFPVNNYYN-DTEKLQRAQAWEKEFINFVKNYK--NPNLTISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQR-DERLQGETL--DQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQAS-------ESCLFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSS--CCRVDNITDQFCNASVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNIL----LGHG-TRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTE----TMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAK 1259          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Human
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:HGNC Symbol;Acc:HGNC:7898])

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 482/1318 (36.57%), Postives = 730/1318 (55.39%), Query Frame = 1
Query:  112 CIWYGQCDKSNPN--------KILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV----DTGYGGSIQAVTYNLNENFYQGLF-----NSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYL---------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEK---CAVMSVMQYFQNNITQLDRIVTDEFNLPIAT----YMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDL-HISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPASVVNSTC-NNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKM--------PENNSWGN*NSDNIYI 3915
            C +Y +C K NP           ++C    P + +        L K+CP+      N   CC+  QL++L+  LS    +   CP C  NF+ L+C  TC PNQ  F+ V      G G     V Y   E FYQ  F     +SC  V + +A + A+ T+CG      C+   +    GD  +  AP  I +          + ++ +N+ +  CN + G DD   CSCQDC ASCPA   PQ    TF +  + G + ++ I+   F ++ I +  F    +    +D    + P        S  DK        L  +F  WG +VA   L +L + +I  + L+ G++  ++TTDPVELWS+P+S AR  K + D++FGPF+RT Q+I+   +R+ + + +  +  +N  +  + ++DLL  +  L   + +++V+S        L+DIC+ PL+PD      C + S++QYFQNN T L  ++T    L   T    + D  + C   P   K  T     C  D+G PVFP+LA GG+   K+Y+++ AL++TF +NN    + +  +A L WE+AFL  ++ F      +  +++ AERS++DEI+R +  DL   A SYI++F Y+++ LG Y++  ++ VDSK TLGL  V +VL +V  ++GF+SYL +  +L+IL+VVPFLVL+VG DN+FI V  YQR            E  I R + +V PSMLL SLSE++ FF G +T MPAV+ F+L +  AV+ DFLLQ++  +A+L LD+KR EA R+DV CCV+   +  P            G+L   F K YAP L     R +V++ F+     +L  +  I V L+Q+L++PKDSY+++YF  L  Y  VG PVYF+   GYN+ SE   N IC ++GCN  S   ++  A++ P  +Y++   +SW+DDF  W   S    CCRLY  G     FCP++V +  C  NC +      RP  + F  YL +FL + P+++CPKGG AAY  +VN+ +         ++ A+ FM YH  LK   DYTEAL+ + E+AA++T  L+   G    FEV PY++  VFYEQYLT+  +    L +CL     V+ +LLGLD ++ L+    I++I+    GFM LWGI  NA+S++NLV A+G+SVEF++HI R++ +    T +ERA+E  + MGS+V +G+ +T L GI+VL  +K+QL QIF+FR+ L I + G  H ++FLPV LS+ GP +N    +EQK+  E +        P + S  +  +DNIY+
Sbjct:   33 CAFYDECGK-NPELSGSLMTLSNVSCLSNTPARKIT-GDHLILLQKICPRLYT-GPNTQACCSAKQLVSLEASLSITKALLTRCPACSDNFVNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAY---EAFYQHSFAEQSYDSCSRVRVPAAATLAVGTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVARCNESQG-DDVATCSCQDCAASCPAIARPQALDSTFYLGQMPGSLVLIIILCSVFAVVTILLVGF----RVAPARDKSKMVDPK----KGTSLSDKLSFSTHTLLGQFFQGWGTWVASWPLTILVLSVIPVVALAAGLVFTELTTDPVELWSAPNSQARSEKAFHDQHFGPFFRTNQVILTAPNRSSYRYDSLLLGPKN--FSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLL--LLTANQTLMGQTSQVDWKDHFLYCANAPLTFKDGTALALSCMADYGAPVFPFLAIGGY-KGKDYSEAEALIMTFSLNNYPAGDPRLAQAKL-WEEAFLEEMRAFQRRMAGMFQVTFMAERSLEDEINRTTAEDLPIFATSYIVIFLYISLALGSYSSWSRVMVDSKATLGLGGVAVVLGAVMAAMGFFSYLGIRSSLVILQVVPFLVLSVGADNIFIFVLEYQRLPRRPGEPR---EVHIGRALGRVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAVILDFLLQMSAFVALLSLDSKRQEASRLDVCCCVKPQELPPPGQG--------EGLLLGFFQKAYAPFLLHWITRGVVLLLFLALFGVSLYSMCHISVGLDQELALPKDSYLLDYFLFLNRYFEVGAPVYFVTTLGYNFSSEAGMNAICSSAGCNNFSFTQKIQYATEFPEQSYLAIPASSWVDDFIDWLTPSS---CCRLYISGPNKDKFCPSTVNSLNCLKNCMSITMGSVRPSVEQFHKYLPWFLNDRPNIKCPKGGLAAYSTSVNLTSDG-------QVLASRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNVFYEQYLTILPEGLFMLSLCLVPTFAVSCLLLGLDLRSGLLNLLSIVMILVDTVGFMALWGISYNAVSLINLVSAVGMSVEFVSHITRSFAISTKPTWLERAKEATISMGSAVFAGVAMTNLPGILVLGLAKAQLIQIFFFRLNLLITLLGLLHGLVFLPVILSYVGPDVNPALALEQKRAEEAVAAVMVASCPNHPSRVS-TADNIYV 1307          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Human
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:HGNC Symbol;Acc:HGNC:7898])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 484/1339 (36.15%), Postives = 731/1339 (54.59%), Query Frame = 1
Query:  112 CIWYGQCDKSNPN--------KILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV----DTGYGGSIQAVTYNLNENFYQGLF-----NSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYL---------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEK---CAVMSVMQYFQNNITQLDRIVTDEFNLPIAT----YMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDL-HISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPASVVNSTC-NNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEI---------------------GATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKM--------PENNSWGN*NSDNIYI 3915
            C +Y +C K NP           ++C    P + +        L K+CP+      N   CC+  QL++L+  LS    +   CP C  NF+ L+C  TC PNQ  F+ V      G G     V Y   E FYQ  F     +SC  V + +A + A+ T+CG      C+   +    GD  +  AP  I +          + ++ +N+ +  CN + G DD   CSCQDC ASCPA   PQ    TF +  + G + ++ I+   F ++ I +  F    +    +D    + P        S  DK        L  +F  WG +VA   L +L + +I  + L+ G++  ++TTDPVELWS+P+S AR  K + D++FGPF+RT Q+I+   +R+ + + +  +  +N  +  + ++DLL  +  L   + +++V+S        L+DIC+ PL+PD      C + S++QYFQNN T L  ++T    L   T    + D  + C   P   K  T     C  D+G PVFP+LA GG+   K+Y+++ AL++TF +NN    + +  +A L WE+AFL  ++ F      +  +++ AERS++DEI+R +  DL   A SYI++F Y+++ LG Y++  ++ VDSK TLGL  V +VL +V  ++GF+SYL +  +L+IL+VVPFLVL+VG DN+FI V  YQR            E  I R + +V PSMLL SLSE++ FF G +T MPAV+ F+L +  AV+ DFLLQ++  +A+L LD+KR EA R+DV CCV+   +  P            G+L   F K YAP L     R +V++ F+     +L  +  I V L+Q+L++PKDSY+++YF  L  Y  VG PVYF+   GYN+ SE   N IC ++GCN  S   ++  A++ P  +Y++   +SW+DDF  W   S    CCRLY  G     FCP++V +  C  NC +      RP  + F  YL +FL + P+++CPKGG AAY  +VN+ + D +    V I                       + FM YH  LK   DYTEAL+ + E+AA++T  L+   G    FEV PY++  VFYEQYLT+  +    L +CL     V+ +LLGLD ++ L+    I++I+    GFM LWGI  NA+S++NLV A+G+SVEF++HI R++ +    T +ERA+E  + MGS+V +G+ +T L GI+VL  +K+QL QIF+FR+ L I + G  H ++FLPV LS+ GP +N    +EQK+  E +        P + S  +  +DNIY+
Sbjct:   33 CAFYDECGK-NPELSGSLMTLSNVSCLSNTPARKIT-GDHLILLQKICPRLYT-GPNTQACCSAKQLVSLEASLSITKALLTRCPACSDNFVNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAY---EAFYQHSFAEQSYDSCSRVRVPAAATLAVGTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVARCNESQG-DDVATCSCQDCAASCPAIARPQALDSTFYLGQMPGSLVLIIILCSVFAVVTILLVGF----RVAPARDKSKMVDPK----KGTSLSDKLSFSTHTLLGQFFQGWGTWVASWPLTILVLSVIPVVALAAGLVFTELTTDPVELWSAPNSQARSEKAFHDQHFGPFFRTNQVILTAPNRSSYRYDSLLLGPKN--FSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLL--LLTANQTLMGQTSQVDWKDHFLYCANAPLTFKDGTALALSCMADYGAPVFPFLAIGGY-KGKDYSEAEALIMTFSLNNYPAGDPRLAQAKL-WEEAFLEEMRAFQRRMAGMFQVTFMAERSLEDEINRTTAEDLPIFATSYIVIFLYISLALGSYSSWSRVMVDSKATLGLGGVAVVLGAVMAAMGFFSYLGIRSSLVILQVVPFLVLSVGADNIFIFVLEYQRLPRRPGEPR---EVHIGRALGRVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAVILDFLLQMSAFVALLSLDSKRQEASRLDVCCCVKPQELPPPGQG--------EGLLLGFFQKAYAPFLLHWITRGVVLLLFLALFGVSLYSMCHISVGLDQELALPKDSYLLDYFLFLNRYFEVGAPVYFVTTLGYNFSSEAGMNAICSSAGCNNFSFTQKIQYATEFPEQSYLAIPASSWVDDFIDWLTPSS---CCRLYISGPNKDKFCPSTVNSLNCLKNCMSITMGSVRPSVEQFHKYLPWFLNDRPNIKCPKGGLAAYSTSVNLTS-DGQVLDTVAILSPRLEYSGTISAHCNLYLLDSTSRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNVFYEQYLTILPEGLFMLSLCLVPTFAVSCLLLGLDLRSGLLNLLSIVMILVDTVGFMALWGISYNAVSLINLVSAVGMSVEFVSHITRSFAISTKPTWLERAKEATISMGSAVFAGVAMTNLPGILVLGLAKAQLIQIFFFRLNLLITLLGLLHGLVFLPVILSYVGPDVNPALALEQKRAEEAVAAVMVASCPNHPSRVS-TADNIYV 1334          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Human
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:HGNC Symbol;Acc:HGNC:7898])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 466/1318 (35.36%), Postives = 702/1318 (53.26%), Query Frame = 1
Query:  112 CIWYGQCDKSNPN--------KILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV----DTGYGGSIQAVTYNLNENFYQGLF-----NSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYL---------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEK---CAVMSVMQYFQNNITQLDRIVTDEFNLPIAT----YMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDL-HISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPASVVNSTC-NNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKM--------PENNSWGN*NSDNIYI 3915
            C +Y +C K NP           ++C    P + +        L K+CP+      N   CC+  QL++L+  LS    +   CP C  NF+ L+C  TC PNQ  F+ V      G G     V Y   E FYQ  F     +SC  V + +A + A+ T+CG      C+   +    GD  +  AP  I +          + ++ +N+ +  CN + G DD   CSCQDC ASCPA   PQ    TF +  + G + ++ I+   F ++ I +  F    +    +D    + P        S  DK        L  +F  WG +VA   L +L + +I  + L+ G++  ++TTDPVELWS+P+S AR  K + D++FGPF+RT Q+I+   +R+ + + +  +  +N  +  + ++DLL  +  L   + +++V+S        L+DIC+ PL+PD      C + S++QYFQNN T L  ++T    L   T    + D  + C   P   K  T     C  D+G PVFP+LA GG+   K+Y+++ AL++TF +NN    + +  +A L WE+AFL  ++ F      +  +++ AERS++DEI+R +  DL   A SYI++F Y+++ LG Y++  ++ VDSK TLGL  V +VL +V  ++GF+SYL +  +L+IL+VVPFLVL+VG DN+FI V  YQR            E  I R + +V PSMLL SLSE++ FF G +T MPAV+ F+L +  AV+ DFLLQ++  +A+L LD+KR EA R+DV CCV+   +  P            G+L   F K YAP L     R +V                                              VG PVYF+   GYN+ SE   N IC ++GCN  S   ++  A++ P  +Y++   +SW+DDF  W   S    CCRLY  G     FCP++V +  C  NC +      RP  + F  YL +FL + P+++CPKGG AAY  +VN+ +         ++ A+ FM YH  LK   DYTEAL+ + E+AA++T  L+   G    FEV PY++  VFYEQYLT+  +    L +CL     V+ +LLGLD ++ L+    I++I+    GFM LWGI  NA+S++NLV A+G+SVEF++HI R++ +    T +ERA+E  + MGS+V +G+ +T L GI+VL  +K+QL QIF+FR+ L I + G  H ++FLPV LS+ GP +N    +EQK+  E +        P + S  +  +DNIY+
Sbjct:   33 CAFYDECGK-NPELSGSLMTLSNVSCLSNTPARKIT-GDHLILLQKICPRLYT-GPNTQACCSAKQLVSLEASLSITKALLTRCPACSDNFVNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAY---EAFYQHSFAEQSYDSCSRVRVPAAATLAVGTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVARCNESQG-DDVATCSCQDCAASCPAIARPQALDSTFYLGQMPGSLVLIIILCSVFAVVTILLVGF----RVAPARDKSKMVDPK----KGTSLSDKLSFSTHTLLGQFFQGWGTWVASWPLTILVLSVIPVVALAAGLVFTELTTDPVELWSAPNSQARSEKAFHDQHFGPFFRTNQVILTAPNRSSYRYDSLLLGPKN--FSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLL--LLTANQTLMGQTSQVDWKDHFLYCANAPLTFKDGTALALSCMADYGAPVFPFLAIGGY-KGKDYSEAEALIMTFSLNNYPAGDPRLAQAKL-WEEAFLEEMRAFQRRMAGMFQVTFMAERSLEDEINRTTAEDLPIFATSYIVIFLYISLALGSYSSWSRVMVDSKATLGLGGVAVVLGAVMAAMGFFSYLGIRSSLVILQVVPFLVLSVGADNIFIFVLEYQRLPRRPGEPR---EVHIGRALGRVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAVILDFLLQMSAFVALLSLDSKRQEASRLDVCCCVKPQELPPPGQG--------EGLLLGFFQKAYAPFLLHWITRGVV----------------------------------------------VGAPVYFVTTLGYNFSSEAGMNAICSSAGCNNFSFTQKIQYATEFPEQSYLAIPASSWVDDFIDWLTPSS---CCRLYISGPNKDKFCPSTVNSLNCLKNCMSITMGSVRPSVEQFHKYLPWFLNDRPNIKCPKGGLAAYSTSVNLTSDG-------QVLASRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNVFYEQYLTILPEGLFMLSLCLVPTFAVSCLLLGLDLRSGLLNLLSIVMILVDTVGFMALWGISYNAVSLINLVSAVGMSVEFVSHITRSFAISTKPTWLERAKEATISMGSAVFAGVAMTNLPGILVLGLAKAQLIQIFFFRLNLLITLLGLLHGLVFLPVILSYVGPDVNPALALEQKRAEEAVAAVMVASCPNHPSRVS-TADNIYV 1261          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Human
Match: NPC1 (NPC intracellular cholesterol transporter 1 [Source:HGNC Symbol;Acc:HGNC:7897])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 347/696 (49.86%), Postives = 478/696 (68.68%), Query Frame = 1
Query: 1756 FLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRL-YPDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLG-NSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKK 3834
            F+N V+N+   N +L IS+TAERS++DE++R+S++D+FT+ +SY IMF Y+++ LG   + +++ VDSKV+LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FILVQ YQR DE    + L  +Q++ RV+ +V PSM LSS SE++AFF G ++ MPAV  FSL+A  AV  DFLLQIT  +++L LD KR E  R+D+ CCVR     T V A           L   F   Y+P+L K  +R +V+  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +++ YL  GPPVYF++++G++Y S   QNM+CG  GCN  SL+ Q+F A+Q  N T I  + +SW+DD+F W K   +  CCR+      FC ASVV+  C  C P     K RP    F  +L  FL++NP+ +C KGGHAAY  AVNI            +GATYFMTYHT+L+T +D+ +ALK +  IA++VTE    T+G N + + V PYSVFYVFYEQYLT+       LGV LG + LVT VLLG +  + +I+   I +++ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HI RA+ V    +R+ERA E L  MGSSV SGITLTK GGI+VLAF+KSQ+FQIFYFRMYL +V+ GA H +IFLPV LS+ GP++N+ K
Sbjct:  280 FINFVKNYK--NPNLTISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQR-DERLQGETL--DQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQAS-------ESCLFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSS--CCRVDNITDQFCNASVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILLGHG-----TRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTE----TMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAK 952          

HSP 2 Score: 139.043 bits (349), Expect = 1.641e-32
Identity = 95/286 (33.22%), Postives = 143/286 (50.00%), Query Frame = 1
Query:  778 FTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY-----------------DKDYGNGIV-----PATPEV-DDISTFDKCGAKVEAYLTLWFYRWGMFVARR--CLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFT----WINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIK 1548
            +TILG+D    I+ I + AF ++    +  ++  + +Y                   D G   +     P++P +  + S  D   A  E  L   F RWG F  R   C+I  S+  I A   S G++  +VTT+PV+LWS+PSS AR  K+YFD++FGPF+RTEQ+II    R P T    +  Y  S  ++ +GP  +I +L +V  L   I N+   +   N    L+DIC  PLSP    C ++SV+ YFQN+ + LD    D+F    A Y    + C++
Sbjct:    4 WTILGLDAMYVIMWITYMAFLLVFFGAFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGTAWLLTSTFPSSPVLPGEASCCDPVSAAFEGCLRRLFTRWGSFCVRNPGCVIFFSLVFITA--CSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLII----RAPLTDKHIYQPYP-SGADVPFGPPLDIQILHQVLDLQIAIENIT--ASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDF-FVYADYHTHFLYCVR 279          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Celegans
Match: ncr-1 (NPC intracellular cholesterol transporter 1 homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19127])

HSP 1 Score: 449.129 bits (1154), Expect = 7.564e-135
Identity = 357/1324 (26.96%), Postives = 612/1324 (46.22%), Query Frame = 1
Query:   94 HCKNDKCIWYGQCDKSNPNK----ILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDT--------GYGGSIQ-------AVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALG--DATSNAPFQINYL--NEVK---GMNQTMLPCNMNGGEDDGE----ACSCQDCR----ASCXXXXXXXXXSKTFTILGIDGW-VFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGN-GIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDE------------FNLPIAT--YMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQY----NNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTY--QRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFY-APMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIW-SKQSGNPPCCRLY--PDGSFCP-----ASVVNSTCNNC----------PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILK--TPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILG-------FHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCG 3813
            H  +  CI  G C K   N     + N     P         ++ + + CP     D    LCC   Q   L  Q++ A  I G CP+C  NF +L+C  TC PNQ +FV++          G+    Q        V Y L+ +F +G+F+SC +V        A+  +C +T   C    + + +G  +   N P    +L  + +K       T +  N  G +        ACS  +C     A+       +   +T  + GI    +F++    G+  +++   ++F       YD+DY N     +  E    +   + GA +  ++       GM   R       +G  + +    G+I  K +T+ V++WSSP S AR+ +  F+ NFG   R +QI+++          + D  +    YGPVF+ D+   +  ++N I N+          T L+D+C++P+ P Y+ C +MS   YFQ N   LD     E            F+    T  +M+ +  CI  P + K TK    C G +GGP  P + FG   +  N+  + ++++T +V     +   +I+ A  WEK FL   + + E +  +  S+ AERS+ DEI+  ++ ++ T+ ++   +  YVT +LG+Y    N +  I V S++ LG+ +V+I L+S  CS G +S   +      L V  F+V  +GV   F++V+ Y  QR    Y S +   E  +  V++   P+M  SSL  + +FF G  T++PA++ F LYA  AVL D +L  T+ +A+ + D +R    + +     ++ +++    A  + + + +      F  F  AP L     R +  I F+   +  +     I V  +Q ++  + SY+  +F  L  +  VGPPV+F V    ++   + QN  C   GC++ S    +  A  +   TY+S    +W+D++  W S++S   PCC++Y     +FC      +++ +  C  C          P +    HRP  +VF  +L  FL + P+ +C  GG A++  A++  ++         I A+ FMT+H  L     SD+ +A+    + A  V+ +L+ ++ ++    V  YS  + FYEQY T+   L  QL + +  V  +  V LG+D K             FHI+        FMY++ IP+NALS  NLVM+ GI +EF  ++++ Y         +RA   +  +G  +LSG  +T  G  + L+ +  Q+  +++F+++L  ++  A HA+I LP+ L+F G
Sbjct:   16 HHGDAGCIMRGLCQKHTENAYGPCVTNDTNVEPTAFDKTHPAYEKMVEFCPHLLTGDNK--LCCTPSQAEGLTKQIAQARHILGRCPSCFDNFAKLWCEFTCSPNQQDFVSISEMKPIEKKEGFTPEYQPAEAYVNTVEYRLSTDFAEGMFSSCKDVTF--GGQPALRVMCTST--PCTLTNWLEFIGTQNLDLNIPIHTKFLLYDPIKTPPSDRSTYMNVNFTGCDKSARVGWPACSTSECNKEEYANLIDLDDGKTSGQTCNVHGIACLNIFVMLAFIGSLAVLLCVGFVF-----TSYDEDYTNLRQTQSGEESPKRNRIKRTGAWIHNFMENNARDIGMMAGRNPKSHFFIGCAVLIFCLPGMIYHKESTNVVDMWSSPRSRARQEEMVFNANFGRPQRYQQIMLLS---------HRDFQSSGKLYGPVFHKDIFEELFDILNAIKNISTQDSDGRTIT-LDDVCYRPMGPGYD-CLIMSPTNYFQGNKEHLDMKSNKEETVSEDDDAFDYFSSEATTDEWMNHMAACIDQPMSQK-TKSGLSCMGTYGGPSAPNMVFGK--NSTNHQAANSIMMTILVTQ---RTEPEIQKAELWEKEFLKFCKEYREKSPKVIFSFMAERSITDEIENDAKDEIVTVVIALAFLIGYVTFSLGRYFVCENQLWSILVHSRICLGMLSVIINLLSSFCSWGIFSMFGIHPVKNALVVQFFVVTLLGVCRTFMVVKYYAQQRVSMPYMSPDQCPE-IVGMVMAGTMPAMFSSSLGCAFSFFIGGFTDLPAIRTFCLYAGLAVLIDVVLHCTIFLALFVWDTQRELNGKPEFFFPYQIKDLL---GAYLIGRQRATDTFMTQFFHFQVAPFLMHRMTRIITGIIFIASFITTVILSSKISVGFDQSMAFTEKSYISTHFRYLDKFFDVGPPVFFTVDGELDWHRPDVQNKFCTFPGCSDTSFGNIMNYAVGHTEQTYLSGEMYNWIDNYLEWISRKS---PCCKVYVHDPNTFCSTNRNKSALDDKACRTCMDFDYVANSYPKSSIMYHRPSIEVFYRHLRHFLEDTPNSECVFGGRASFKDAISFTSRG-------RIQASQFMTFHKKLSISNSSDFIKAM----DTARMVSRRLERSIDDTAH--VFAYSKIFPFYEQYSTIMPILTTQLFITVVGVFGIICVTLGIDVKGAACAVICQVSNYFHIV-------AFMYIFNIPVNALSATNLVMSSGILIEFSVNVLKGYACSLRQRAKDRAESTVGSIGPIILSGPVVTMAGSTMFLSGAHLQIITVYFFKLFLITIVSSAVHALIILPILLAFGG 1284          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Celegans
Match: ncr-1 (NPC intracellular cholesterol transporter 1 homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19127])

HSP 1 Score: 449.129 bits (1154), Expect = 7.564e-135
Identity = 357/1324 (26.96%), Postives = 612/1324 (46.22%), Query Frame = 1
Query:   94 HCKNDKCIWYGQCDKSNPNK----ILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDT--------GYGGSIQ-------AVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALG--DATSNAPFQINYL--NEVK---GMNQTMLPCNMNGGEDDGE----ACSCQDCR----ASCXXXXXXXXXSKTFTILGIDGW-VFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGN-GIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDE------------FNLPIAT--YMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQY----NNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTY--QRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFY-APMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIW-SKQSGNPPCCRLY--PDGSFCP-----ASVVNSTCNNC----------PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILK--TPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILG-------FHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCG 3813
            H  +  CI  G C K   N     + N     P         ++ + + CP     D    LCC   Q   L  Q++ A  I G CP+C  NF +L+C  TC PNQ +FV++          G+    Q        V Y L+ +F +G+F+SC +V        A+  +C +T   C    + + +G  +   N P    +L  + +K       T +  N  G +        ACS  +C     A+       +   +T  + GI    +F++    G+  +++   ++F       YD+DY N     +  E    +   + GA +  ++       GM   R       +G  + +    G+I  K +T+ V++WSSP S AR+ +  F+ NFG   R +QI+++          + D  +    YGPVF+ D+   +  ++N I N+          T L+D+C++P+ P Y+ C +MS   YFQ N   LD     E            F+    T  +M+ +  CI  P + K TK    C G +GGP  P + FG   +  N+  + ++++T +V     +   +I+ A  WEK FL   + + E +  +  S+ AERS+ DEI+  ++ ++ T+ ++   +  YVT +LG+Y    N +  I V S++ LG+ +V+I L+S  CS G +S   +      L V  F+V  +GV   F++V+ Y  QR    Y S +   E  +  V++   P+M  SSL  + +FF G  T++PA++ F LYA  AVL D +L  T+ +A+ + D +R    + +     ++ +++    A  + + + +      F  F  AP L     R +  I F+   +  +     I V  +Q ++  + SY+  +F  L  +  VGPPV+F V    ++   + QN  C   GC++ S    +  A  +   TY+S    +W+D++  W S++S   PCC++Y     +FC      +++ +  C  C          P +    HRP  +VF  +L  FL + P+ +C  GG A++  A++  ++         I A+ FMT+H  L     SD+ +A+    + A  V+ +L+ ++ ++    V  YS  + FYEQY T+   L  QL + +  V  +  V LG+D K             FHI+        FMY++ IP+NALS  NLVM+ GI +EF  ++++ Y         +RA   +  +G  +LSG  +T  G  + L+ +  Q+  +++F+++L  ++  A HA+I LP+ L+F G
Sbjct:   16 HHGDAGCIMRGLCQKHTENAYGPCVTNDTNVEPTAFDKTHPAYEKMVEFCPHLLTGDNK--LCCTPSQAEGLTKQIAQARHILGRCPSCFDNFAKLWCEFTCSPNQQDFVSISEMKPIEKKEGFTPEYQPAEAYVNTVEYRLSTDFAEGMFSSCKDVTF--GGQPALRVMCTST--PCTLTNWLEFIGTQNLDLNIPIHTKFLLYDPIKTPPSDRSTYMNVNFTGCDKSARVGWPACSTSECNKEEYANLIDLDDGKTSGQTCNVHGIACLNIFVMLAFIGSLAVLLCVGFVF-----TSYDEDYTNLRQTQSGEESPKRNRIKRTGAWIHNFMENNARDIGMMAGRNPKSHFFIGCAVLIFCLPGMIYHKESTNVVDMWSSPRSRARQEEMVFNANFGRPQRYQQIMLLS---------HRDFQSSGKLYGPVFHKDIFEELFDILNAIKNISTQDSDGRTIT-LDDVCYRPMGPGYD-CLIMSPTNYFQGNKEHLDMKSNKEETVSEDDDAFDYFSSEATTDEWMNHMAACIDQPMSQK-TKSGLSCMGTYGGPSAPNMVFGK--NSTNHQAANSIMMTILVTQ---RTEPEIQKAELWEKEFLKFCKEYREKSPKVIFSFMAERSITDEIENDAKDEIVTVVIALAFLIGYVTFSLGRYFVCENQLWSILVHSRICLGMLSVIINLLSSFCSWGIFSMFGIHPVKNALVVQFFVVTLLGVCRTFMVVKYYAQQRVSMPYMSPDQCPE-IVGMVMAGTMPAMFSSSLGCAFSFFIGGFTDLPAIRTFCLYAGLAVLIDVVLHCTIFLALFVWDTQRELNGKPEFFFPYQIKDLL---GAYLIGRQRATDTFMTQFFHFQVAPFLMHRMTRIITGIIFIASFITTVILSSKISVGFDQSMAFTEKSYISTHFRYLDKFFDVGPPVFFTVDGELDWHRPDVQNKFCTFPGCSDTSFGNIMNYAVGHTEQTYLSGEMYNWIDNYLEWISRKS---PCCKVYVHDPNTFCSTNRNKSALDDKACRTCMDFDYVANSYPKSSIMYHRPSIEVFYRHLRHFLEDTPNSECVFGGRASFKDAISFTSRG-------RIQASQFMTFHKKLSISNSSDFIKAM----DTARMVSRRLERSIDDTAH--VFAYSKIFPFYEQYSTIMPILTTQLFITVVGVFGIICVTLGIDVKGAACAVICQVSNYFHIV-------AFMYIFNIPVNALSATNLVMSSGILIEFSVNVLKGYACSLRQRAKDRAESTVGSIGPIILSGPVVTMAGSTMFLSGAHLQIITVYFFKLFLITIVSSAVHALIILPILLAFGG 1284          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Celegans
Match: ncr-2 (NPC intracellular cholesterol transporter 1 homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:P34389])

HSP 1 Score: 355.14 bits (910), Expect = 4.412e-102
Identity = 312/1250 (24.96%), Postives = 563/1250 (45.04%), Query Frame = 1
Query:  196 NATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV--DTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGD---ATS---NAPFQINYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTIL---GIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQL---------DRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEI-CNGDFGGPVFPYLAFGGFGDK----KNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLG----QYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQ---KIARVVSKVGPXXXXXXXXXXXAFFCG------VMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKF---YAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQL--FMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG-SFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCG 3813
            N T      K C    + +    +CC   QL  +  ++S A+ I G CP+C  NF +L+C  TC P+Q  F+ V   TG    +  + + +N +F +GL+ SC +   ++  +  + ++ G    K     FY  +G    A S   N  FQ + +     MN    PC+ + G     AC   DC  +        K     T +       + +++ I  G   + V+ ++I  Y    +           + P  +D    D     +E        R+   V +  LI +S+G+I+A     G       T  V+  S+     RRN+  F  +FGP +R EQI           +IN   + +++     FN+ L   +  L+ +I N+       N+  KL+DIC+KP+  ++  CA+MS   YFQN  T           D I  D+       + + +  CI++P  +  + + E+ C G+F GP+ P L FGG  +     + Y  +  ++IT ++    DQ       A+ WE AFLN++  +   + +   ++  E SV +EI    ETD     ++   +  +V   LG      ++I    V  K+ + + AV+I +ISV CS+G +S   V  T   + V+ F++  +G++ +F++++T+Q     Y   N++  +   +I+ V+ +  P +L +SL  S   F        V   MPAV++F+ +A  A+L D    + V++ +   DA+R  + + ++     ++N       + +      G L    D F    AP+L K   R  +  FF    + A      +    NQ ++  + SY+  +F  +   L++GPP++F+V+    +     QN  C  +GC++ S+  ++     ++N    Y+      WLD +  +    G+  CC++  DG  FC  S      +   ++  +    + + + + L  FL   PS+QC  GG A    A+N+           +I + YF T+   L   SD  + L ++   A  + + ++  L      +V  YS F+ +YEQYLT+   ++  + + L V  +   + L ++   +L+  F ++     +  +MYL GI +N +S++N+ M++GI+VEF   ++  +   +   R ERA   LV  GS+ LSGI    +     L+F+ S++   ++    +GI +  A H ++++P  L+  G
Sbjct:   62 NPTYMARFEKYCSYLVQEEDKAQVCCTELQLKGMTDRISNAATILGSCPSCFDNFAKLWCQFTCSPDQSKFMKVMETTGPKNVVVKMEFKVNRDFVEGLYESCRHTWFANGLALRLMSLGG----KVSFENFYGFMGTKNLAQSIPINTEFQFSRMK--NAMNIPTTPCHKSAGPKV-PACGAIDCPTNAHQLVDISKVEHLGTKVFHPHFPDFEWLLKIC-GCLALTVLLVFILKYSCHRR-----------SAPNGEDGCYVDLGKGNLEVQFEGLCARYANAVIKHPLIFVSLGLIVAAACCSGNFKFHSLTHSVDQVSAADGETRRNEKKFIHSFGPNHRIEQI-----------FINLPPTTKSM-----FNMPLFEEMFQLVGNIQNLTACYG--NSSVKLDDICYKPIGKNH-GCAIMSPTNYFQNKWTNFENAGPPTIDDEIFDDQ-------HWEHLKYCIRNPLTV--STYSEMSCFGEFSGPIDPILVFGGSNESIKGAEMYYTARTIMITVLIRGPEDQ-------AIAWETAFLNMMSRYEMKHANF--TFMTETSVAEEIHTAVETDKIVSVIACAAVLIWVITMLGINHWPESSILSALVHHKLLISISAVMISVISVWCSIGMFSLFGVHATDNAIVVLFFVITCLGINRIFVIIRTFQANGHCYGLPNISYREMNHRISNVMRRSIPIVLTNSLICSTCLFLAGGVLPYVSVSMPAVEVFARHAGLAILMDTAFYLLVMLPLFQYDARREMSGKCEIWPWYELSNE----SKINLCMEAVDGNLRSPVDWFKLAIAPLLLKKICRIWIATFFFVSLIIACYCTLCLEFGFNQVMAFSETSYLTKHFQNMNENLNIGPPLWFVVEGDVKWHDPKMQNKFCTLAGCDDNSMGNKIRSLAYAENYKGNYLHGDVNIWLDSYLQFMHPRGS--CCKM--DGKQFCDPSNATHCSSCSSSSVASLTTTEYEFYRN-LHHFLETPPSIQCAHGGMALAKPAINLTRNG-------KIQSAYFSTFFKKLNL-SDSIQ-LYDAWRFAKYLADDIEREL-EIPGVKVYVYSTFFPYYEQYLTLSTTVYTLVVLVLFVAFVTISLFLRVNLAGSLVTVFVLLSSYLHLMEWMYLLGITVNVVSVINMAMSLGIAVEFFGQMLHGFYNSKKPKREERAFAALVSNGSTTLSGIFPAIMITAGCLSFADSRVLITYFCNQLVGIGLVCAVHGVVYMPTLLAIFG 1236          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Celegans
Match: ptr-2 (PaTched Related family [Source:UniProtKB/TrEMBL;Acc:P91129])

HSP 1 Score: 104.375 bits (259), Expect = 2.751e-22
Identity = 116/475 (24.42%), Postives = 217/475 (45.68%), Query Frame = 1
Query: 1453 FQNNITQLDRIVTDEFN-LPIATYMDQIMECIKD-----PTNIKPTKFKEICNGDFGGPVFPYLAFGGFG-------------DKKNYTDSTALVITFIVNNALDQNSKQIK-AALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDL--FTIALSYIIMFTYVTITLGQYNNIK-KIPVD---SKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMR-----VDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEI--------FDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYL-SVGPPVYFIVKDGYNYKSENSQNMI 2757
            F N + QLD+ +      L    Y      C++      P+N       ++ N  F    +PY  FG  G               +N TD  A    + +   L  + +++   + +WE     ++  + E +  + I+Y   +++ DE+ R ++T +  F I+++ +I+F+    TL   + I     +D   SK  L +  V+   I++   VGF S + +P   I+  V+PFLVLAVGVDN+F++V   +R     +S+  T  +++   ++    S+L++S ++ L+F  G +T +PAV+IF +Y   A+ F F+ QIT   A L L  K   + R     ++ +   +  ++ T      +  V      H++        F ++YAP+L    VR + +++FV + L A      I   L     + +DSY I ++  L  Y    G  V  ++ +  + ++  S++ +
Sbjct:  110 FANAVYQLDKYIQTRVRVLHNGHYYSYKNLCLQYKNGGCPSNKHVHILSDLHNHGFN-ITYPYFRFGSEGGYIGSSLGGVTVMKGENETDILASAKAWFMIYHLKFHPEEMSYISGEWELELGRMLTQYPE-DPYISITYFHSQTLADELKRNADTLIPRFIISITLLIVFS----TLCSLSFIDGSFSIDWVLSKPILSILGVVSAGIAILTGVGFLSLMGMPYNDIV-GVMPFLVLAVGVDNMFLMVAAVRR-----TSRTHTVHERMGECLADAAVSILITSSTDVLSFGVGAITTIPAVQIFCVYTGVAIFFAFIYQITFFAACLALAMKHEASGRNSLFLIEAVSAEKKTSLSTFQRLFNLGSVPDHSASHDVKQPLTSRFFGEWYAPVLMHPVVRGIAMVWFVIYLLGASYGCSRIKEGLEPVNLLVEDSYAIPHYRLLEKYFWKYGQQVQIVINNAPDLRNHTSRDRV 572          

HSP 2 Score: 62.3882 bits (150), Expect = 2.226e-9
Identity = 41/110 (37.27%), Postives = 66/110 (60.00%), Query Frame = 1
Query: 3475 GFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLS 3804
            G+M LWG+ ++A+SM+ ++M+IG SV++ AHI   YVV R DT   R +E L  +G  +  G  ++ +  + VLA   + +   F+  + L I + G  H ++FLPV LS
Sbjct:  747 GYMTLWGVNLDAISMITIIMSIGFSVDYSAHIAYGYVVSREDTAAGRVKEALSALGWPLSQG-AMSTIIAVSVLADIPAYMIVTFFKTVVLSISL-GLLHGLVFLPVLLS 854          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Celegans
Match: ptc-3 (pep chromosome:WBcel235:II:2845384:2852128:-1 gene:WBGene00004210.1 transcript:Y110A2AL.8c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ptc-3)

HSP 1 Score: 98.9821 bits (245), Expect = 1.887e-20
Identity = 113/486 (23.25%), Postives = 198/486 (40.74%), Query Frame = 1
Query: 1438 SVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPY---LAFGGFG-DKKNYTDSTALVITFIVNNALD-----QNSK-QIKAALD---------------WEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVP------VAKVKYSGI--------LHE-------IFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMI 2757
            S++++ Q N  +L   +T E       Y D +                  C G FG  +  +   L  GG   D      + AL   F+V+ A D     +N K      LD               W++ F   + +             A  S+ D ++  S+ +   I + YI+M  Y   T G++     + V S V L +C V++V IS  C +GF ++L +       +VVPFL L +G+D++F+L+     YDE     N+  + +I  ++ + G S++L+S++  LAF  G +  +PA++ F    A  + F+ +  + +  A++ +D +R    + D+  C R N  +    +VP       ++ + +G          HE         +K Y P L    V+  V+I      +F L  ++   + L     +P+ +    +  A   Y S  P   F V  G      N Q +I
Sbjct:  477 SLLKWMQENPERLGEFLTKEEMPDYPNYGDVMTGG---------------CKG-FGKKIMEWPEDLIIGGIQRDNGKLVSAEALQSVFLVSGAYDVFARIKNDKTDSHPGLDRHHFQPWMAGEIISTWQRNFTKRLYSHELNRERRQFHPLASTSIADMLEEFSQFNYIIIVIGYILMVIYAAFTQGRFQGWW-LAVQSNVALAICGVILVTISSICGLGFATHLGINFNAATTQVVPFLSLGLGIDDMFLLLHN---YDEII---NICNKNEIGVLLKETGMSVMLTSINNILAFISGYVLPIPALRSFCSQTAILLAFNLIFLMFIFPAMIGIDLRRQRKGKRDLAYCSRGNPQMATSQSVPSNVSNMSSRAELAGYEKQADEYKRHEPWYTVGGFLNKIYIPALKNNVVKACVLIGTTTAVVFGLYGMYTSTLGLELADVLPEHTPPAAFLRAREQYFSFYP--MFAVLRGDKLDIPNQQQLI 937          

HSP 2 Score: 75.485 bits (184), Expect = 2.398e-13
Identity = 63/197 (31.98%), Postives = 96/197 (48.73%), Query Frame = 1
Query: 3226 EIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGP 3816
            EI A+  E  +  L N       P  + + F+EQYLT+   L+  + +    V  V  +L+   W ATLI+   +I  +  + GFM L GI +N +S V L+ A+GI VEF AH+  A++     T  +R    L  M   V  G   T L G+++L FS+      ++F     +V  G  + +  LPV L+  GP
Sbjct: 1109 EIRATCEEYSERGLSNH------PSGIAFTFWEQYLTLRWNLFQAICIIALAVFCVISILMFNPWAATLIMCIVVITTI-ELGGFMGLMGIKMNPISAVTLICAVGIGVEFTAHVELAFLTALG-TIDQRLESCLQHMFVPVYHGAISTFL-GVVMLVFSEFDFVVTYFFYTMTLLVALGVFNGLCVLPVILTLVGP 1296          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Fly
Match: Npc1a (gene:FBgn0024320 transcript:FBtr0303907)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 498/1285 (38.75%), Postives = 761/1285 (59.22%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS-----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGT-THEKCDPVAFYKALGDATSN-APFQINYL--------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI---FIYLKKNKYDKDY---GNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD-----YEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGF---GDK----KNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD--LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL-------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI 3837
            C+WYG C+ ++ +   NC Y G  K +    G + L K C    +   N   CC+ +Q+  L+  +  A  I   CP+CM N +R  C  TC P Q  F+ V            I +V  +++  +    + SC  V +      A D +CG  +  +C+P  ++  +GDAT+   PFQI Y+        N    +N T +PCN         ACSC DC  SCP  PP     + F I+G+D +     ++  A F++ + +++   F++ + +  D ++   GN +    P  ++ S F+K GA  E +L  +F +WG + A    + L  G  + ++L  GI   ++TTDPV+LW+SP+S +R  +++FD  F PFYR EQIII   +      I ++ S    T+GPVF+ + L +V  L   I  +        N T+L+DIC+ PLS D       +C V S+  YF ++  +LD    DE N    TY+D + +CI +P          +C   +GGPV P +A GGF   GD+      +  + A+++TF+V N    N   ++ AL WEK F+  + N+++ N    + I++T+ERS++DE++R+S++D+ TI +SY+IMF Y+ I+LG     K++ +DSK+TLG+  V+IVL SV  SVG + Y+ +P TLII+EV+PFLVLAVGVDN+FILVQT+QR        N T EQ++ R++ KVGPSMLL+SLSES  FF G +++MPAV+ F+LYA  A++ DFLLQIT  +++  LD KR E  R+D+ C ++           P +     G+L++ F   Y P L K  VR  V++ F  W  F+++    I + L+Q+L+MP+DS++++YF +L   L++GPPVYF++K    Y + + QN++C    CN+ S+L Q+++AS++ N TYI+   +SW+DD+F W+  + +  CC+   D G FCP    +++C  C     +  RP+ K F  YL FFL +NP   C K GHAAYG AV   N    SH+ + I A+YFM YHTILK+ +DY  AL+++ +I+A++T+ L+  L        ++   EV PYSVFYVFYEQYLT++      +G+ +  + +VTFVL+G D  + L++   I +I+ ++ G MY W I +NA+S+VNLVMA+GISVEF +H+V ++   +S ++I+RA + L +MGSS+ SGITLTK  GI+VLAF+KSQ+FQ+FYFRMYLGIV+ GAAH +IFLPV LS+ G  ++  ++
Sbjct:   33 CVWYGVCNTNDFSHSQNCPYNGTAKEMA-TDGLELLKKRCGFLLENSEN-KFCCDKNQVELLNKNVELAGNILDRCPSCMENLVRHICQFTCSPKQAEFMHVVATQKNKKGDEYISSVDLHISTEYINKTYKSCSQVSVPQTGQLAFDLMCGAYSASRCNPTKWFNFMGDATNPYVPFQITYIQHEPKSNSNNFTPLNVTTVPCN-QAVSSKLPACSCSDCDLSCPQGPPEPPRPEPFKIVGLDAYF----VIMAAVFLVGVLVFLMGSFLFTQGSSMDDNFQVDGNDVSDEMPYSENDSYFEKLGAHTETFLETFFTKWGTYFASNPGLTLIAGASLVVILGYGINFIEITTDPVKLWASPNSKSRLEREFFDTKFSPFYRLEQIIIKAVN---LPQIVHNTSNGPYTFGPVFDREFLTKVLDLQEGIKEINA------NGTQLKDICYAPLSDDGSEIDVSQCVVQSIWGYFGDDRERLDD--HDEDNGFNVTYLDALYDCISNPY---------LCLAPYGGPVDPAIALGGFLPPGDQLTGSTKFELANAIILTFLVKN--HHNKTDLENALTWEKKFVEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVKEFKRVFIDSKITLGIGGVIIVLASVVSSVGVFGYIGLPATLIIVEVIPFLVLAVGVDNIFILVQTHQRDQR---KPNETLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAFALYAGVALIIDFLLQITCFVSLFTLDTKRREENRMDICCFIKGKK--------PDSITSNEGLLYKFFSSVYVPFLMKKIVRASVMVIFFAWLCFSIAIAPRIDIGLDQELAMPQDSFVLHYFQSLNENLNIGPPVYFVLKGDLAYTNSSDQNLVCAGQYCNDDSVLTQIYLASRHSNQTYIARPASSWIDDYFDWAAAASS--CCKYRKDSGDFCPHQ--DTSCLRCNITKNSLLRPEEKEFVKYLPFFLKDNPDDTCAKAGHAAYGGAVRYSN----SHERLNIEASYFMAYHTILKSSADYFLALESARKISANITQMLQGRLMSNGVPMASALTVEVFPYSVFYVFYEQYLTMWSDTLQSMGISVLSIFVVTFVLMGFDVHSALVVVITITMIVVNLGGLMYYWNISLNAVSLVNLVMAVGISVEFCSHLVHSFATSKSVSQIDRAADSLSKMGSSIFSGITLTKFAGILVLAFAKSQIFQVFYFRMYLGIVVIGAAHGLIFLPVLLSYIGAPVSNARL 1269          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Fly
Match: Npc1a (gene:FBgn0024320 transcript:FBtr0303906)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 498/1285 (38.75%), Postives = 761/1285 (59.22%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS-----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGT-THEKCDPVAFYKALGDATSN-APFQINYL--------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI---FIYLKKNKYDKDY---GNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD-----YEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGF---GDK----KNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD--LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL-------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI 3837
            C+WYG C+ ++ +   NC Y G  K +    G + L K C    +   N   CC+ +Q+  L+  +  A  I   CP+CM N +R  C  TC P Q  F+ V            I +V  +++  +    + SC  V +      A D +CG  +  +C+P  ++  +GDAT+   PFQI Y+        N    +N T +PCN         ACSC DC  SCP  PP     + F I+G+D +     ++  A F++ + +++   F++ + +  D ++   GN +    P  ++ S F+K GA  E +L  +F +WG + A    + L  G  + ++L  GI   ++TTDPV+LW+SP+S +R  +++FD  F PFYR EQIII   +      I ++ S    T+GPVF+ + L +V  L   I  +        N T+L+DIC+ PLS D       +C V S+  YF ++  +LD    DE N    TY+D + +CI +P          +C   +GGPV P +A GGF   GD+      +  + A+++TF+V N    N   ++ AL WEK F+  + N+++ N    + I++T+ERS++DE++R+S++D+ TI +SY+IMF Y+ I+LG     K++ +DSK+TLG+  V+IVL SV  SVG + Y+ +P TLII+EV+PFLVLAVGVDN+FILVQT+QR        N T EQ++ R++ KVGPSMLL+SLSES  FF G +++MPAV+ F+LYA  A++ DFLLQIT  +++  LD KR E  R+D+ C ++           P +     G+L++ F   Y P L K  VR  V++ F  W  F+++    I + L+Q+L+MP+DS++++YF +L   L++GPPVYF++K    Y + + QN++C    CN+ S+L Q+++AS++ N TYI+   +SW+DD+F W+  + +  CC+   D G FCP    +++C  C     +  RP+ K F  YL FFL +NP   C K GHAAYG AV   N    SH+ + I A+YFM YHTILK+ +DY  AL+++ +I+A++T+ L+  L        ++   EV PYSVFYVFYEQYLT++      +G+ +  + +VTFVL+G D  + L++   I +I+ ++ G MY W I +NA+S+VNLVMA+GISVEF +H+V ++   +S ++I+RA + L +MGSS+ SGITLTK  GI+VLAF+KSQ+FQ+FYFRMYLGIV+ GAAH +IFLPV LS+ G  ++  ++
Sbjct:   33 CVWYGVCNTNDFSHSQNCPYNGTAKEMA-TDGLELLKKRCGFLLENSEN-KFCCDKNQVELLNKNVELAGNILDRCPSCMENLVRHICQFTCSPKQAEFMHVVATQKNKKGDEYISSVDLHISTEYINKTYKSCSQVSVPQTGQLAFDLMCGAYSASRCNPTKWFNFMGDATNPYVPFQITYIQHEPKSNSNNFTPLNVTTVPCN-QAVSSKLPACSCSDCDLSCPQGPPEPPRPEPFKIVGLDAYF----VIMAAVFLVGVLVFLMGSFLFTQGSSMDDNFQVDGNDVSDEMPYSENDSYFEKLGAHTETFLETFFTKWGTYFASNPGLTLIAGASLVVILGYGINFIEITTDPVKLWASPNSKSRLEREFFDTKFSPFYRLEQIIIKAVN---LPQIVHNTSNGPYTFGPVFDREFLTKVLDLQEGIKEINA------NGTQLKDICYAPLSDDGSEIDVSQCVVQSIWGYFGDDRERLDD--HDEDNGFNVTYLDALYDCISNPY---------LCLAPYGGPVDPAIALGGFLPPGDQLTGSTKFELANAIILTFLVKN--HHNKTDLENALTWEKKFVEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVKEFKRVFIDSKITLGIGGVIIVLASVVSSVGVFGYIGLPATLIIVEVIPFLVLAVGVDNIFILVQTHQRDQR---KPNETLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAFALYAGVALIIDFLLQITCFVSLFTLDTKRREENRMDICCFIKGKK--------PDSITSNEGLLYKFFSSVYVPFLMKKIVRASVMVIFFAWLCFSIAIAPRIDIGLDQELAMPQDSFVLHYFQSLNENLNIGPPVYFVLKGDLAYTNSSDQNLVCAGQYCNDDSVLTQIYLASRHSNQTYIARPASSWIDDYFDWAAAASS--CCKYRKDSGDFCPHQ--DTSCLRCNITKNSLLRPEEKEFVKYLPFFLKDNPDDTCAKAGHAAYGGAVRYSN----SHERLNIEASYFMAYHTILKSSADYFLALESARKISANITQMLQGRLMSNGVPMASALTVEVFPYSVFYVFYEQYLTMWSDTLQSMGISVLSIFVVTFVLMGFDVHSALVVVITITMIVVNLGGLMYYWNISLNAVSLVNLVMAVGISVEFCSHLVHSFATSKSVSQIDRAADSLSKMGSSIFSGITLTKFAGILVLAFAKSQIFQVFYFRMYLGIVVIGAAHGLIFLPVLLSYIGAPVSNARL 1269          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Fly
Match: Npc1a (gene:FBgn0024320 transcript:FBtr0079957)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 498/1285 (38.75%), Postives = 761/1285 (59.22%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS-----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGT-THEKCDPVAFYKALGDATSN-APFQINYL--------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI---FIYLKKNKYDKDY---GNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD-----YEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGF---GDK----KNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD--LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL-------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI 3837
            C+WYG C+ ++ +   NC Y G  K +    G + L K C    +   N   CC+ +Q+  L+  +  A  I   CP+CM N +R  C  TC P Q  F+ V            I +V  +++  +    + SC  V +      A D +CG  +  +C+P  ++  +GDAT+   PFQI Y+        N    +N T +PCN         ACSC DC  SCP  PP     + F I+G+D +     ++  A F++ + +++   F++ + +  D ++   GN +    P  ++ S F+K GA  E +L  +F +WG + A    + L  G  + ++L  GI   ++TTDPV+LW+SP+S +R  +++FD  F PFYR EQIII   +      I ++ S    T+GPVF+ + L +V  L   I  +        N T+L+DIC+ PLS D       +C V S+  YF ++  +LD    DE N    TY+D + +CI +P          +C   +GGPV P +A GGF   GD+      +  + A+++TF+V N    N   ++ AL WEK F+  + N+++ N    + I++T+ERS++DE++R+S++D+ TI +SY+IMF Y+ I+LG     K++ +DSK+TLG+  V+IVL SV  SVG + Y+ +P TLII+EV+PFLVLAVGVDN+FILVQT+QR        N T EQ++ R++ KVGPSMLL+SLSES  FF G +++MPAV+ F+LYA  A++ DFLLQIT  +++  LD KR E  R+D+ C ++           P +     G+L++ F   Y P L K  VR  V++ F  W  F+++    I + L+Q+L+MP+DS++++YF +L   L++GPPVYF++K    Y + + QN++C    CN+ S+L Q+++AS++ N TYI+   +SW+DD+F W+  + +  CC+   D G FCP    +++C  C     +  RP+ K F  YL FFL +NP   C K GHAAYG AV   N    SH+ + I A+YFM YHTILK+ +DY  AL+++ +I+A++T+ L+  L        ++   EV PYSVFYVFYEQYLT++      +G+ +  + +VTFVL+G D  + L++   I +I+ ++ G MY W I +NA+S+VNLVMA+GISVEF +H+V ++   +S ++I+RA + L +MGSS+ SGITLTK  GI+VLAF+KSQ+FQ+FYFRMYLGIV+ GAAH +IFLPV LS+ G  ++  ++
Sbjct:   33 CVWYGVCNTNDFSHSQNCPYNGTAKEMA-TDGLELLKKRCGFLLENSEN-KFCCDKNQVELLNKNVELAGNILDRCPSCMENLVRHICQFTCSPKQAEFMHVVATQKNKKGDEYISSVDLHISTEYINKTYKSCSQVSVPQTGQLAFDLMCGAYSASRCNPTKWFNFMGDATNPYVPFQITYIQHEPKSNSNNFTPLNVTTVPCN-QAVSSKLPACSCSDCDLSCPQGPPEPPRPEPFKIVGLDAYF----VIMAAVFLVGVLVFLMGSFLFTQGSSMDDNFQVDGNDVSDEMPYSENDSYFEKLGAHTETFLETFFTKWGTYFASNPGLTLIAGASLVVILGYGINFIEITTDPVKLWASPNSKSRLEREFFDTKFSPFYRLEQIIIKAVN---LPQIVHNTSNGPYTFGPVFDREFLTKVLDLQEGIKEINA------NGTQLKDICYAPLSDDGSEIDVSQCVVQSIWGYFGDDRERLDD--HDEDNGFNVTYLDALYDCISNPY---------LCLAPYGGPVDPAIALGGFLPPGDQLTGSTKFELANAIILTFLVKN--HHNKTDLENALTWEKKFVEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVKEFKRVFIDSKITLGIGGVIIVLASVVSSVGVFGYIGLPATLIIVEVIPFLVLAVGVDNIFILVQTHQRDQR---KPNETLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAFALYAGVALIIDFLLQITCFVSLFTLDTKRREENRMDICCFIKGKK--------PDSITSNEGLLYKFFSSVYVPFLMKKIVRASVMVIFFAWLCFSIAIAPRIDIGLDQELAMPQDSFVLHYFQSLNENLNIGPPVYFVLKGDLAYTNSSDQNLVCAGQYCNDDSVLTQIYLASRHSNQTYIARPASSWIDDYFDWAAAASS--CCKYRKDSGDFCPHQ--DTSCLRCNITKNSLLRPEEKEFVKYLPFFLKDNPDDTCAKAGHAAYGGAVRYSN----SHERLNIEASYFMAYHTILKSSADYFLALESARKISANITQMLQGRLMSNGVPMASALTVEVFPYSVFYVFYEQYLTMWSDTLQSMGISVLSIFVVTFVLMGFDVHSALVVVITITMIVVNLGGLMYYWNISLNAVSLVNLVMAVGISVEFCSHLVHSFATSKSVSQIDRAADSLSKMGSSIFSGITLTKFAGILVLAFAKSQIFQVFYFRMYLGIVVIGAAHGLIFLPVLLSYIGAPVSNARL 1269          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Fly
Match: Npc1a (gene:FBgn0024320 transcript:FBtr0303905)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 498/1285 (38.75%), Postives = 761/1285 (59.22%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS-----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGT-THEKCDPVAFYKALGDATSN-APFQINYL--------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI---FIYLKKNKYDKDY---GNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD-----YEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGF---GDK----KNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD--LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL-------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI 3837
            C+WYG C+ ++ +   NC Y G  K +    G + L K C    +   N   CC+ +Q+  L+  +  A  I   CP+CM N +R  C  TC P Q  F+ V            I +V  +++  +    + SC  V +      A D +CG  +  +C+P  ++  +GDAT+   PFQI Y+        N    +N T +PCN         ACSC DC  SCP  PP     + F I+G+D +     ++  A F++ + +++   F++ + +  D ++   GN +    P  ++ S F+K GA  E +L  +F +WG + A    + L  G  + ++L  GI   ++TTDPV+LW+SP+S +R  +++FD  F PFYR EQIII   +      I ++ S    T+GPVF+ + L +V  L   I  +        N T+L+DIC+ PLS D       +C V S+  YF ++  +LD    DE N    TY+D + +CI +P          +C   +GGPV P +A GGF   GD+      +  + A+++TF+V N    N   ++ AL WEK F+  + N+++ N    + I++T+ERS++DE++R+S++D+ TI +SY+IMF Y+ I+LG     K++ +DSK+TLG+  V+IVL SV  SVG + Y+ +P TLII+EV+PFLVLAVGVDN+FILVQT+QR        N T EQ++ R++ KVGPSMLL+SLSES  FF G +++MPAV+ F+LYA  A++ DFLLQIT  +++  LD KR E  R+D+ C ++           P +     G+L++ F   Y P L K  VR  V++ F  W  F+++    I + L+Q+L+MP+DS++++YF +L   L++GPPVYF++K    Y + + QN++C    CN+ S+L Q+++AS++ N TYI+   +SW+DD+F W+  + +  CC+   D G FCP    +++C  C     +  RP+ K F  YL FFL +NP   C K GHAAYG AV   N    SH+ + I A+YFM YHTILK+ +DY  AL+++ +I+A++T+ L+  L        ++   EV PYSVFYVFYEQYLT++      +G+ +  + +VTFVL+G D  + L++   I +I+ ++ G MY W I +NA+S+VNLVMA+GISVEF +H+V ++   +S ++I+RA + L +MGSS+ SGITLTK  GI+VLAF+KSQ+FQ+FYFRMYLGIV+ GAAH +IFLPV LS+ G  ++  ++
Sbjct:   33 CVWYGVCNTNDFSHSQNCPYNGTAKEMA-TDGLELLKKRCGFLLENSEN-KFCCDKNQVELLNKNVELAGNILDRCPSCMENLVRHICQFTCSPKQAEFMHVVATQKNKKGDEYISSVDLHISTEYINKTYKSCSQVSVPQTGQLAFDLMCGAYSASRCNPTKWFNFMGDATNPYVPFQITYIQHEPKSNSNNFTPLNVTTVPCN-QAVSSKLPACSCSDCDLSCPQGPPEPPRPEPFKIVGLDAYF----VIMAAVFLVGVLVFLMGSFLFTQGSSMDDNFQVDGNDVSDEMPYSENDSYFEKLGAHTETFLETFFTKWGTYFASNPGLTLIAGASLVVILGYGINFIEITTDPVKLWASPNSKSRLEREFFDTKFSPFYRLEQIIIKAVN---LPQIVHNTSNGPYTFGPVFDREFLTKVLDLQEGIKEINA------NGTQLKDICYAPLSDDGSEIDVSQCVVQSIWGYFGDDRERLDD--HDEDNGFNVTYLDALYDCISNPY---------LCLAPYGGPVDPAIALGGFLPPGDQLTGSTKFELANAIILTFLVKN--HHNKTDLENALTWEKKFVEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVKEFKRVFIDSKITLGIGGVIIVLASVVSSVGVFGYIGLPATLIIVEVIPFLVLAVGVDNIFILVQTHQRDQR---KPNETLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAFALYAGVALIIDFLLQITCFVSLFTLDTKRREENRMDICCFIKGKK--------PDSITSNEGLLYKFFSSVYVPFLMKKIVRASVMVIFFAWLCFSIAIAPRIDIGLDQELAMPQDSFVLHYFQSLNENLNIGPPVYFVLKGDLAYTNSSDQNLVCAGQYCNDDSVLTQIYLASRHSNQTYIARPASSWIDDYFDWAAAASS--CCKYRKDSGDFCPHQ--DTSCLRCNITKNSLLRPEEKEFVKYLPFFLKDNPDDTCAKAGHAAYGGAVRYSN----SHERLNIEASYFMAYHTILKSSADYFLALESARKISANITQMLQGRLMSNGVPMASALTVEVFPYSVFYVFYEQYLTMWSDTLQSMGISVLSIFVVTFVLMGFDVHSALVVVITITMIVVNLGGLMYYWNISLNAVSLVNLVMAVGISVEFCSHLVHSFATSKSVSQIDRAADSLSKMGSSIFSGITLTKFAGILVLAFAKSQIFQVFYFRMYLGIVVIGAAHGLIFLPVLLSYIGAPVSNARL 1269          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Fly
Match: Npc1a (gene:FBgn0024320 transcript:FBtr0343610)

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 498/1282 (38.85%), Postives = 759/1282 (59.20%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS-----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGT-THEKCDPVAFYKALGDATSN-APFQINYL--------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI---FIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD-----YEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGF---GDK----KNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD--LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL-------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI 3837
            C+WYG C+ ++ +   NC Y G  K +    G + L K C    +   N   CC+ +Q+  L+  +  A  I   CP+CM N +R  C  TC P Q  F+ V            I +V  +++  +    + SC  V +      A D +CG  +  +C+P  ++  +GDAT+   PFQI Y+        N    +N T +PCN         ACSC DC  SCP  PP     + F I+G+D +     ++  A F++ + +++   F++ + + +  D GN +    P  ++ S F+K GA  E +L  +F +WG + A    + L  G  + ++L  GI   ++TTDPV+LW+SP+S +R  +++FD  F PFYR EQIII          I ++ S    T+GPVF+ + L +V  L   I  +        N T+L+DIC+ PLS D       +C V S+  YF ++  +LD    DE N    TY+D + +CI +P          +C   +GGPV P +A GGF   GD+      +  + A+++TF+V N    N   ++ AL WEK F+  + N+++ N    + I++T+ERS++DE++R+S++D+ TI +SY+IMF Y+ I+LG     K++ +DSK+TLG+  V+IVL SV  SVG + Y+ +P TLII+EV+PFLVLAVGVDN+FILVQT+QR        N T EQ++ R++ KVGPSMLL+SLSES  FF G +++MPAV+ F+LYA  A++ DFLLQIT  +++  LD KR E  R+D+ C ++           P +     G+L++ F   Y P L K  VR  V++ F  W  F+++    I + L+Q+L+MP+DS++++YF +L   L++GPPVYF++K    Y + + QN++C    CN+ S+L Q+++AS++ N TYI+   +SW+DD+F W+  + +  CC+   D G FCP    +++C  C     +  RP+ K F  YL FFL +NP   C K GHAAYG AV   N    SH+ + I A+YFM YHTILK+ +DY  AL+++ +I+A++T+ L+  L        ++   EV PYSVFYVFYEQYLT++      +G+ +  + +VTFVL+G D  + L++   I +I+ ++ G MY W I +NA+S+VNLVMA+GISVEF +H+V ++   +S ++I+RA + L +MGSS+ SGITLTK  GI+VLAF+KSQ+FQ+FYFRMYLGIV+ GAAH +IFLPV LS+ G  ++  ++
Sbjct:   33 CVWYGVCNTNDFSHSQNCPYNGTAKEMA-TDGLELLKKRCGFLLENSEN-KFCCDKNQVELLNKNVELAGNILDRCPSCMENLVRHICQFTCSPKQAEFMHVVATQKNKKGDEYISSVDLHISTEYINKTYKSCSQVSVPQTGQLAFDLMCGAYSASRCNPTKWFNFMGDATNPYVPFQITYIQHEPKSNSNNFTPLNVTTVPCN-QAVSSKLPACSCSDCDLSCPQGPPEPPRPEPFKIVGLDAYF----VIMAAVFLVGVLVFLMGSFLFTQDDNFQVD-GNDVSDEMPYSENDSYFEKLGAHTETFLETFFTKWGTYFASNPGLTLIAGASLVVILGYGINFIEITTDPVKLWASPNSKSRLEREFFDTKFSPFYRLEQIII---KAVNLPQIVHNTSNGPYTFGPVFDREFLTKVLDLQEGIKEINA------NGTQLKDICYAPLSDDGSEIDVSQCVVQSIWGYFGDDRERLDD--HDEDNGFNVTYLDALYDCISNPY---------LCLAPYGGPVDPAIALGGFLPPGDQLTGSTKFELANAIILTFLVKN--HHNKTDLENALTWEKKFVEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVKEFKRVFIDSKITLGIGGVIIVLASVVSSVGVFGYIGLPATLIIVEVIPFLVLAVGVDNIFILVQTHQRDQR---KPNETLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAFALYAGVALIIDFLLQITCFVSLFTLDTKRREENRMDICCFIKGKK--------PDSITSNEGLLYKFFSSVYVPFLMKKIVRASVMVIFFAWLCFSIAIAPRIDIGLDQELAMPQDSFVLHYFQSLNENLNIGPPVYFVLKGDLAYTNSSDQNLVCAGQYCNDDSVLTQIYLASRHSNQTYIARPASSWIDDYFDWAAAASS--CCKYRKDSGDFCPHQ--DTSCLRCNITKNSLLRPEEKEFVKYLPFFLKDNPDDTCAKAGHAAYGGAVRYSN----SHERLNIEASYFMAYHTILKSSADYFLALESARKISANITQMLQGRLMSNGVPMASALTVEVFPYSVFYVFYEQYLTMWSDTLQSMGISVLSIFVVTFVLMGFDVHSALVVVITITMIVVNLGGLMYYWNISLNAVSLVNLVMAVGISVEFCSHLVHSFATSKSVSQIDRAADSLSKMGSSIFSGITLTKFAGILVLAFAKSQIFQVFYFRMYLGIVVIGAAHGLIFLPVLLSYIGAPVSNARL 1265          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Zebrafish
Match: npc1 (Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB-GENE-030131-3161])

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 554/1272 (43.55%), Postives = 788/1272 (61.95%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN--PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVD----TGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQINYLNE---VKGM----NQTMLPCNMNGGEDDG-EACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYL-KKNKYDKDYGNGIVPATPEV----DDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVP--KDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPT-KFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIV 3840
                CIWYG+C  S   P K LNCNYTGP  PL N  G + L +LCP+    D    +CC+T QL TL   +         CP C  NF+ L+C LTC P Q  F++V          S+  VTY + + F   +FN+C +V   S+N  A+  +CG     C P  + + +   +    PF I  +     V+GM    N+T    N +   DDG E CSCQDC   C   P P      + ILG+D   FI+   + AF +I   + +  +  +++    +YG  +    P      D+ S  +  G + E  L L F RWG    R+ L ++   +++  + S G+   ++TT+PVELWS+PSS AR+ K+YFD++FGPF+RTEQ+II     +   F+ I  DI    + + P+ N+ LL +V  L   I N+    K  N    L+DIC  PLSP  + C ++SV+ YFQN+   LD    DEF L    Y   ++ C   PT++  T +  + C G FGGPVFP+L  GG+ D   Y ++TALVITF V N L+ +++++  AL WEK F+  ++N+   N +L +S+++ERS++DEIDR+S +D+ TI +SYIIMF Y+++ LG+ N+ + + VDSK++LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FI+VQTYQR DE    + L   Q+I R++  V PSM LSS SE++AFF G ++ MPAV+ FSL+A  A+  DFLLQI+  +++L LD KR EA R+D+LCCV++++           + K  G L   F K YAP + K  VR LVV  FVG   F+++ ++ + + L Q LSMP DSY++NYF  L+ YL  GPPVYF+V+DG++YK+   QN +CG  GCN  SL+ Q++ AS   N T IS   +SWLDD+F W K      CCR Y   G+FC ASVV+ +C +C P   + K RP+   F  +L  FL++NP+++C KGGHAAYG AV++K+ +       ++GATYFM+YHTILK  SD+  A+K + E+  ++T+ L T   +   ++V PYSVFYVFYEQYLT+     + LGV L  + +VT VLLG +  + +++ F I +I+ +MFG M+LW I +NA+S+VNLVM+ GISVEF +HIVRA+ +    +R+ERA E L  MGSSV SGITLTK GGI++LA SKSQ+FQIFYFRMYL IV+ GAAH +IFLPV LS+ GP++N+ K++
Sbjct:   24 HGQHCIWYGECGNSPNVPEKKLNCNYTGPAVPLPNE-GQELLQELCPRLVYADNR--VCCDTQQLNTLKSNIQIPLQYLSRCPACFFNFMTLFCELTCSPRQSQFISVKDFLKEKNQTSVGNVTYYITQTFADAMFNACRDVQAPSSNIKALGLLCGRDASVCTPQIWIQYMFSISNGQVPFGIEPIFTDVPVQGMTPMNNRTF---NCSQSLDDGSEPCSCQDCSEVCGPTPVPPPIPPPWIILGLDAMSFIMWCSYIAFLLIFFGVVLGAWCYRRSVVTSEYGPILDSNQPHSLNSDDEASCCETVGERFENSLRLVFSRWGSLCVRQPLTIILSSLVLICICSAGLSYMRITTNPVELWSAPSSRARQEKNYFDQHFGPFFRTEQLIITTPWTEEGGFSTITGDI----IPFSPILNLSLLHQVLDLQLEIENLIAEYKGEN--VTLKDICVSPLSPYNDNCTILSVLNYFQNSHEVLDHEFQDEFFL-YNDYHTHLLYCASSPTSLDDTSRLHDPCMGTFGGPVFPWLVLGGYEDSA-YNNATALVITFPVTNYLN-DTEKLGKALAWEKEFIRFMKNYE--NPNLTVSFSSERSIEDEIDRESNSDVSTIVISYIIMFVYISVALGRINSCRTLLVDSKISLGIAGILIVLSSVACSLGIFSYIGIPLTLIVIEVIPFLVLAVGVDNIFIIVQTYQR-DERMPEEEL--HQQIGRILGDVAPSMFLSSFSETVAFFLGALSTMPAVRTFSLFAGLAIFIDFLLQISCFVSLLGLDIKRQEANRMDILCCVKLSDG---------QEEKSEGWLFRFFKKIYAPFILKDWVRPLVVAVFVGMLSFSIAVVNKVEIGLEQTLSMPDDSYVLNYFGNLSKYLHTGPPVYFVVEDGHDYKTFEGQNAVCGGVGCNNDSLVQQIYTASLMSNYTRISNVPSSWLDDYFDWVKPQST--CCRYYNSTGAFCNASVVDKSCVHCRPMTSSGKQRPNGTEFMHFLPMFLSDNPNIKCGKGGHAAYGTAVDLKDNN------TDVGATYFMSYHTILKNSSDFINAMKMARELTDNITQTLST---HDKSYKVFPYSVFYVFYEQYLTIVDDTALNLGVSLSAIFIVTAVLLGFELWSAVLVCFTIAMILINMFGVMWLWSISLNAVSLVNLVMSCGISVEFCSHIVRAFSISTRSSRVERAEEALAHMGSSVFSGITLTKFGGILILALSKSQIFQIFYFRMYLAIVLLGAAHGLIFLPVLLSYAGPSVNKAKVL 1255          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Zebrafish
Match: npc1 (Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB-GENE-030131-3161])

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 554/1277 (43.38%), Postives = 789/1277 (61.79%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN--PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVD----TGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQINYLNE---VKGM----NQTMLPCNMNGGEDDG-EACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYL-KKNKYDKDYGNGIVPATPE---------VDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVP--KDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPT-KFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIV 3840
                CIWYG+C  S   P K LNCNYTGP  PL N  G + L +LCP+    D    +CC+T QL TL   +         CP C  NF+ L+C LTC P Q  F++V          S+  VTY + + F   +FN+C +V   S+N  A+  +CG     C P  + + +   +    PF I  +     V+GM    N+T    N +   DDG E CSCQDC   C   P P      + ILG+D   FI+   + AF +I   + +  +  +++    +YG  +    P          +D+ S  +  G + E  L L F RWG    R+ L ++   +++  + S G+   ++TT+PVELWS+PSS AR+ K+YFD++FGPF+RTEQ+II     +   F+ I  DI    + + P+ N+ LL +V  L   I N+    K  N    L+DIC  PLSP  + C ++SV+ YFQN+   LD    DEF L    Y   ++ C   PT++  T +  + C G FGGPVFP+L  GG+ D   Y ++TALVITF V N L+ +++++  AL WEK F+  ++N+   N +L +S+++ERS++DEIDR+S +D+ TI +SYIIMF Y+++ LG+ N+ + + VDSK++LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FI+VQTYQR DE    + L   Q+I R++  V PSM LSS SE++AFF G ++ MPAV+ FSL+A  A+  DFLLQI+  +++L LD KR EA R+D+LCCV++++           + K  G L   F K YAP + K  VR LVV  FVG   F+++ ++ + + L Q LSMP DSY++NYF  L+ YL  GPPVYF+V+DG++YK+   QN +CG  GCN  SL+ Q++ AS   N T IS   +SWLDD+F W K      CCR Y   G+FC ASVV+ +C +C P   + K RP+   F  +L  FL++NP+++C KGGHAAYG AV++K+ +       ++GATYFM+YHTILK  SD+  A+K + E+  ++T+ L T   +   ++V PYSVFYVFYEQYLT+     + LGV L  + +VT VLLG +  + +++ F I +I+ +MFG M+LW I +NA+S+VNLVM+ GISVEF +HIVRA+ +    +R+ERA E L  MGSSV SGITLTK GGI++LA SKSQ+FQIFYFRMYL IV+ GAAH +IFLPV LS+ GP++N+ K++
Sbjct:   24 HGQHCIWYGECGNSPNVPEKKLNCNYTGPAVPLPNE-GQELLQELCPRLVYADNR--VCCDTQQLNTLKSNIQIPLQYLSRCPACFFNFMTLFCELTCSPRQSQFISVKDFLKEKNQTSVGNVTYYITQTFADAMFNACRDVQAPSSNIKALGLLCGRDASVCTPQIWIQYMFSISNGQVPFGIEPIFTDVPVQGMTPMNNRTF---NCSQSLDDGSEPCSCQDCSEVCGPTPVPPPIPPPWIILGLDAMSFIMWCSYIAFLLIFFGVVLGAWCYRRSVVTSEYGPILDSNQPHSLNSDGTDLIDEASCCETVGERFENSLRLVFSRWGSLCVRQPLTIILSSLVLICICSAGLSYMRITTNPVELWSAPSSRARQEKNYFDQHFGPFFRTEQLIITTPWTEEGGFSTITGDI----IPFSPILNLSLLHQVLDLQLEIENLIAEYKGEN--VTLKDICVSPLSPYNDNCTILSVLNYFQNSHEVLDHEFQDEFFL-YNDYHTHLLYCASSPTSLDDTSRLHDPCMGTFGGPVFPWLVLGGYEDSA-YNNATALVITFPVTNYLN-DTEKLGKALAWEKEFIRFMKNYE--NPNLTVSFSSERSIEDEIDRESNSDVSTIVISYIIMFVYISVALGRINSCRTLLVDSKISLGIAGILIVLSSVACSLGIFSYIGIPLTLIVIEVIPFLVLAVGVDNIFIIVQTYQR-DERMPEEEL--HQQIGRILGDVAPSMFLSSFSETVAFFLGALSTMPAVRTFSLFAGLAIFIDFLLQISCFVSLLGLDIKRQEANRMDILCCVKLSDG---------QEEKSEGWLFRFFKKIYAPFILKDWVRPLVVAVFVGMLSFSIAVVNKVEIGLEQTLSMPDDSYVLNYFGNLSKYLHTGPPVYFVVEDGHDYKTFEGQNAVCGGVGCNNDSLVQQIYTASLMSNYTRISNVPSSWLDDYFDWVKPQST--CCRYYNSTGAFCNASVVDKSCVHCRPMTSSGKQRPNGTEFMHFLPMFLSDNPNIKCGKGGHAAYGTAVDLKDNN------TDVGATYFMSYHTILKNSSDFINAMKMARELTDNITQTLST---HDKSYKVFPYSVFYVFYEQYLTIVDDTALNLGVSLSAIFIVTAVLLGFELWSAVLVCFTIAMILINMFGVMWLWSISLNAVSLVNLVMSCGISVEFCSHIVRAFSISTRSSRVERAEEALAHMGSSVFSGITLTKFGGILILALSKSQIFQIFYFRMYLAIVLLGAAHGLIFLPVLLSYAGPSVNKAKVL 1260          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Zebrafish
Match: npc1 (Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB-GENE-030131-3161])

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 552/1274 (43.33%), Postives = 785/1274 (61.62%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN--PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVD----TGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQINYLNE---VKGM----NQTMLPCNMNGGEDDG-EACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYL-KKNKYDKDYGNGIVPATPE---------VDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVP--KDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPT-KFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRK 3831
                CIWYG+C  S   P K LNCNYTGP  PL N  G + L +LCP+    D    +CC+T QL TL   +         CP C  NF+ L+C LTC P Q  F++V          S+  VTY + + F   +FN+C +V   S+N  A+  +CG     C P  + + +   +    PF I  +     V+GM    N+T    N +   DDG E CSCQDC   C   P P      + ILG+D   FI+   + AF +I   + +  +  +++    +YG  +    P          +D+ S  +  G + E  L L F RWG    R+ L ++   +++  + S G+   ++TT+PVELWS+PSS AR+ K+YFD++FGPF+RTEQ+II     +   F+ I  DI    + + P+ N+ LL +V  L   I N+    K  N    L+DIC  PLSP  + C ++SV+ YFQN+   LD    DEF L    Y   ++ C   PT++  T +  + C G FGGPVFP+L  GG+ D   Y ++TALVITF V N L+ +++++  AL WEK F+  ++N+   N +L +S+++ERS++DEIDR+S +D+ TI +SYIIMF Y+++ LG+ N+ + + VDSK++LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FI+VQTYQR DE    + L   Q+I R++  V PSM LSS SE++AFF G ++ MPAV+ FSL+A  A+  DFLLQI+  +++L LD KR EA R+D+LCCV++++           + K  G L   F K YAP + K  VR LVV  FVG   F+++ ++ + + L Q LSMP DSY++NYF  L+ YL  GPPVYF+V+DG++YK+   QN +CG  GCN  SL+ Q++ AS   N T IS   +SWLDD+F W K      CCR Y   G+FC ASVV+ +C +C P   + K RP+   F  +L  FL++NP+++C KGGHAAYG AV++K+ +       ++GATYFM+YHTILK  SD+  A+K + E+  ++T+ L T   +   ++V PYSVFYVFYEQYLT+     + LGV L  + +VT VLLG +  + +++ F I +I+ +MFG M+LW I +NA+S+VNLVM+ GISVEF +HIVRA+ +    +R+ERA E L  MGSSV SGITLTK GGI++LA SKSQ+FQIFYFRMYL IV+ GAAH +IFLPV LS+ G +L+ +
Sbjct:   24 HGQHCIWYGECGNSPNVPEKKLNCNYTGPAVPLPNE-GQELLQELCPRLVYADNR--VCCDTQQLNTLKSNIQIPLQYLSRCPACFFNFMTLFCELTCSPRQSQFISVKDFLKEKNQTSVGNVTYYITQTFADAMFNACRDVQAPSSNIKALGLLCGRDASVCTPQIWIQYMFSISNGQVPFGIEPIFTDVPVQGMTPMNNRTF---NCSQSLDDGSEPCSCQDCSEVCGPTPVPPPIPPPWIILGLDAMSFIMWCSYIAFLLIFFGVVLGAWCYRRSVVTSEYGPILDSNQPHSLNSDGTDLIDEASCCETVGERFENSLRLVFSRWGSLCVRQPLTIILSSLVLICICSAGLSYMRITTNPVELWSAPSSRARQEKNYFDQHFGPFFRTEQLIITTPWTEEGGFSTITGDI----IPFSPILNLSLLHQVLDLQLEIENLIAEYKGEN--VTLKDICVSPLSPYNDNCTILSVLNYFQNSHEVLDHEFQDEFFL-YNDYHTHLLYCASSPTSLDDTSRLHDPCMGTFGGPVFPWLVLGGYEDSA-YNNATALVITFPVTNYLN-DTEKLGKALAWEKEFIRFMKNYE--NPNLTVSFSSERSIEDEIDRESNSDVSTIVISYIIMFVYISVALGRINSCRTLLVDSKISLGIAGILIVLSSVACSLGIFSYIGIPLTLIVIEVIPFLVLAVGVDNIFIIVQTYQR-DERMPEEEL--HQQIGRILGDVAPSMFLSSFSETVAFFLGALSTMPAVRTFSLFAGLAIFIDFLLQISCFVSLLGLDIKRQEANRMDILCCVKLSDG---------QEEKSEGWLFRFFKKIYAPFILKDWVRPLVVAVFVGMLSFSIAVVNKVEIGLEQTLSMPDDSYVLNYFGNLSKYLHTGPPVYFVVEDGHDYKTFEGQNAVCGGVGCNNDSLVQQIYTASLMSNYTRISNVPSSWLDDYFDWVKPQST--CCRYYNSTGAFCNASVVDKSCVHCRPMTSSGKQRPNGTEFMHFLPMFLSDNPNIKCGKGGHAAYGTAVDLKDNN------TDVGATYFMSYHTILKNSSDFINAMKMARELTDNITQTLST---HDKSYKVFPYSVFYVFYEQYLTIVDDTALNLGVSLSAIFIVTAVLLGFELWSAVLVCFTIAMILINMFGVMWLWSISLNAVSLVNLVMSCGISVEFCSHIVRAFSISTRSSRVERAEEALAHMGSSVFSGITLTKFGGILILALSKSQIFQIFYFRMYLAIVLLGAAHGLIFLPVLLSYAGKSLSPR 1257          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Zebrafish
Match: NPC1L1 (NPC1-like 1 [Source:NCBI gene;Acc:100616532])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 372/1020 (36.47%), Postives = 546/1020 (53.53%), Query Frame = 1
Query:  196 NATG--FQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--------VTVDTG-YGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINY-------LNEVKGMNQTMLPCNMNGGE---DDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMI----VISIYIFIYLK-----KNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSP---DYEKCAVMSVMQYFQNNITQLDRIV--TDEFNLPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSE-TNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPAS---VVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNK 3117
            N TG  ++ L  +CP  A  D     CC+  QL  L   LS +  +   CP+C  NF  L+CA TC P+Q           +T  TG    ++      ++ NF    F+SC NV + S   +AI T+CG      C P  +Y   GD+++  AP  I++        +EV           +   E     GEACSCQDC  SCP  P P    K F I  ++G + I   VF  F  +    VI+     Y+K     K K  KD     +       D+S  DK     + +L   F  WG  +AR   IVL V ++I +V ++GI   ++TTDPV+LWS+P S A R K + D +F PFYRT Q+I+    R    + +     +N  +  + + DL+  +  L   I  +E +S  LN+   L+D+C+ PL+P       CAV S+ QYFQN+I  L+  V  T+        + D  + C+  P + K  T     C  D+GGPVFP+LA GG+ D + YT + AL++TF +NN    + K  K   +WE  FL +VQ + + + T+   +Y AERS++DEI+R +  D+    +SY ++F Y+ + LG+Y++ K+I VDSK  +GL  +L+V  SV  S+GF++++ V  +L+IL+VVPFLVLAVG DN+FI V  YQR       +    E++I RV+  V PSMLL SLSES+ FF G ++ MPAVK F+LYAA AVL DF+LQ+T  +A+L LDA+R ++ R ++ CCV ++         P  +    GIL  +  K+YAP L  +  R +V++ F+     ++  +  + V LNQ+L+MP DSYM++YF  L  Y  VG P YFI   G+N+ SE   N +C + GC++ S+  ++  A++ P  +Y++   +SW+DD+  W        CCRLY  G     FCPA+   V    C   P N     RPD   F+ +L  FL+N P +QCPKGG  AY +AV   N+
Sbjct:   64 NVTGDHYELLKSVCPMLANGDGQTLACCSIRQLTALQNSLSLSKAVLIRCPSCAENFAYLHCATTCSPDQSQILKITKTANITQPTGIVKEAVVGYAAYISTNFSDASFDSCKNVRIPSTGGFAIATMCGRYGAALCTPQRWYDFQGDSSNGLAPLDIDFKLLQDSETSEVPAGAFAFAGQALKCNEVTPSGGEACSCQDCLQSCPVVPEPPPLPKPFMIGNLNGVLVICLTVFSCFLFLFLCYVITECTTYYMKSRKGRKGKSTKDQNANEIKFKISPKDVSCSDKASLATQEFLGSLFQSWGTLMARYPYIVLPVCLVIVLVFAVGIKDIELTTDPVQLWSAPESRAMREKAFHDAHFDPFYRTNQLILTAPGRPSHFYDSLLFGKQN--FSGIISKDLIIELLKLQQSIQAIEFWSDELNSTASLKDVCYAPLNPGNPSLTDCAVNSLPQYFQNSIDNLNAKVNMTELGVTKEVDWRDHFIYCVNSPLSFKDITALGMSCMSDYGGPVFPFLAVGGY-DNEQYTTAEALILTFSLNNYARTDVK-FKVVEEWENRFLKIVQEYQKNSTTNFTFAYMAERSLEDEINRTTAEDIPIFMISYAVIFLYIAVALGEYSSCKRILVDSKFLVGLGGILVVGCSVIASMGFYAWIGVASSLVILQVVPFLVLAVGADNIFIFVLEYQRDLRRPGEQR---EEQIGRVLGNVAPSMLLCSLSESVCFFLGALSTMPAVKSFALYAALAVLMDFVLQMTAFVALLSLDARRQDSNRCEIACCVTVD--------TPRPQKPNEGILLPLMRKYYAPFLLNSFSRVVVMVLFLVMFFSSVFLMFHVKVGLNQELAMPTDSYMLDYFAYLFKYFEVGVPTYFITTKGFNFNSEEGINAVCSSVGCDQFSMTQKIRYATEYPERSYLAIPASSWVDDYIDWLNPGSR--CCRLYTFGPNKDEFCPANETGVCLKKCMGKPEN--GVLRPDVSEFNRFLPDFLSNRPDLQCPKGGLGAYDKAVIRDNE 1064          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Zebrafish
Match: ptch1 (patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196])

HSP 1 Score: 112.849 bits (281), Expect = 1.940e-24
Identity = 68/237 (28.69%), Postives = 122/237 (51.48%), Query Frame = 1
Query: 1705 LDQNSKQIKAALD-WEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCC 2412
            ++ N  +  A L+ W++ +   VQ     N+   +      +++D +   S+  +  IA  Y++M  Y  +T+ +++  K     S+  +GL  VL+V +SV   +G  S L +       +V+PFL L VGVD++F+L   +    E   +K +  E +    + + G S+ L+S+S   AFF   +  +PA++ FSL AA  V+F+F + + +  A+L +D  R E  R D+ CC
Sbjct:  374 INWNEDKAAAILEAWQRKYSEAVQQSVPVNSSQKVLTFTTTTLEDILKSFSDVSVIRIASGYLLMLAYACLTMLRWDCAK-----SQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAF---SETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCC 602          

HSP 2 Score: 59.6918 bits (143), Expect = 2.621e-8
Identity = 54/169 (31.95%), Postives = 92/169 (54.44%), Query Frame = 1
Query: 3310 YVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGP 3816
            ++F+EQY+ +   L + + V L    LV  V L   W A +I+   + L+   +FG M L GI ++A+ +V L+ ++GI VEF  H+  A++    D R +RA   L  M + VL G   + L G+++LA S+      ++F +   + + G  + ++ LPV LS+ GP
Sbjct: 1029 FLFWEQYVGLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIV-LVLSLMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD-RNKRAVLALEHMFAPVLDG-AFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGP 1194          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Xenopus
Match: fosl1 (FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-6257957])

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 515/1275 (40.39%), Postives = 770/1275 (60.39%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN-PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGYGG--------SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI--FIYLKKN------KYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTK-FKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPA-NFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI 3837
             +  C+WYG+C  S   +K LNC Y+GPP  L    G   L +LCP       N ++CC+  QL TL+  L         CP+C  NF+ ++C LTC P Q  F  VT    + G        SI A+ Y + E F   ++N+C +V   S+N  A+  +CG   + C+   + + +        PF I      + +  +  MN     C+    E+ G +CSCQDC  SC   P P      + I G+D    I+ IV+  F ++  ++ I  + Y KKN        D       V +TP   + S  D+ G ++E +L + F +WG F  R+  IV+   +++ ++   G+   ++TTDPVELWS P S AR+ K+YFD +FGPF+RTEQ+II   + +   +  Y  S  ++ +GP  + ++L +V  L N I N++ +    N    L+DIC  PL+P    C + SV+ YFQN+ + L+  + D+F +  A Y    + C++ P ++  T    + C G FGGP+FP+L  GG+ D +NY ++TALVITF VNN    +++++  A  WE  F+  V+N+S  N +L IS++AERS++DEI+R+S++D+ T+ +SY +MF Y+++ LGQ  +   I VDSK++LG+  +LIVL SV CS+G +SY  V +TLI++EV+PFLVLAVGVDN++I+VQ YQR +  +     T +Q+I R++  V PS+ LS+ +E++AFF G ++ MPAV+ FSL+A  AV  DFLLQIT  I++L LD +R E  R+D+LCCV         D       K    L   F K YAP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +L+TYL  GPPVYF+V++G+NY ++  Q+ +CG +GCN  SL+ +++ A+   N T I  + +SW+DD+F W K      CCR+Y +   FC ASVVN++C +C +     K +P  + F  +L  FL++NP+ +C KGGHAAYG AV++ + +        +GATYFMTYHTILK  +D+ +A++ +  IA ++T+ +        +++V PYS+FYVFYEQYLT+       L V L  V  VT +LLG +  + +++   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +H+ RA+ V     R++RA + L  MGSSV SGITLTK  GI VL  SKSQ+F+IFYFRMYL +V+ GAAH +IFLPV LS+ GP +N+ K+
Sbjct:   25 SSQHCVWYGECGNSTLEDKRLNCRYSGPPISLPEE-GHTLLQQLCPSLYY--GNNTVCCDVQQLNTLNSNLQLPLQFLSRCPSCFYNFMTMFCELTCSPYQSEFLNVTQTEPFVGPSPQRANESIVAMEYYIGEQFANAMYNACKDVEAPSSNVKALALLCGKDVKDCNATNWIQYMFSKDNGQVPFTITPIFSDDPVTSMLPMNNATKGCD-EPVEEGGASCSCQDCALSCGPVPQPPPLPPPWLIFGLDAMAVIMWIVYVVFLLLFSAVIIGSWCYRKKNIVSEYAPIDSTLAYS-VNSTPIAGEPSCCDRLGERLENFLRIGFTKWGSFCVRKPWIVIFFSVLLIVICCFGLKYMRITTDPVELWSDPHSQARQEKEYFDSHFGPFFRTEQLIITAPNSSVHNYSPYP-SGSDVPFGPPLDFNILAQVLELQNGIENLKAYYN--NETVMLKDICLAPLAPYNNNCTIFSVLNYFQNSFSVLNHSIQDDFYV-YADYHTHFLYCVRSPASLNDTSVLHDPCLGTFGGPIFPWLVLGGY-DDENYNNATALVITFPVNN-FRNDTEKLNRAKAWELEFIKFVENYS--NPNLSISFSAERSIEDEINRESKSDVTTVVISYALMFVYISLALGQIGHCSSILVDSKISLGIAGILIVLSSVACSLGIFSYAGVSLTLIVIEVIPFLVLAVGVDNIYIIVQRYQRDERLHDE---TLDQQIGRILGDVAPSIFLSAFAETVAFFLGALSSMPAVRTFSLFAGMAVFLDFLLQITCFISLLSLDIRRQEKNRLDILCCVPGCKRNRGTD-------KPKSWLFLFFKKLYAPVLMKDWIRPIVVSVFVGILSFSIAVVNKVEIGLDQSLSMPDDSYMLDYFGSLSTYLHTGPPVYFVVEEGHNYTTKEGQDKVCGGAGCNNNSLVQEIYTAAGISNYTRIGYAPSSWIDDYFDWVKPQST--CCRIYNNTDQFCNASVVNASCLSCRSYTPEGKRKPVGEDFMHFLPMFLSDNPNPKCGKGGHAAYGSAVDLLDSN------TNVGATYFMTYHTILKNSTDFIDAMRKARTIAQNITDNMDIP---GKKYKVFPYSIFYVFYEQYLTIVDDTIFNLCVSLAAVFFVTVILLGFELWSAVLMCITISMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHVTRAFSVSTRGNRVQRAEDALAHMGSSVFSGITLTKFVGIGVLGLSKSQIFKIFYFRMYLAMVLLGAAHGLIFLPVLLSYLGPQVNKAKV 1265          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Xenopus
Match: fosl1 (FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-6257957])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 514/1271 (40.44%), Postives = 766/1271 (60.27%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN-PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGYGG--------SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI--FIYLKKN------KYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTK-FKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPA-NFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALN 3825
             +  C+WYG+C  S   +K LNC Y+GPP  L    G   L +LCP       N ++CC+  QL TL+  L         CP+C  NF+ ++C LTC P Q  F  VT    + G        SI A+ Y + E F   ++N+C +V   S+N  A+  +CG   + C+   + + +        PF I      + +  +  MN     C+    E+ G +CSCQDC  SC   P P      + I G+D    I+ IV+  F ++  ++ I  + Y KKN        D       V +TP   + S  D+ G ++E +L + F +WG F  R+  IV+   +++ ++   G+   ++TTDPVELWS P S AR+ K+YFD +FGPF+RTEQ+II   + +   +  Y  S  ++ +GP  + ++L +V  L N I N++ +    N    L+DIC  PL+P    C + SV+ YFQN+ + L+  + D+F +  A Y    + C++ P ++  T    + C G FGGP+FP+L  GG+ D +NY ++TALVITF VNN    +++++  A  WE  F+  V+N+S  N +L IS++AERS++DEI+R+S++D+ T+ +SY +MF Y+++ LGQ  +   I VDSK++LG+  +LIVL SV CS+G +SY  V +TLI++EV+PFLVLAVGVDN++I+VQ YQR +  +     T +Q+I R++  V PS+ LS+ +E++AFF G ++ MPAV+ FSL+A  AV  DFLLQIT  I++L LD +R E  R+D+LCCV       P         K    L   F K YAP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +L+TYL  GPPVYF+V++G+NY ++  Q+ +CG +GCN  SL+ +++ A+   N T I  + +SW+DD+F W K      CCR+Y +   FC ASVVN++C +C +     K +P  + F  +L  FL++NP+ +C KGGHAAYG AV++ + +        +GATYFMTYHTILK  +D+ +A++ +  IA ++T+ +        +++V PYS+FYVFYEQYLT+       L V L  V  VT +LLG +  + +++   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +H+ RA+ V     R++RA + L  MGSSV SGITLTK  GI VL  SKSQ+F+IFYFRMYL +V+ GAAH +IFLPV LS+ G  LN
Sbjct:   28 SSQHCVWYGECGNSTLEDKRLNCRYSGPPISLPEE-GHTLLQQLCPSLYY--GNNTVCCDVQQLNTLNSNLQLPLQFLSRCPSCFYNFMTMFCELTCSPYQSEFLNVTQTEPFVGPSPQRANESIVAMEYYIGEQFANAMYNACKDVEAPSSNVKALALLCGKDVKDCNATNWIQYMFSKDNGQVPFTITPIFSDDPVTSMLPMNNATKGCD-EPVEEGGASCSCQDCALSCGPVPQPPPLPPPWLIFGLDAMAVIMWIVYVVFLLLFSAVIIGSWCYRKKNIVSEYAPIDSTLAYS-VNSTPIAGEPSCCDRLGERLENFLRIGFTKWGSFCVRKPWIVIFFSVLLIVICCFGLKYMRITTDPVELWSDPHSQARQEKEYFDSHFGPFFRTEQLIITAPNSSVHNYSPYP-SGSDVPFGPPLDFNILAQVLELQNGIENLKAYYN--NETVMLKDICLAPLAPYNNNCTIFSVLNYFQNSFSVLNHSIQDDFYV-YADYHTHFLYCVRSPASLNDTSVLHDPCLGTFGGPIFPWLVLGGY-DDENYNNATALVITFPVNN-FRNDTEKLNRAKAWELEFIKFVENYS--NPNLSISFSAERSIEDEINRESKSDVTTVVISYALMFVYISLALGQIGHCSSILVDSKISLGIAGILIVLSSVACSLGIFSYAGVSLTLIVIEVIPFLVLAVGVDNIYIIVQRYQRDERLHDE---TLDQQIGRILGDVAPSIFLSAFAETVAFFLGALSSMPAVRTFSLFAGMAVFLDFLLQITCFISLLSLDIRRQEKNRLDILCCV-------PGCKRNRGTDKPKSWLFLFFKKLYAPVLMKDWIRPIVVSVFVGILSFSIAVVNKVEIGLDQSLSMPDDSYMLDYFGSLSTYLHTGPPVYFVVEEGHNYTTKEGQDKVCGGAGCNNNSLVQEIYTAAGISNYTRIGYAPSSWIDDYFDWVKPQST--CCRIYNNTDQFCNASVVNASCLSCRSYTPEGKRKPVGEDFMHFLPMFLSDNPNPKCGKGGHAAYGSAVDLLDSN------TNVGATYFMTYHTILKNSTDFIDAMRKARTIAQNITDNMDIP---GKKYKVFPYSIFYVFYEQYLTIVDDTIFNLCVSLAAVFFVTVILLGFELWSAVLMCITISMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHVTRAFSVSTRGNRVQRAEDALAHMGSSVFSGITLTKFVGIGVLGLSKSQIFKIFYFRMYLAMVLLGAAHGLIFLPVLLSYLGENLN 1264          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Xenopus
Match: fosl1 (FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-6257957])

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 513/1280 (40.08%), Postives = 768/1280 (60.00%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN-PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGYGG--------SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI--FIYLKKN------KYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTK-FKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPA-NFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK 3852
             +  C+WYG+C  S   +K LNC Y+GPP  L    G   L +LCP       N ++CC+  QL TL+  L         CP+C  NF+ ++C LTC P Q  F  VT    + G        SI A+ Y + E F   ++N+C +V   S+N  A+  +CG   + C+   + + +        PF I      + +  +  MN     C+    E+ G +CSCQDC  SC   P P      + I G+D    I+ IV+  F ++  ++ I  + Y KKN        D       V +TP   + S  D+ G ++E +L + F +WG F  R+  IV+   +++ ++   G+   ++TTDPVELWS P S AR+ K+YFD +FGPF+RTEQ+II   + +   +  Y  S  ++ +GP  + ++L +V  L N I N++ +    N    L+DIC  PL+P    C + SV+ YFQN+ + L+  + D+F +  A Y    + C++ P ++  T    + C G FGGP+FP+L  GG+ D +NY ++TALVITF VNN    +++++  A  WE  F+  V+N+S  N +L IS++AERS++DEI+R+S++D+ T+ +SY +MF Y+++ LGQ  +   I VDSK++LG+  +LIVL SV CS+G +SY  V +TLI++EV+PFLVLAVGVDN++I+VQ YQR +  +     T +Q+I R++  V PS+ LS+ +E++AFF G ++ MPAV+ FSL+A  AV  DFLLQIT  I++L LD +R E  R+D+LCCV         D       K    L   F K YAP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +L+TYL  GPPVYF+V++G+NY ++  Q+ +CG +GCN  SL+ +++ A+   N T I  + +SW+DD+F W K      CCR+Y +   FC ASVVN++C +C +     K +P  + F  +L  FL++NP+ +C KGGHAAYG AV++ + +        +GATYFMTYHTILK  +D+ +A++ +  IA ++T+ +        +++V PYS+FYVFYEQYLT+       L V L  V  VT +LLG +  + +++   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +H+ RA+ V     R++RA + L  MGSSV SGITLTK  GI VL  SKSQ+F+IFYFRMYL +V+ GAAH +IFLPV LS+ G  L     +  ++
Sbjct:   19 SSQHCVWYGECGNSTLEDKRLNCRYSGPPISLPEE-GHTLLQQLCPSLYY--GNNTVCCDVQQLNTLNSNLQLPLQFLSRCPSCFYNFMTMFCELTCSPYQSEFLNVTQTEPFVGPSPQRANESIVAMEYYIGEQFANAMYNACKDVEAPSSNVKALALLCGKDVKDCNATNWIQYMFSKDNGQVPFTITPIFSDDPVTSMLPMNNATKGCD-EPVEEGGASCSCQDCALSCGPVPQPPPLPPPWLIFGLDAMAVIMWIVYVVFLLLFSAVIIGSWCYRKKNIVSEYAPIDSTLAYS-VNSTPIAGEPSCCDRLGERLENFLRIGFTKWGSFCVRKPWIVIFFSVLLIVICCFGLKYMRITTDPVELWSDPHSQARQEKEYFDSHFGPFFRTEQLIITAPNSSVHNYSPYP-SGSDVPFGPPLDFNILAQVLELQNGIENLKAYYN--NETVMLKDICLAPLAPYNNNCTIFSVLNYFQNSFSVLNHSIQDDFYV-YADYHTHFLYCVRSPASLNDTSVLHDPCLGTFGGPIFPWLVLGGY-DDENYNNATALVITFPVNN-FRNDTEKLNRAKAWELEFIKFVENYS--NPNLSISFSAERSIEDEINRESKSDVTTVVISYALMFVYISLALGQIGHCSSILVDSKISLGIAGILIVLSSVACSLGIFSYAGVSLTLIVIEVIPFLVLAVGVDNIYIIVQRYQRDERLHDE---TLDQQIGRILGDVAPSIFLSAFAETVAFFLGALSSMPAVRTFSLFAGMAVFLDFLLQITCFISLLSLDIRRQEKNRLDILCCVPGCKRNRGTD-------KPKSWLFLFFKKLYAPVLMKDWIRPIVVSVFVGILSFSIAVVNKVEIGLDQSLSMPDDSYMLDYFGSLSTYLHTGPPVYFVVEEGHNYTTKEGQDKVCGGAGCNNNSLVQEIYTAAGISNYTRIGYAPSSWIDDYFDWVKPQST--CCRIYNNTDQFCNASVVNASCLSCRSYTPEGKRKPVGEDFMHFLPMFLSDNPNPKCGKGGHAAYGSAVDLLDSN------TNVGATYFMTYHTILKNSTDFIDAMRKARTIAQNITDNMDIP---GKKYKVFPYSIFYVFYEQYLTIVDDTIFNLCVSLAAVFFVTVILLGFELWSAVLMCITISMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHVTRAFSVSTRGNRVQRAEDALAHMGSSVFSGITLTKFVGIGVLGLSKSQIFKIFYFRMYLAMVLLGAAHGLIFLPVLLSYLGEFLGTAAFIGDER 1264          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Xenopus
Match: fosl1 (FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-6257957])

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 512/1274 (40.19%), Postives = 766/1274 (60.13%), Query Frame = 1
Query:  100 KNDKCIWYGQCDKSN-PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGYGG--------SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI--FIYLKKN------KYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTK-FKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVT---YISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPA-NFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALN 3825
             +  C+WYG+C  S   +K LNC Y+GPP  L    G   L +LCP       N ++CC+  QL TL+  L         CP+C  NF+ ++C LTC P Q  F  VT    + G        SI A+ Y + E F   ++N+C +V   S+N  A+  +CG   + C+   + + +        PF I      + +  +  MN     C+    E+ G +CSCQDC  SC   P P      + I G+D    I+ IV+  F ++  ++ I  + Y KKN        D       V +TP   + S  D+ G ++E +L + F +WG F  R+  IV+   +++ ++   G+   ++TTDPVELWS P S AR+ K+YFD +FGPF+RTEQ+II   + +   +  Y  S  ++ +GP  + ++L +V  L N I N++ +    N    L+DIC  PL+P    C + SV+ YFQN+ + L+  + D+F +  A Y    + C++ P ++  T    + C G FGGP+FP+L  GG+ D +NY ++TALVITF VNN    +++++  A  WE  F+  V+N+S  N +L IS++AERS++DEI+R+S++D+ T+ +SY +MF Y+++ LGQ  +   I VDSK++LG+  +LIVL SV CS+G +SY  V +TLI++EV+PFLVLAVGVDN++I+VQ YQR +  +     T +Q+I R++  V PS+ LS+ +E++AFF G ++ MPAV+ FSL+A  AV  DFLLQIT  I++L LD +R E  R+D+LCCV         D       K    L   F K YAP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +L+TYL  GPPVYF+V++G+NY ++  Q+ +CG +GCN  SL+ +++ A+    ++    I  + +SW+DD+F W K      CCR+Y +   FC ASVVN++C +C +     K +P  + F  +L  FL++NP+ +C KGGHAAYG AV++ + +        +GATYFMTYHTILK  +D+ +A++ +  IA ++T+ +        +++V PYS+FYVFYEQYLT+       L V L  V  VT +LLG +  + +++   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +H+ RA+ V     R++RA + L  MGSSV SGITLTK  GI VL  SKSQ+F+IFYFRMYL +V+ GAAH +IFLPV LS+ G  LN
Sbjct:   19 SSQHCVWYGECGNSTLEDKRLNCRYSGPPISLPEE-GHTLLQQLCPSLYY--GNNTVCCDVQQLNTLNSNLQLPLQFLSRCPSCFYNFMTMFCELTCSPYQSEFLNVTQTEPFVGPSPQRANESIVAMEYYIGEQFANAMYNACKDVEAPSSNVKALALLCGKDVKDCNATNWIQYMFSKDNGQVPFTITPIFSDDPVTSMLPMNNATKGCD-EPVEEGGASCSCQDCALSCGPVPQPPPLPPPWLIFGLDAMAVIMWIVYVVFLLLFSAVIIGSWCYRKKNIVSEYAPIDSTLAYS-VNSTPIAGEPSCCDRLGERLENFLRIGFTKWGSFCVRKPWIVIFFSVLLIVICCFGLKYMRITTDPVELWSDPHSQARQEKEYFDSHFGPFFRTEQLIITAPNSSVHNYSPYP-SGSDVPFGPPLDFNILAQVLELQNGIENLKAYYN--NETVMLKDICLAPLAPYNNNCTIFSVLNYFQNSFSVLNHSIQDDFYV-YADYHTHFLYCVRSPASLNDTSVLHDPCLGTFGGPIFPWLVLGGY-DDENYNNATALVITFPVNN-FRNDTEKLNRAKAWELEFIKFVENYS--NPNLSISFSAERSIEDEINRESKSDVTTVVISYALMFVYISLALGQIGHCSSILVDSKISLGIAGILIVLSSVACSLGIFSYAGVSLTLIVIEVIPFLVLAVGVDNIYIIVQRYQRDERLHDE---TLDQQIGRILGDVAPSIFLSAFAETVAFFLGALSSMPAVRTFSLFAGMAVFLDFLLQITCFISLLSLDIRRQEKNRLDILCCVPGCKRNRGTD-------KPKSWLFLFFKKLYAPVLMKDWIRPIVVSVFVGILSFSIAVVNKVEIGLDQSLSMPDDSYMLDYFGSLSTYLHTGPPVYFVVEEGHNYTTKEGQDKVCGGAGCNNNSLVQEIYTAAGISTMSDRFAIGYAPSSWIDDYFDWVKPQST--CCRIYNNTDQFCNASVVNASCLSCRSYTPEGKRKPVGEDFMHFLPMFLSDNPNPKCGKGGHAAYGSAVDLLDSN------TNVGATYFMTYHTILKNSTDFIDAMRKARTIAQNITDNMDIP---GKKYKVFPYSIFYVFYEQYLTIVDDTIFNLCVSLAAVFFVTVILLGFELWSAVLMCITISMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHVTRAFSVSTRGNRVQRAEDALAHMGSSVFSGITLTKFVGIGVLGLSKSQIFKIFYFRMYLAMVLLGAAHGLIFLPVLLSYLGENLN 1258          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Xenopus
Match: fosl1 (FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-6257957])

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 510/1272 (40.09%), Postives = 765/1272 (60.14%), Query Frame = 1
Query:   94 HCKNDKCIWYGQCDKSN-PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGYGG--------SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYI--FIYLKKN------KYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTK-FKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVT---YISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPA-NFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCG 3813
            +  +  C+WYG+C  S   +K LNC Y+GPP  L    G   L +LCP       N ++CC+  QL TL+  L         CP+C  NF+ ++C LTC P Q  F  VT    + G        SI A+ Y + E F   ++N+C +V   S+N  A+  +CG   + C+   + + +        PF I      + +  +  MN     C+    E+ G +CSCQDC  SC   P P      + I G+D    I+ IV+  F ++  ++ I  + Y KKN        D       V +TP   + S  D+ G ++E +L + F +WG F  R+  IV+   +++ ++   G+   ++TTDPVELWS P S AR+ K+YFD +FGPF+RTEQ+II   + +   +  Y  S  ++ +GP  + ++L +V  L N I N++ +    N    L+DIC  PL+P    C + SV+ YFQN+ + L+  + D+F +  A Y    + C++ P ++  T    + C G FGGP+FP+L  GG+ D +NY ++TALVITF VNN    +++++  A  WE  F+  V+N+S  N +L IS++AERS++DEI+R+S++D+ T+ +SY +MF Y+++ LGQ  +   I VDSK++LG+  +LIVL SV CS+G +SY  V +TLI++EV+PFLVLAVGVDN++I+VQ YQR +  +     T +Q+I R++  V PS+ LS+ +E++AFF G ++ MPAV+ FSL+A  AV  DFLLQIT  I++L LD +R E  R+D+LCCV         D       K    L   F K YAP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +L+TYL  GPPVYF+V++G+NY ++  Q+ +CG +GCN  SL+ +++ A+    ++    I  + +SW+DD+F W K      CCR+Y +   FC ASVVN++C +C +     K +P  + F  +L  FL++NP+ +C KGGHAAYG AV++ + +        +GATYFMTYHTILK  +D+ +A++ +  IA ++T+ +        +++V PYS+FYVFYEQYLT+       L V L  V  VT +LLG +  + +++   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +H+ RA+ V     R++RA + L  MGSSV SGITLTK  GI VL  SKSQ+F+IFYFRMYL +V+ GAAH +IFLPV LS+ G
Sbjct:    6 YVSSQHCVWYGECGNSTLEDKRLNCRYSGPPISLPEE-GHTLLQQLCPSLYY--GNNTVCCDVQQLNTLNSNLQLPLQFLSRCPSCFYNFMTMFCELTCSPYQSEFLNVTQTEPFVGPSPQRANESIVAMEYYIGEQFANAMYNACKDVEAPSSNVKALALLCGKDVKDCNATNWIQYMFSKDNGQVPFTITPIFSDDPVTSMLPMNNATKGCD-EPVEEGGASCSCQDCALSCGPVPQPPPLPPPWLIFGLDAMAVIMWIVYVVFLLLFSAVIIGSWCYRKKNIVSEYAPIDSTLAYS-VNSTPIAGEPSCCDRLGERLENFLRIGFTKWGSFCVRKPWIVIFFSVLLIVICCFGLKYMRITTDPVELWSDPHSQARQEKEYFDSHFGPFFRTEQLIITAPNSSVHNYSPYP-SGSDVPFGPPLDFNILAQVLELQNGIENLKAYYN--NETVMLKDICLAPLAPYNNNCTIFSVLNYFQNSFSVLNHSIQDDFYV-YADYHTHFLYCVRSPASLNDTSVLHDPCLGTFGGPIFPWLVLGGY-DDENYNNATALVITFPVNN-FRNDTEKLNRAKAWELEFIKFVENYS--NPNLSISFSAERSIEDEINRESKSDVTTVVISYALMFVYISLALGQIGHCSSILVDSKISLGIAGILIVLSSVACSLGIFSYAGVSLTLIVIEVIPFLVLAVGVDNIYIIVQRYQRDERLHDE---TLDQQIGRILGDVAPSIFLSAFAETVAFFLGALSSMPAVRTFSLFAGMAVFLDFLLQITCFISLLSLDIRRQEKNRLDILCCVPGCKRNRGTD-------KPKSWLFLFFKKLYAPVLMKDWIRPIVVSVFVGILSFSIAVVNKVEIGLDQSLSMPDDSYMLDYFGSLSTYLHTGPPVYFVVEEGHNYTTKEGQDKVCGGAGCNNNSLVQEIYTAAGISTMSDRFAIGYAPSSWIDDYFDWVKPQST--CCRIYNNTDQFCNASVVNASCLSCRSYTPEGKRKPVGEDFMHFLPMFLSDNPNPKCGKGGHAAYGSAVDLLDSN------TNVGATYFMTYHTILKNSTDFIDAMRKARTIAQNITDNMDIP---GKKYKVFPYSIFYVFYEQYLTIVDDTIFNLCVSLAAVFFVTVILLGFELWSAVLMCITISMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHVTRAFSVSTRGNRVQRAEDALAHMGSSVFSGITLTKFVGIGVLGLSKSQIFKIFYFRMYLAMVLLGAAHGLIFLPVLLSYLG 1243          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Mouse
Match: Npc1 (NPC intracellular cholesterol transporter 1 [Source:MGI Symbol;Acc:MGI:1097712])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 537/1273 (42.18%), Postives = 773/1273 (60.72%), Query Frame = 1
Query:  103 NDKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGY--------GGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDA-TSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY------DKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARR--CLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKF-KEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIW-SKQSGNPPCCRLYP-DGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKK 3834
            +  C+WYG+C  +  +K  NC Y+GPPKPL    G+  + +LCP       N SLCC+  QL TL   L         CP+C  N + L+C LTC P+Q  F  VT    Y          +++ + Y + ++F   ++N+C +V   S+N  A+  +CG     C+   + + + +     APF I        +  ++ M      CN +  E  G  CSCQDC   C   P P  P   + I G+D    I+ + + AF  +     + ++  + +Y        D        + +  + S  D  GA  +  L   F +WG F  R   C+I  S+  I   V S G++  +VTT+PVELWS+P S AR  K+YFD++FGPF+RTEQ+II   + +   +  Y   A ++ +GP  N ++L +V  L   I+   + +   N    L+DIC  PLSP  + C +MSV+ YFQN+   LD  V D+F +  A Y    + C++ P ++  T      C G FGGPVFP+L  GG+ D +NY ++TALVITF VNN  + ++++++ A  WEK F++ V+N+   N +L IS+TAERS++DE++R+S +D+FT+ +SY++MF Y+++ LG   +  ++ VDSK++LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FILVQTYQR DE    + L  +Q++ R++ +V P+M LSS SE+ AFF G ++ MPAV  FSL+A  AVL DFLLQIT  +++L LD KR E   +D+LCCVR  +      A           L   F  ++AP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSY+I+YF +LA YL  GPPVYF++++GYNY S   QNM+CG  GC+  SL+ Q+F A++    T +  + +SW+DD+F W S QS    CCRLY     FC ASV++ TC  C P     K RP  K F  +L  FL++NP+ +C KGGHAAYG AVNI   D        IGATYFMTYHTILKT +DYT+A+K +  IA+++TE +++     + + V PYSVFYVFYEQYLT+       L V LG + LVT V+LG +  + +I+   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HI RA+ +    +R+ RA E L  MGSSV SGITLTK GGI+VLAF+KSQ+F+IFYFRMYL +V+ GA H +IFLPV LS+ GP++N+ K
Sbjct:   22 SQSCVWYGECGIATGDKRYNCKYSGPPKPLPK-DGYDLVQELCP--GLFFDNVSLCCDIQQLQTLKSNLQLPLQFLSRCPSCFYNLMTLFCELTCSPHQSQFLNVTATEDYFDPKTQENKTNVKELEYFVGQSFANAMYNACRDVEAPSSNEKALGLLCGRDARACNATNWIEYMFNKDNGQAPFTIIPVFSDLSILGMEPMRNATKGCNESVDEVTG-PCSCQDCSIVCGPKPQPPPPPMPWRIWGLDAMYVIMWVTYVAFLFVFFGALLAVWCHRRRYFVSEYTPIDSNIAFSVNSSDKGEASCCDPLGAAFDDCLRRMFTKWGAFCVRNPTCIIFFSLAFIT--VCSSGLVFVQVTTNPVELWSAPHSQARLEKEYFDKHFGPFFRTEQLIIQAPNTSVHIYEPYPAGA-DVPFGPPLNKEILHQVLDL--QIAIESITASYNNETVTLQDICVAPLSPYNKNCTIMSVLNYFQNSHAVLDSQVGDDFYI-YADYHTHFLYCVRAPASLNDTSLLHGPCLGTFGGPVFPWLVLGGY-DDQNYNNATALVITFPVNNYYN-DTERLQRAWAWEKEFISFVKNYK--NPNLTISFTAERSIEDELNRESNSDVFTVIISYVVMFLYISLALGHIQSCSRLLVDSKISLGIAGILIVLSSVACSLGIFSYMGMPLTLIVIEVIPFLVLAVGVDNIFILVQTYQR-DERLQEETL--DQQLGRILGEVAPTMFLSSFSETSAFFFGALSSMPAVHTFSLFAGMAVLIDFLLQITCFVSLLGLDIKRQEKNHLDILCCVRGADDGQGSHAS-------ESYLFRFFKNYFAPLLLKDWLRPIVVAVFVGVLSFSVAVVNKVDIGLDQSLSMPNDSYVIDYFKSLAQYLHSGPPVYFVLEEGYNYSSRKGQNMVCGGMGCDNDSLVQQIFNAAELDTYTRVGFAPSSWIDDYFDWVSPQSS---CCRLYNVTHQFCNASVMDPTCVRCRPLTPEGKQRPQGKEFMKFLPMFLSDNPNPKCGKGGHAAYGSAVNIVGDD------TYIGATYFMTYHTILKTSADYTDAMKKARLIASNITETMRS---KGSDYRVFPYSVFYVFYEQYLTIIDDTIFNLSVSLGSIFLVTLVVLGCELWSAVIMCITIAMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTMSTKGSRVSRAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFEIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAK 1258          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Mouse
Match: Npc1l1 (NPC1 like intracellular cholesterol transporter 1 [Source:MGI Symbol;Acc:MGI:2685089])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 473/1260 (37.54%), Postives = 718/1260 (56.98%), Query Frame = 1
Query:  187 PLNNATG--FQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV------DTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINY---------LNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNK-YDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSP---DYEKCAVMSVMQYFQNNITQLDRIVTDEFN--LPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD-LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPML---FKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPASVVNSTC-NNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLE 3861
            P  + TG     L ++CP+      +   CC+T QL++LD  LS    +   CP C  NF+ ++C  TC P+Q  F+ V      D G   ++ A       +F +  + SC  V + +A S A+ ++CG      C+   +    GD  +  AP  I +          + +K ++  + PCN + GED   ACSCQDC ASCP  PPP     +F +  + GW+ ++ I+F A F+++  + +++ +  N+  +K  G+   P  P     S            L  +F  WG  VA   L VL++  I+ + LS+G+   ++TTDPVELWS+P S AR+ K + DE+FGPF+RT QI +  K+R+ + + +  +  +N  +  + ++DLL+ +  L   + +++V+S        L+DIC+ PL P       C V S++QYFQNN T L        N    +  + D  + C   P   K  T     C  D+G PVFP+LA GG+    +Y+++ AL+ITF +NN    + +   A L WE+AFL  +Q+F  +  D   I+++AERS++DEI+R +  DL   A+SY+I+F Y+++ LG Y+   ++ VDSK TLGL  V +VL +V  ++GF+SYL VP +L+I++VVPFLVLAVG DN+FI V  YQR       +    E  I R +  V PSMLL SLSE++ FF G +T MPAV+ F+L +  A++FDFLLQ+T  +A+L LD+KR EA R DV+CC    N+  P         +  G+L   F K Y P L   F  PV  L+ +   G NL+ +  I    V L+Q L++PKDSY+I+YF  L  YL VGPPVYF    GYN+ +E   N IC ++GC   SL  ++  AS+ PN +Y++ + +SW+DDF  W   S +  CCR+Y  G     FCP++  +  C  NC        RP  + F  YL +FL + P+++CPKGG AAY  +VN+ +         +I A+ FM YH  L+   D+TEAL+ S  +AA++T +L+   G    FEV PY++  VFY+QYLTV  +    L +C     +V ++LLGLD ++ ++    II+I+    G M +WGI  NA+S++NLV A+G+SVEF++HI R++ V    TR+ERA++  + MGS+V +G+ +T   GI++L F+++QL QIF+FR+ L I + G  H ++FLPV LS+ GP +N+  ++E+K   E
Sbjct:   61 PARHVTGDHLALLQRVCPRLYNGPNDTYACCSTKQLVSLDSSLSITKALLTRCPACSENFVSIHCHNTCSPDQSLFINVTRVVQRDPGQLPAVVAYEAFYQRSFAEKAYESCSRVRIPAAASLAVGSMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQALADGMKPLDGKITPCNESQGEDSA-ACSCQDCAASCPVIPPPPALRPSFYMGRMPGWLALI-IIFTAVFVLLSVVLVYLRVASNRNKNKTAGSQEAPNLPRKRRFSP--------HTVLGRFFESWGTRVASWPLTVLALSFIVVIALSVGLTFIELTTDPVELWSAPKSQARKEKAFHDEHFGPFFRTNQIFVTAKNRSSYKYDSLLLGPKN--FSGILSLDLLQELLELQERLRHLQVWSHEAQRNISLQDICYAPLKPHNTSLTDCCVNSLLQYFQNNHTLLLLTANQTLNGQTSLVDWKDHFLYCANAPLTYKDGTALALSCIADYGAPVFPFLAVGGY-QGTDYSEAEALIITFSINNYPADDPRMAHAKL-WEEAFLKEMQSFQRSTADKFQIAFSAERSLEDEINRTTIQDLPVFAISYLIVFLYISLALGSYSRWSRVAVDSKATLGLGGVAVVLGAVVAAMGFYSYLGVPSSLVIIQVVPFLVLAVGADNIFIFVLEYQRLPRMPGEQR---EAHIGRTLGSVAPSMLLCSLSEAICFFLGALTSMPAVRTFALTSGLAIIFDFLLQMTAFVALLSLDSKRQEASRPDVVCCFSSRNLPPPK--------QKEGLLLCFFRKIYTPFLLHRFIRPVVLLLFLVLFGANLYLMCNIS---VGLDQDLALPKDSYLIDYFLFLNRYLEVGPPVYFDTTSGYNFSTEAGMNAICSSAGCESFSLTQKIQYASEFPNQSYVAIAASSWVDDFIDWLTPSSS--CCRIYTRGPHKDEFCPSTDTSFNCLKNCMNRTLGPVRPTTEQFHKYLPWFLNDTPNIRCPKGGLAAYRTSVNLSSDG-------QIIASQFMAYHKPLRNSQDFTEALRASRLLAANITAELRKVPGTDPNFEVFPYTISNVFYQQYLTVLPEGIFTLALCFVPTFVVCYLLLGLDIRSGILNLLSIIMILVDTIGLMAVWGISYNAVSLINLVTAVGMSVEFVSHITRSFAVSTKPTRLERAKDATIFMGSAVFAGVAMTNFPGILILGFAQAQLIQIFFFRLNLLITLLGLLHGLVFLPVVLSYLGPDVNQALVLEEKLATE 1283          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Mouse
Match: Ptch1 (patched 1 [Source:MGI Symbol;Acc:MGI:105373])

HSP 1 Score: 109.383 bits (272), Expect = 7.228e-24
Identity = 66/237 (27.85%), Postives = 123/237 (51.90%), Query Frame = 1
Query: 1705 LDQNSKQIKAALD-WEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCC 2412
            ++ N  +  A L+ W++ ++ VV      N+   +      ++ D +   S+  +  +A  Y++M  Y  +T+ +++  K     S+  +GL  VL+V +SV   +G  S + +       +V+PFL L VGVD++F+L   +    E   +K +  E +    + + G S+ L+S+S   AFF   +  +PA++ FSL AA  V+F+F + + +  A+L +D  R E  R+D+ CC
Sbjct:  319 INWNEDRAAAILEAWQRTYVEVVHQSVAPNSTQKVLPFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSK-----SQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF---SETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCC 547          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Mouse
Match: Ptch1 (patched 1 [Source:MGI Symbol;Acc:MGI:105373])

HSP 1 Score: 110.538 bits (275), Expect = 1.059e-23
Identity = 66/237 (27.85%), Postives = 123/237 (51.90%), Query Frame = 1
Query: 1705 LDQNSKQIKAALD-WEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCC 2412
            ++ N  +  A L+ W++ ++ VV      N+   +      ++ D +   S+  +  +A  Y++M  Y  +T+ +++  K     S+  +GL  VL+V +SV   +G  S + +       +V+PFL L VGVD++F+L   +    E   +K +  E +    + + G S+ L+S+S   AFF   +  +PA++ FSL AA  V+F+F + + +  A+L +D  R E  R+D+ CC
Sbjct:  371 INWNEDRAAAILEAWQRTYVEVVHQSVAPNSTQKVLPFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSK-----SQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF---SETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCC 599          

HSP 2 Score: 65.855 bits (159), Expect = 4.520e-10
Identity = 70/228 (30.70%), Postives = 116/228 (50.88%), Query Frame = 1
Query: 3133 KPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGP 3816
            +P+E     F  Y   L+  SD+ EA++    I  + T     +LG S+     P    ++F+EQY+++   L + + V L    LV  V L   W A +I+   + L+   +FG M L GI ++A+ +V L+ ++GI VEF  H+  A++    D +  RA   L  M + VL G   T L G+++LA S+      ++F +   + + G  + ++ LPV LSF GP
Sbjct:  953 EPIEYAQ--FPFYLNGLRDTSDFVEAIEKVRVICNNYT-----SLGLSS----YPNGYPFLFWEQYISLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIV-MVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD-KNHRAMLALEHMFAPVLDGAVSTLL-GVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSFFGP 1166          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Mouse
Match: Ptchd3 (patched domain containing 3 [Source:MGI Symbol;Acc:MGI:1921925])

HSP 1 Score: 109.768 bits (273), Expect = 1.235e-23
Identity = 98/410 (23.90%), Postives = 193/410 (47.07%), Query Frame = 1
Query: 1552 PTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNT--DLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEA------------MRVDVLCCVRMNNVVTP--VDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLS-VGPPVYFIVKDGYNY 2730
            P +  PT+   +  G FGG V   +     G  +   +S A+ + + +     ++S++ +A   W   FL+   +   + T  ++ + Y +  S Q E +  S+T +    L+YI++  +  ++  + + I+     +K+ + +  V  V +SV    G   +L VP  +I+    PFL+L VGVD++FI++  +Q+     +S + +  ++++   SKV  S+ +++++  LAF+ G+ +   +V+ F +Y  T +LF +   IT   AV+ LD KR  A              +   CCV   +++     D  P         ++  F  ++ P L  +  +F+VV+ ++ + + ++     +   L+ +     DSY+  YF+    Y S  GP V  IV +  NY
Sbjct:  242 PIHNTPTQLIYLA-GFFGGNVLGQMT----GKSQRLVESRAMRLLYYLKTEDPEDSERSQA---WLTHFLDHFNDMKSSLTLEEIEVVYFSSLSRQLEFEATSKTVIPLFHLAYILIILFAVVSCSRLDCIR-----NKMCVAVFGVFSVAMSVVSGFGLMLHLGVPFVIIVANS-PFLILGVGVDDMFIMISAWQK-----TSLSESIRERLSNSYSKVAVSITITTITNVLAFYTGITSSFRSVQYFCIYTGTTLLFCYFYSITCFGAVMALDGKREVAWSRWLEKPDQKYSSLKKSCCVPFGSLIDKHGEDNHP---------MNLFFRDYFGPFLTTSKAKFIVVLLYIFYIISSIYGCFQVQEGLDLRNLASDDSYITPYFNVEEDYFSDYGPRVMVIVTESVNY 623          

HSP 2 Score: 83.9593 bits (206), Expect = 9.197e-16
Identity = 46/127 (36.22%), Postives = 81/127 (63.78%), Query Frame = 1
Query: 3427 TLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSF 3807
            +L + F I  ++  + GFM  W + ++++SM+NLV+ IG S +F AHI  A+V     +  +++ E L  +G  VL    ++ + G+ VL+ +K+ +F+ F+  M+L ++ FGAAH +IF+PVFL+F
Sbjct:  781 SLWVTFAIASVIVGVTGFMAFWNVNLDSISMINLVICIGFSFDFSAHISYAFVSSTEPSVNKKSIEALYLLGYPVLQS-AISTIIGVCVLSAAKAYIFRTFFKIMFL-VMFFGAAHGLIFIPVFLTF 905          
BLAST of Niemann-Pick disease, type C1 vs. UniProt/SwissProt
Match: sp|O35604|NPC1_MOUSE (NPC intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1 PE=1 SV=2)

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 537/1273 (42.18%), Postives = 773/1273 (60.72%), Query Frame = 1
Query:  103 NDKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGY--------GGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDA-TSNAPFQI------NYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY------DKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARR--CLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKF-KEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIW-SKQSGNPPCCRLYP-DGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKK 3834
            +  C+WYG+C  +  +K  NC Y+GPPKPL    G+  + +LCP       N SLCC+  QL TL   L         CP+C  N + L+C LTC P+Q  F  VT    Y          +++ + Y + ++F   ++N+C +V   S+N  A+  +CG     C+   + + + +     APF I        +  ++ M      CN +  E  G  CSCQDC   C   P P  P   + I G+D    I+ + + AF  +     + ++  + +Y        D        + +  + S  D  GA  +  L   F +WG F  R   C+I  S+  I   V S G++  +VTT+PVELWS+P S AR  K+YFD++FGPF+RTEQ+II   + +   +  Y   A ++ +GP  N ++L +V  L   I+   + +   N    L+DIC  PLSP  + C +MSV+ YFQN+   LD  V D+F +  A Y    + C++ P ++  T      C G FGGPVFP+L  GG+ D +NY ++TALVITF VNN  + ++++++ A  WEK F++ V+N+   N +L IS+TAERS++DE++R+S +D+FT+ +SY++MF Y+++ LG   +  ++ VDSK++LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FILVQTYQR DE    + L  +Q++ R++ +V P+M LSS SE+ AFF G ++ MPAV  FSL+A  AVL DFLLQIT  +++L LD KR E   +D+LCCVR  +      A           L   F  ++AP+L K  +R +VV  FVG   F+++ ++ + + L+Q LSMP DSY+I+YF +LA YL  GPPVYF++++GYNY S   QNM+CG  GC+  SL+ Q+F A++    T +  + +SW+DD+F W S QS    CCRLY     FC ASV++ TC  C P     K RP  K F  +L  FL++NP+ +C KGGHAAYG AVNI   D        IGATYFMTYHTILKT +DYT+A+K +  IA+++TE +++     + + V PYSVFYVFYEQYLT+       L V LG + LVT V+LG +  + +I+   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HI RA+ +    +R+ RA E L  MGSSV SGITLTK GGI+VLAF+KSQ+F+IFYFRMYL +V+ GA H +IFLPV LS+ GP++N+ K
Sbjct:   22 SQSCVWYGECGIATGDKRYNCKYSGPPKPLPK-DGYDLVQELCP--GLFFDNVSLCCDIQQLQTLKSNLQLPLQFLSRCPSCFYNLMTLFCELTCSPHQSQFLNVTATEDYFDPKTQENKTNVKELEYFVGQSFANAMYNACRDVEAPSSNEKALGLLCGRDARACNATNWIEYMFNKDNGQAPFTIIPVFSDLSILGMEPMRNATKGCNESVDEVTG-PCSCQDCSIVCGPKPQPPPPPMPWRIWGLDAMYVIMWVTYVAFLFVFFGALLAVWCHRRRYFVSEYTPIDSNIAFSVNSSDKGEASCCDPLGAAFDDCLRRMFTKWGAFCVRNPTCIIFFSLAFIT--VCSSGLVFVQVTTNPVELWSAPHSQARLEKEYFDKHFGPFFRTEQLIIQAPNTSVHIYEPYPAGA-DVPFGPPLNKEILHQVLDL--QIAIESITASYNNETVTLQDICVAPLSPYNKNCTIMSVLNYFQNSHAVLDSQVGDDFYI-YADYHTHFLYCVRAPASLNDTSLLHGPCLGTFGGPVFPWLVLGGY-DDQNYNNATALVITFPVNNYYN-DTERLQRAWAWEKEFISFVKNYK--NPNLTISFTAERSIEDELNRESNSDVFTVIISYVVMFLYISLALGHIQSCSRLLVDSKISLGIAGILIVLSSVACSLGIFSYMGMPLTLIVIEVIPFLVLAVGVDNIFILVQTYQR-DERLQEETL--DQQLGRILGEVAPTMFLSSFSETSAFFFGALSSMPAVHTFSLFAGMAVLIDFLLQITCFVSLLGLDIKRQEKNHLDILCCVRGADDGQGSHAS-------ESYLFRFFKNYFAPLLLKDWLRPIVVAVFVGVLSFSVAVVNKVDIGLDQSLSMPNDSYVIDYFKSLAQYLHSGPPVYFVLEEGYNYSSRKGQNMVCGGMGCDNDSLVQQIFNAAELDTYTRVGFAPSSWIDDYFDWVSPQSS---CCRLYNVTHQFCNASVMDPTCVRCRPLTPEGKQRPQGKEFMKFLPMFLSDNPNPKCGKGGHAAYGSAVNIVGDD------TYIGATYFMTYHTILKTSADYTDAMKKARLIASNITETMRS---KGSDYRVFPYSVFYVFYEQYLTIIDDTIFNLSVSLGSIFLVTLVVLGCELWSAVIMCITIAMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTMSTKGSRVSRAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFEIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAK 1258          
BLAST of Niemann-Pick disease, type C1 vs. UniProt/SwissProt
Match: sp|P56941|NPC1_PIG (NPC intracellular cholesterol transporter 1 OS=Sus scrofa OX=9823 GN=NPC1 PE=2 SV=1)

HSP 1 Score: 935.636 bits (2417), Expect = 0.000e+0
Identity = 547/1281 (42.70%), Postives = 781/1281 (60.97%), Query Frame = 1
Query:  103 NDKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGY--------GGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDA-TSNAPFQINYL------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY-DKDY----GNGIVPATPEVDDISTF--DKCGAKVEAYLTLWFYRWGMFVARR--CLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKF-KEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYS-GILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLG-NSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK 3852
            +  C+WYG+C  ++ +K  NC Y+GPPKPL    G+  + +LCP +     N SLCC+  QL TL   L         CP+C  N + L+C LTC P Q  F  VT    Y          +++ + Y + E F   ++N+C +V   S+N  A+  +CG   + C+   + + + +     APF I  +      + ++ MN     C+ +  E  G  CSCQDC   C   P P  P   + ILG+D    I+   + AF ++    +  ++  + +Y   +Y    GN I  +    D    F  D  GA  E  L   F +WG F  R   C++  S+  I+A   S G++  +VTTDPV+LWS+P S ARR K+YFD +FGPF+R EQ+II   +     +  Y   A ++ +GP  + D+L +V  L   I N+   +   N    L+DIC  PLSP  + C ++SV+ YFQN+ + LD  V D F    A Y    + C++ P ++       + C G FGGPVFP+L  GG+ D +NY ++TALVITF VNN  + ++++++ A  WE  F+N V+N+   N +L IS+ AERS++DE++R+S +DLFTI +SY IMF Y++I LG   +  ++ VDSK++LG+  +LIVL SV CS+G +SY+ VP+TLI++EV+PFLVLAVGVDN+FILVQTYQR DE    + L  +Q++ RV+ +V PSM LSS SE++AFF G ++ +PAV  FSL+A  AVL DFLLQIT  +++L LD KR E  R+DV+CCV+         A   A V+ S   L   F   YAP+L K  +R +V+  FVG   F+++ ++ + + L+Q LSMP DSY+++YF +L+ YL  GPPVYF+V++G+NY S   QNM+CG  GCN  SL+ Q+F A+Q  N T I  + +SW+DD+F W K   +  CCR+Y     FC ASVV+ TC  C P     K RP  + F  +L  FL++NP+ +C KGGHAAY  AVNI            +GATYFMTYHT+L+  +D+ +A++ +  IA+++T     T+G  ++ + V PYSVFYVFYEQYLTV       LGV LG + LVT VL+G +  AT+I+   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HI RA+ +    +R++RA E L  MGSSV SGITLTK GGI+VLAF+KSQ+FQIFYFRMYL IV+ GA H +IFLPV LS+ GP++N+ K +  ++
Sbjct:   22 SQSCVWYGECGIASGDKRYNCRYSGPPKPLPE-DGYDLVQELCPGF--FFGNVSLCCDVQQLRTLKDNLQLPLQFLSRCPSCFYNLMNLFCELTCSPRQSQFLNVTATEDYVDPVTNQTKTNVKELEYYVGETFANAMYNACRDVEAPSSNEKALGLLCGREAQACNATNWIEYMFNKDNGQAPFTITPIFSDLPTHGMEPMNNATKGCDESVDEVTG-PCSCQDCSIVCGPKPQPPPPPVPWRILGLDAMYVIMWSSYMAFLIVFFGAFFAVWCYRKRYFVSEYTPIDGN-IAFSVNSSDKGQAFCCDPLGAAFERGLRRLFAQWGAFCVRHPGCVVFFSLAFIVA--CSSGLVFIRVTTDPVDLWSAPGSQARREKEYFDTHFGPFFRMEQLIIRATNNQSHIYHPYPAGA-DVPFGPPLSRDILHQVLDLQTAIENIT--ASYNNETVTLQDICLAPLSPYNKNCTILSVLNYFQNSHSVLDHQVGD-FFFVYADYHTHFLYCVRAPASLNDASLLHDPCLGTFGGPVFPWLVLGGY-DDQNYNNATALVITFPVNNYYN-DTEKLQRAQAWESEFINFVKNYK--NPNLTISFMAERSIEDELNRESNSDLFTILISYAIMFLYISIALGHIKSCSRLLVDSKISLGIAGILIVLSSVACSLGIFSYIGVPLTLIVIEVIPFLVLAVGVDNIFILVQTYQR-DERLQGETL--DQQLGRVLGEVAPSMFLSSFSETVAFFLGGLSVVPAVHTFSLFAGMAVLIDFLLQITCFVSLLGLDIKRQEKNRLDVVCCVQ--------GAEDGAGVQASESCLFRFFKNSYAPLLLKDWMRPIVIAVFVGVLSFSIAVLNKVEIGLDQSLSMPDDSYVMDYFQSLSRYLHAGPPVYFVVEEGHNYTSLKGQNMVCGGLGCNNDSLVQQIFTAAQLDNYTRIGFAPSSWIDDYFDWIKPQSS--CCRVYNSTDQFCNASVVDPTCIRCRPLTSEGKQRPQGEDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILGNGSG------VGATYFMTYHTVLQASADFIDAMQKARLIASNITR----TMGLEASSYRVFPYSVFYVFYEQYLTVIDDTIFNLGVSLGAIFLVTVVLMGCELWATVIMCVTIAMILVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTLSTKGSRVDRAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFQIFYFRMYLAIVLLGATHGLIFLPVLLSYIGPSINKAKSLATQE 1264          
BLAST of Niemann-Pick disease, type C1 vs. UniProt/SwissProt
Match: sp|O15118|NPC1_HUMAN (NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2)

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 544/1277 (42.60%), Postives = 775/1277 (60.69%), Query Frame = 1
Query:  103 NDKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNF--VTVDTGY--------GGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDA-TSNAPFQINYL------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY------DKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARR--CLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFT----WINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKF-KEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRL-YPDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLG-NSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKK 3834
            +  C+WYG+C  +  +K  NC Y+GPPKPL    G+  + +LCP +     N SLCC+  QL TL   L         CP+C  N + L+C LTC P Q  F  VT    Y          +++ + Y + ++F   ++N+C +V   S+N  A+  +CG   + C+   + + + +     APF I  +      + ++ MN     C+ +  E     CSCQDC   C   P P  P   +TILG+D    I+ I + AF ++    +  ++  + +Y        D          +  + S  D   A  E  L   F RWG F  R   C+I  S+  I A   S G++  +VTT+PV+LWS+PSS AR  K+YFD++FGPF+RTEQ+II    R P T    +  Y  S  ++ +GP  +I +L +V  L   I N+   +   N    L+DIC  PLSP    C ++SV+ YFQN+ + LD    D+F    A Y    + C++ P ++  T    + C G FGGPVFP+L  GG+ D +NY ++TALVITF VNN  + ++++++ A  WEK F+N V+N+   N +L IS+TAERS++DE++R+S++D+FT+ +SY IMF Y+++ LG   + +++ VDSKV+LG+  +LIVL SV CS+G +SY+ +P+TLI++EV+PFLVLAVGVDN+FILVQ YQR DE    + L  +Q++ RV+ +V PSM LSS SE++AFF G ++ MPAV  FSL+A  AV  DFLLQIT  +++L LD KR E  R+D+ CCVR     T V A           L   F   Y+P+L K  +R +V+  FVG   F+++ ++ + + L+Q LSMP DSYM++YF +++ YL  GPPVYF++++G++Y S   QNM+CG  GCN  SL+ Q+F A+Q  N T I  + +SW+DD+F W K   +  CCR+      FC ASVV+  C  C P     K RP    F  +L  FL++NP+ +C KGGHAAY  AVNI       H    +GATYFMTYHT+L+T +D+ +ALK +  IA++VTE    T+G N + + V PYSVFYVFYEQYLT+       LGV LG + LVT VLLG +  + +I+   I +++ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HI RA+ V    +R+ERA E L  MGSSV SGITLTK GGI+VLAF+KSQ+FQIFYFRMYL +V+ GA H +IFLPV LS+ GP++N+ K
Sbjct:   22 SQSCVWYGECGIAYGDKRYNCEYSGPPKPLPK-DGYDLVQELCPGF--FFGNVSLCCDVRQLQTLKDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQFLNVTATEDYVDPVTNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTA-PCSCQDCSIVCGPKPQPPPPPAPWTILGLDAMYVIMWITYMAFLLVFFGAFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLFTRWGSFCVRNPGCVIFFSLVFITA--CSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLII----RAPLTDKHIYQPYP-SGADVPFGPPLDIQILHQVLDLQIAIENIT--ASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDF-FVYADYHTHFLYCVRAPASLNDTSLLHDPCLGTFGGPVFPWLVLGGY-DDQNYNNATALVITFPVNNYYN-DTEKLQRAQAWEKEFINFVKNYK--NPNLTISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQR-DERLQGETL--DQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQAS-------ESCLFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSS--CCRVDNITDQFCNASVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNIL----LGHG-TRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTE----TMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGITLTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAK 1259          
BLAST of Niemann-Pick disease, type C1 vs. UniProt/SwissProt
Match: sp|Q6T3U3|NPCL1_RAT (NPC1-like intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1l1 PE=1 SV=1)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 477/1291 (36.95%), Postives = 729/1291 (56.47%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTG-------PPKPLNNATG--FQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFV----TVDTGYGGSIQAVTYNLNENFYQGLF-----NSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYL---------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNK-YDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSP---DYEKCAVMSVMQYFQNNITQLDRIVTDEFN--LPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTD-LHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFV---GWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPASVVNSTC-NNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQK 3849
            C +Y +C K   N  L+   T           P  + TG     L ++CP+          CC+T QLL+L+  +S    +   CP C  NF+ L+C  TC P+Q  F+     V+ G G     V Y   E FYQ  F      SC  V + +A S A+ ++CG      C+   +    GD  +  AP  I +          + ++ +N  + PCN + G DD   CSCQDC ASCP  PPP+    +F +  + GW+ ++ I+F A F+++ ++ + + +  N+  +K  G    P  P    +S            L  +F  WG  VA   L VL++  I+ + L+ G+   ++TTDPVELWS+P S AR+ K + DE+FGPF+RT QI +  ++R+ + + +  + ++N  +  + ++D L  +  L   + +++V+S        L+DIC+ PL+P       C V S++QYFQNN T L        N    +  + D  + C   P   K  T     C  D+G PVFP+LA GG+    +Y+++ AL+ITF +NN    + +  +A L WE+AFL  +++F    +D   ++++AERS++DEI+R +  DL   A+SYII+F Y+++ LG Y+   ++ V+SK TLGL  V++VL +V  ++GF+SYL VP +L+I++VVPFLVLAVG DN+FI V  YQR       +    E  I R +  V PSMLL SLSE++ FF G +T MPAV+ F+L +  A++ DFLLQ+T  +A+L LD+KR EA R DVLCC     +  P +          G+L   F K YAP L    +R +V++ F+   G NL+ +  I+   V L+Q+L++PKDSY+I+YF  L  YL VGPPVYF+   G+N+ SE   N  C ++GC   SL  ++  AS+ P+ +Y++ + +SW+DDF  W   S +  CCRLY  G     FCP++  +  C  NC        RP A+ F  YL +FL + P+++CPKGG AAY  +VN+ +         ++ A+ FM YH  L+   D+TEAL+ S  +AA++T  L+   G    FEV PY++  VFY+QYLTV  +    L +C     +V ++LLGLD  + ++    II+I+    G M +WGI  NA+S++NLV A+G+SVEF++HI R++ V    TR+ERA++  V MGS+V +G+ +T   GI++L F+++QL QIF+FR+ L I + G  H ++FLPV LS+ GP +N+  + E+K
Sbjct:   32 CTFYEECGK---NPELSGGLTSLSNVSCLSNTPARHVTGEHLALLQRICPRLYNGPNTTFACCSTKQLLSLESSMSITKALLTRCPACSDNFVSLHCHNTCSPDQSLFINVTRVVERGAGEPPAVVAY---EAFYQRSFAEKAYESCSQVRIPAAASLAVGSMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQALPDGIQPLNGKIAPCNESQG-DDSAVCSCQDCAASCPVIPPPEALRPSFYMGRMPGWLALI-IIFTAVFVLLSAVLVRLRVVSNRNKNKAEGPQEAPKLPHKHKLSP--------HTILGRFFQNWGTRVASWPLTVLALSFIVVIALAAGLTFIELTTDPVELWSAPKSQARKEKSFHDEHFGPFFRTNQIFVTARNRSSYKYDSLLLGSKN--FSGILSLDFLLELLELQERLRHLQVWSPEAERNISLQDICYAPLNPYNTSLSDCCVNSLLQYFQNNRTLLMLTANQTLNGQTSLVDWKDHFLYCANAPLTFKDGTSLALSCMADYGAPVFPFLAVGGY-QGTDYSEAEALIITFSLNNYPADDPRMAQAKL-WEEAFLKEMESFQRNTSDKFQVAFSAERSLEDEINRTTIQDLPVFAVSYIIVFLYISLALGSYSRCSRVAVESKATLGLGGVIVVLGAVLAAMGFYSYLGVPSSLVIIQVVPFLVLAVGADNIFIFVLEYQRLPRMPGEQR---EAHIGRTLGSVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAIILDFLLQMTAFVALLSLDSKRQEASRPDVLCCFSTRKLPPPKEK--------EGLLLRFFRKIYAPFLLHRFIRPVVMLLFLTLFGANLYLMCNIN---VGLDQELALPKDSYLIDYFLFLNRYLEVGPPVYFVTTSGFNFSSEAGMNATCSSAGCKSFSLTQKIQYASEFPDQSYVAIAASSWVDDFIDWLTPSSS--CCRLYIRGPHKDEFCPSTDTSFNCLKNCMNRTLGPVRPTAEQFHKYLPWFLNDPPNIRCPKGGLAAYRTSVNLSSDG-------QVIASQFMAYHKPLRNSQDFTEALRASRLLAANITADLRKVPGTDPNFEVFPYTISNVFYQQYLTVLPEGIFTLALCFVPTFVVCYLLLGLDMCSGILNLLSIIMILVDTIGLMAVWGISYNAVSLINLVTAVGMSVEFVSHITRSFAVSTKPTRLERAKDATVFMGSAVFAGVAMTNFPGILILGFAQAQLIQIFFFRLNLLITLLGLLHGLVFLPVVLSYLGPDVNQALVQEEK 1279          
BLAST of Niemann-Pick disease, type C1 vs. UniProt/SwissProt
Match: sp|Q9VRC9|NPC1B_DROME (NPC intracellular cholesterol transporter 1 homolog 1b OS=Drosophila melanogaster OX=7227 GN=Npc1b PE=2 SV=2)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 464/1254 (37.00%), Postives = 692/1254 (55.18%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPS------LCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV--DTGYGGS--IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYL---NEVKGMNQTML---PCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPL-----SPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGF-----GDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNN-VVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRL-YPDGSFCPASVVNSTCNNCPANFTAKH-RPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSD-TRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHA 3777
            CIWYGQ      + + N   T P +PLN+ T      K CP   K  +  S      LCC+  Q+ T++  LS A  +F  CP C RN     CA+TC  N   F+T   DT   G   ++ + Y L ++    ++NSC  +  +     A+D  CG+ + K C+   +Y+ +GD + +  PFQINY    +  +G N+  L   P       +D  AC+C DC  SCP    P  P + + I G+ G  FI+ ++        +S +IF           +G     + P V   + F +       +    F  WG F A+  +IVL++       LS GI    +TTDPVELW+   S  R  KDYFD++FGPFYRT Q+ +   ++T FT   ++ S   L +GP F  + L+ V  L + I  +      + +   L+ IC+ P+     +P  ++CA+ SV  YFQ+++ + +    D  N  I  Y++Q+ +C++ P         E C G FGGP+ P +A GG      G+  +Y  +T LV+TF+  N  D++  +++  + WEK F++ ++++     D  I+Y AERS+QD I   SE ++ T+ +SY++MF YV I LG   + +    +S++ L +  ++IVL SV CS+GFW YL+V  T++ +EV+PFLVLAVGVDN+FI+V TYQR D    SK  TT + I   + +VGPS+L ++ SE   F  G +++MPAVK F++YAA A+L DFLLQIT  +A++ +D KR    R+D+LCCV+     +   D   V + K  G+L  +F  FY+P L   PV+  V++ F      +L     I   L+Q++SMPK+S+++ YF  +   L++G PVY+++K G NY     QN+ICG   CN  SL  QL+  +Q P +T ++   +SWLDD+  W   S    CC+     G FC ++  +  C  C   FT    RPDA+ F+ Y+ +FL + P  +C K G A+Y  AV I   DD     V+   +YFM Y T   T  ++   L+    I+  +    K    N+   E+  Y VFY++YEQYLT++      LG+ L  + LVT ++ GLD  +T I+ F +I I+ +M G M+ W I +NA+S+VNLV+ +GI VEF+AHIVR++  +R++ T  ERAR  L   GSSVLSGITLTK  GI+VL FS SQ+FQ+FYFRMYLGIV+ GAAH 
Sbjct:   24 CIWYGQSHMIGAHWV-NKGDTNPARPLNSPTSEAIFAKRCPMLYKEYKGESGEDELSLCCDAAQIETMESGLSQADGVFSRCPTCTRNMALTVCAMTCAKNHTLFLTAYNDTNDAGVDYVKYIDYRLTDDTVSKIYNSCIGIQHTQTGRPAMDLGCGSYNAKTCNYRRWYEFMGDVSGDYVPFQINYKWSEDAEEGSNEIYLDLSPLKCGESYEDSYACACIDCEESCPLTDAPTGPDELWKIAGLYGVTFILALIIAC----ALSFFIF-----------WGAFGKTSAPSVCMPTLFGE-------FFYHGFRIWGTFCAKHPVIVLALCSWAIAGLSFGIRYMTITTDPVELWAGEESQTRIEKDYFDQHFGPFYRTNQMFVKAVNQTYFT---HETSNGVLNFGPAFEYNFLKEVFELQDSIMKLG-----MADNEGLDKICYAPVLMAGETPTVDRCAIQSVYGYFQHDMDRFENSYVDSNNYTI-NYLNQLEDCLRVP-------MMEDCFGTFGGPIEPGIAVGGMPKVAVGEDPDYMLATGLVLTFLGRNYNDES--KLEPNMKWEKLFVDFLRDYKSDRLD--IAYMAERSIQDAIVELSEGEVSTVVISYVVMFVYVAIALGHIRSCRGFLRESRIMLAIGGIVIVLASVVCSLGFWGYLDVTTTMLAIEVIPFLVLAVGVDNIFIMVHTYQRLDH---SKFKTTHEAIGEAIGQVGPSILQTAGSEMACFAIGCISDMPAVKTFAMYAAIAILLDFLLQITAFVALMAIDEKRYLDGRLDMLCCVKSGGKKINDEDGDGVDRPKEVGLLETLFKNFYSPFLLSKPVKVSVLLIFTVITCLSLMVTPSIEKGLDQEMSMPKNSHVVKYFRYMVDLLAMGAPVYWVLKPGLNYSEPLQQNLICGGVECNNNSLSVQLYTQAQYPEITSLARPASSWLDDYIDWLAIS---DCCKYNVTTGGFCSSNSKSEDCLPCERGFTENGLRPDAETFNKYIPYFLFDLPDAECAKAGRASYADAV-IYTIDDVGMSTVQ--DSYFMQYSTTSTTSEEFYSQLREVRRISGEINAMFKE---NNVDAEIFAYCVFYIYYEQYLTIWGDAMFSLGMSLVAIFLVTLLITGLDITSTFIVLFMVICILINMLGMMWAWSINLNAISLVNLVVCVGIGVEFVAHIVRSF--KRAEGTAQERARHSLNVTGSSVLSGITLTKFAGIVVLGFSNSQIFQVFYFRMYLGIVLIGAAHG 1220          
BLAST of Niemann-Pick disease, type C1 vs. TrEMBL
Match: A0A1S3IJ92 (Niemann-Pick C1 protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106164556 PE=4 SV=1)

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 590/1315 (44.87%), Postives = 818/1315 (62.21%), Query Frame = 1
Query:  106 DKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYG--GSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNAPFQINYLNE-----VKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIY--------------LKKNKY--DKDYGNGIVPATPEV--------DDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYD-ISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNL-PIATYMDQIMECIKDPTNIKPTKFKEI-CNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIK--KIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGS----FCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL--------------------------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK 3852
            D C+WYG+    +  KILN  Y G  KPL N +    L +LCP       N S CC+ DQ+ TL   +   S + G CP+C  NF +LYC  TC     +F+ VD        +  VTY ++E F   +FNSC +VV+ S N  A+  +CG  +  C+   +   +G+   N+PFQI+Y+        +  N +  PC     +DD  ACSCQDC  +C   P P+ P     ILGID   FI+  +F  FF++ I   IF Y              L++N +  + D  + +    P           +I+  +K G  ++ +L   F +WG FVARR L+VL +G+++ + L  G++   V  DPV+LWS+P S AR  KDYFD++FGPFYRTEQ+II PK+++ +   N D  S      GPVF  + L  +  L   I+++       N    LEDIC+KPLSPD   C +MSV+ YFQNN+T+L+    D ++L  +  Y D ++ C + PTN   T   ++ C  +FGGPV P++A GGF +  NY D+TALV+TFIVNN + ++S Q  A L WE+ +L+ ++ + +   D  ++Y+AERS+QDEI+R+S +D+ TI +SY+IMF Y+TI+LG+ N+    ++ +DSK+TLG   VLIV +SV  S+GF+SY+ VPMTLII+EV+PFLVLAVGVDN+FILVQ YQR    +   N + E+++ R+V KVGPSMLL+S SE+LAFF G + +MPAV+IFSLYAA AVLF+FLLQI+V +A+L LD KR E  R+DV CCV++   + P         K    L   F  +YAP L    VR  V++ FVGW   +L+ +  +   L+QKLSMP+DSY++ YFDA+A YLSVGPPVYF+VKDGY+Y +   QN ICG  GC++ SL+GQ+ +AS+  NV+ I+   +SWLDD+F W K  G+PPCCR   D       CP+ V NS+C  C  + T  H PD   F  YL +FL +NP ++C KGGHAAYGQAV+  +         +IG +YFM+YHTILKT  DY EAL+ + ++A ++T+ +   +                           N  +FEV PYSVFYVFYEQYL + K  W  L +C   +L+VTFVLLG D  + +++   I +I  SMFG M+LWGI +NA+S+VNL+M +GISVEF +HIVRA+ V   ++R+ERA++ L  MGSSVLSGITLTKLGGIIVLAFSKSQLFQ+FYFRMYLG+V+FGA H +IFLPV LS+ GP +N+  + E+++
Sbjct:   24 DHCVWYGE-KTLDSGKILNPFYNGTAKPLLNESAKAILKELCPHMVT-GENISTCCSPDQIYTLQKNMGVPSQLIGRCPSCYSNFRKLYCDFTCSATHSSFLRVDQVIPVLNLVNQVTYFIDEGFADRMFNSCKDVVMPSNNEKAMSVLCGNAN--CNAKKWLNFMGNPI-NSPFQIHYIMSGLPPGYETFNISTTPC-YEAVDDDSLACSCQDCPKACGPEPTPKPPPPKCYILGIDCAFFIMGCIFIGFFLVFIIGNIFYYIICKNTLGVNRQDDLEENDWAINSDSSDTVPVLKPGAAQRRVIGKHEINCLEKIGFHLDRWLQKIFTKWGTFVARRPLVVLIIGLLLCVALGCGLLKLSVIVDPVQLWSAPKSVARTQKDYFDQHFGPFYRTEQLIITPKNQSKWWRTNLDPYSPGETLIGPVFKKEFLLEILDLQTKITSLVAHDPDTNVTISLEDICYKPLSPDNNHCTIMSVLNYFQNNVTRLEYTAWDGYHLQELGDYFDHLLSCARGPTNPTDTALTKLPCLAEFGGPVLPWVALGGF-EGDNYEDATALVVTFIVNNHV-KDSDQKNATL-WEQVYLDFMKEYVKKERDFTVAYSAERSIQDEINRESNSDVLTILISYLIMFAYITISLGEANSCDTVRLLIDSKITLGFAGVLIVFLSVISSLGFYSYIGVPMTLIIIEVIPFLVLAVGVDNIFILVQAYQRSQRRH---NESREEQLGRIVGKVGPSMLLTSSSETLAFFLGALIDMPAVRIFSLYAAQAVLFNFLLQISVFVALLSLDVKRQENNRIDVACCVKVGKSIPP---------KQDSYLLACFKNYYAPFLMSDWVRPSVIVIFVGWCCASLAMVPKLSTGLDQKLSMPRDSYVLTYFDAMAKYLSVGPPVYFVVKDGYDYSTLEGQNWICGLPGCHQDSLIGQISLASKFSNVSRIAQPASSWLDDYFAWLKPGGSPPCCRAIKDDHGKEVLCPSLVDNSSCYKCNTSITRDH-PDKDTFVRYLPWFLEDNPGIKCAKGGHAAYGQAVHFNDA-----AKTQIGGSYFMSYHTILKTSQDYIEALRYARQVANNITKAMNDAMTGTEEEVAYKYSAQGNTERNITLEKHKNKKKFEVYPYSVFYVFYEQYLLIVKDTWFNLTLCGVAILVVTFVLLGFDLYSAILVILTISMIEISMFGMMHLWGIDLNAVSLVNLIMCVGISVEFCSHIVRAFAVSIRNSRVERAKDALAHMGSSVLSGITLTKLGGIIVLAFSKSQLFQVFYFRMYLGMVLFGATHGLIFLPVLLSYIGPPINKAILFEKQQ 1311          
BLAST of Niemann-Pick disease, type C1 vs. TrEMBL
Match: A0A1S3IIC0 (Niemann-Pick C1 protein isoform X2 OS=Lingula unguis OX=7574 GN=LOC106164556 PE=4 SV=1)

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 591/1315 (44.94%), Postives = 816/1315 (62.05%), Query Frame = 1
Query:  106 DKCIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYG--GSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNAPFQINYLNE-----VKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIY--------------LKKNKY--DKDYGNGIVPATPEV--------DDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYD-ISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNL-PIATYMDQIMECIKDPTNIKPTKFKEI-CNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIK--KIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGS----FCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTL--------------------------GNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK 3852
            D C+WYG+    +  KILN  Y G  KPL N +    L +LCP       N S CC+ DQ+ TL   +   S + G CP+C  NF +LYC  TC     +F+ VD        +  VTY ++E F   +FNSC +VV+ S N  A+  +CG  +  C+   +   +G+   N+PFQI+Y+        +  N +  PC     +DD  ACSCQDC  +C   P P+ P     ILGID   FI+  +F  FF++ I   IF Y              L++N +  + D  + +    P           +I+  +K G  ++ +L   F +WG FVARR L+VL +G+++ + L  G++   V  DPV+LWS+P S AR  KDYFD++FGPFYRTEQ+II PK+++ +   N D  S      GPVF  + L  +  L   I+++       N    LEDIC+KPLSPD   C +MSV+ YFQNN+T+L+    D ++L  +  Y D ++ C + PTN   T   ++ C  +FGGPV P++A GGF +  NY D+TALV+TFIVNN + ++S Q  A L WE+ +L+ ++ + +   D  ++Y+AERS+QDEI+R+S +D+ TI +SY+IMF Y+TI+LG+ N+    ++ +DSK+TLG   VLIV +SV  S+GF+SY+ VPMTLII+EV+PFLVLAVGVDN+FILVQ YQR    +   N + E+++ R+V KVGPSMLL+S SE+LAFF G + +MPAV+IFSLYAA AVLF+FLLQI+V +A+L LD KR E  R+DV CCV++   + P         K    L   F  +YAP L    VR  V++ FVGW   +L+ +  +   L+QKLSMP+DSY++ YFDA+A YLSVGPPVYF+VKDGY+Y +   QN ICG  GC++ SL+GQ+ +AS+  NV+ I+   +SWLDD+F W K  G+PPCCR   D       CP+ V NS+C  C  + T  H PD   F  YL +FL +NP ++C KGGHAAYGQAV+  +         +IG +YFM+YHTILKT  DY EAL+ + ++A ++T+ +   +                           N  +FEV PYSVFYVFYEQYL + K  W  L +C   +L+VTFVLLG D  + +++   I +I  SMFG M+LWGI +NA+S+VNL+M +GISVEF +HIVRA+ V   ++R+ERA++ L  MGSSVLSGITLTKLGGIIVLAFSKSQLFQ+FYFRMYLG+V+FGA H +IFLPV LS+ GP LN+  +   +K
Sbjct:   24 DHCVWYGE-KTLDSGKILNPFYNGTAKPLLNESAKAILKELCPHMVT-GENISTCCSPDQIYTLQKNMGVPSQLIGRCPSCYSNFRKLYCDFTCSATHSSFLRVDQVIPVLNLVNQVTYFIDEGFADRMFNSCKDVVMPSNNEKAMSVLCGNAN--CNAKKWLNFMGNPI-NSPFQIHYIMSGLPPGYETFNISTTPC-YEAVDDDSLACSCQDCPKACGPEPTPKPPPPKCYILGIDCAFFIMGCIFIGFFLVFIIGNIFYYIICKNTLGVNRQDDLEENDWAINSDSSDTVPVLKPGAAQRRVIGKHEINCLEKIGFHLDRWLQKIFTKWGTFVARRPLVVLIIGLLLCVALGCGLLKLSVIVDPVQLWSAPKSVARTQKDYFDQHFGPFYRTEQLIITPKNQSKWWRTNLDPYSPGETLIGPVFKKEFLLEILDLQTKITSLVAHDPDTNVTISLEDICYKPLSPDNNHCTIMSVLNYFQNNVTRLEYTAWDGYHLQELGDYFDHLLSCARGPTNPTDTALTKLPCLAEFGGPVLPWVALGGF-EGDNYEDATALVVTFIVNNHV-KDSDQKNATL-WEQVYLDFMKEYVKKERDFTVAYSAERSIQDEINRESNSDVLTILISYLIMFAYITISLGEANSCDTVRLLIDSKITLGFAGVLIVFLSVISSLGFYSYIGVPMTLIIIEVIPFLVLAVGVDNIFILVQAYQRSQRRH---NESREEQLGRIVGKVGPSMLLTSSSETLAFFLGALIDMPAVRIFSLYAAQAVLFNFLLQISVFVALLSLDVKRQENNRIDVACCVKVGKSIPP---------KQDSYLLACFKNYYAPFLMSDWVRPSVIVIFVGWCCASLAMVPKLSTGLDQKLSMPRDSYVLTYFDAMAKYLSVGPPVYFVVKDGYDYSTLEGQNWICGLPGCHQDSLIGQISLASKFSNVSRIAQPASSWLDDYFAWLKPGGSPPCCRAIKDDHGKEVLCPSLVDNSSCYKCNTSITRDH-PDKDTFVRYLPWFLEDNPGIKCAKGGHAAYGQAVHFNDA-----AKTQIGGSYFMSYHTILKTSQDYIEALRYARQVANNITKAMNDAMTGTEEEVAYKYSAQGNTERNITLEKHKNKKKFEVYPYSVFYVFYEQYLLIVKDTWFNLTLCGVAILVVTFVLLGFDLYSAILVILTISMIEISMFGMMHLWGIDLNAVSLVNLIMCVGISVEFCSHIVRAFAVSIRNSRVERAKDALAHMGSSVLSGITLTKLGGIIVLAFSKSQLFQVFYFRMYLGMVLFGATHGLIFLPVLLSYIGPPLNKATLYASQK 1311          
BLAST of Niemann-Pick disease, type C1 vs. TrEMBL
Match: A0A267FSF3 (SSD domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027873g1 PE=4 SV=1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 577/1315 (43.88%), Postives = 821/1315 (62.43%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQ-YAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV----DTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTH-EKCDPVAFYKALGDATSN--APFQINYL----------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIV--ISIYIFIYLKKNKYDKDYGN---------------GIVPATPEVD-DISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEI-CNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNT-DLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNN--------VVTP---VDAVP--VAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGS--FCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK--LLEKMPENNSWGN 3891
            CI Y QC K    K  NC Y GPPK LN++    +L  +CP  +         CC   Q+ TL  QL PA ++F  CP C +NF  L+C  TC PNQ +++       T +G  I  + YN+   F  GLFNSC +V+    NS AI  +CG+   EKC     Y  +GD  +N  APF   YL            +  MN +++ C +         CSC DC+A+C  PPP   P K + ILG+DGW  I+ +V+  F ++    +I+  +Y   +   K + N                     P  D DI   D+  A+ E+ L   F  WG  VA R +IVL  G+++ + LS G+   +VTTDPVELWS+P S+AR+ K++FDENFGPFYR+EQII++P+++T F+   Y        + PV     L+++  L  H++NMEV+S  L     L DICFKPL+PDY  CAV S + YFQ+N T L+    ++F+L  A ++  ++ C ++P ++      ++ C  ++GGP++P++ FGGF +   Y +S+A+V+TFIVNN ++  SKQ++AA +WE AFL V + F E N+ +  + Y++ERS++DE++R+S +D+ TI +SY++MF YVTITLGQY +  ++ +D+KVTLGL  V+IVLI+V CS+GFWSYL  P TLII+EVVPFLVLAVGVDN+FILVQ YQR D  Y+      + +IAR V  VGPSMLLSSLSES+AFF G +T MPAV++F+LYA  AVL DFLLQI+  +A+L LDA+R  A R DVLCC+  +            P   +D+ P        SG+L ++F ++ + +LF++ VR  V++ F GW    L+ +H + V L+Q+LSMP+DSY+I+YFD +  YLSVGPPVYF+V+   +Y   + QN++C  +GC +KS++GQL   S+ P  +YI +  +SW DD+  W   SG+PPCCR +  GS  FCPA+   + C +C  NFT+  RP    F  YL +FL +NP   C KGGHAAY  A+       +S+    + A+Y+MTYH++L+T  D+  A K +I++   +    +  +  S +  V PYSVFYVFYEQYLT+     + L +C+  + +VTF+LLG D  +T I+   I LI+NSM GFMY W I +NA+S+VNLVM +GISVEF +H+VRA+ V +  +R+ RAR+  V MGSSV SGITLTKLGGI++L F+KSQLF+IFYFRMYLGIV+FGA H ++FLPV LS+ GPA +  ++ ++++  LLE+  E++S G 
Sbjct:   22 CIMYDQCGKGPTGKSTNCVYNGPPKLLNDSAAVASLKSICPDLFDPGSDTIYTCCAPSQVQTLSQQLDPAGLLFKRCPGCWKNFRELFCQFTCSPNQTHYMRPTQVNQTSHG--ILNIDYNITSTFSYGLFNSCKDVM--QGNSKAIGGLCGSVSVEKCTIQDIYSFIGDTKANSLAPFNTKYLIQDQCYTNGSESMCPMNSSLVKCELGDKAGGIAPCSCTDCQAACVKPPPIPAPPKPWRILGVDGWYLILFLVYAVFILLFGGANIFFHVYANNSMGFKLFQNEPPSASTAASNATAASSSEGRPLSDKDIGCGDRINAEFESRLEAAFTSWGRLVADRPVIVLVAGLLLCVGLSCGVFFFQVTTDPVELWSAPDSTARQQKNFFDENFGPFYRSEQIIVIPRNQTLFSHDPYFEPLPYKVFSPVVRKQFLQKLLDLQTHVTNMEVWSDTLGRNMSLTDICFKPLAPDYSTCAVQSPLGYFQSNGTNLNLTHLNDFDLVDADWITHLVACTQNPISMNDNSPNQMSCFAEWGGPIYPWVVFGGF-NGTAYLNSSAIVLTFIVNNDVNSESKQVRAAKEWESAFLKVARQFKEDNSAEFDVRYSSERSIEDELERESNSDVLTILISYLVMFAYVTITLGQYKSCNRLFIDAKVTLGLAGVVIVLIAVACSLGFWSYLGFPATLIIIEVVPFLVLAVGVDNIFILVQHYQR-DAAYAD---CVQARIARSVGSVGPSMLLSSLSESVAFFFGALTSMPAVRVFALYAGMAVLVDFLLQISCFVALLSLDARRQAAGRPDVLCCLLASKDEQAAQQQQQLPREILDSNPDSAQSNNNSGLLFQLFKRYISAVLFQSWVRPFVILLFTGWACLCLASVHNVRVGLDQELSMPEDSYVIDYFDGIKRYLSVGPPVYFVVRGPLDYSDPSQQNLVCSRAGCPQKSMVGQLSQMSEIPTYSYIVSPPSSWFDDYVDWLDPSGHPPCCRYHTAGSGGFCPATSSATDCVSCNVNFTSDGRPVQSEFYRYLDYFLMDNPGPACAKGGHAAYATAIA------RSNATGAVTASYYMTYHSVLRTGDDFINAYKMAIKMTDDINTYFEN-VTQSKEINVFPYSVFYVFYEQYLTIVHDTVVNLSICVAAIGVVTFILLGFDLFSTCIILLTIGLILNSMLGFMYFWDITLNAVSLVNLVMTVGISVEFCSHLVRAFAVSKETSRLARARDSFVHMGSSVFSGITLTKLGGIVILGFAKSQLFKIFYFRMYLGIVLFGALHGLVFLPVLLSYVGPAGSVGRLRKRRRYGLLEEA-EDSSGGE 1319          
BLAST of Niemann-Pick disease, type C1 vs. TrEMBL
Match: A0A210Q408 (Niemann-Pick C1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23882 PE=4 SV=1)

HSP 1 Score: 1014.99 bits (2623), Expect = 0.000e+0
Identity = 588/1318 (44.61%), Postives = 820/1318 (62.22%), Query Frame = 1
Query:  112 CIWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVD--TGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATS-NAPFQIN-YLNEVKG-----------MNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIV-ISIYIFIYLKKNKY-------------DKDYG-NG-------IVPATP----EVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIV-PKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTD---EFNLPIATYMDQIMECIKDP-TNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNN-------IKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVN--STCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQ---KKLLEKMPENNSWG 3888
            CIWY +C K+    + NC Y GP K L ++   + +   CP   K       CC+  Q+ T++  +     +   CP C  NF+ +YC LTC P Q + ++V   T     +++V Y ++++F  G++NSC NV + SAN  A++  CG T +KC P  + + +G+ ++ + PF+I+ Y+ +V             MN T+ PCN      +  ACSCQDC ASC   PP   P+   TILGID W FI    +  FF++  IS+     + +N +             D  Y  NG       +  A P    +  DIS  ++ G KVE++L   F RWG F AR   IVL++G+I+   L +GI   KVTT+PVELWSSPSS+ R  KDYFD +FGPFYRTEQ+II  P ++T  +      S ++  Y  +F+ + L  +  L   I N+    +  N   +LEDICF+PLSPD + C + S ++Y+Q +  ++D +V +   +FN+  A Y+D    CI  P T    T   + C    G PVFP++  GGF D K+Y  +TA VITF+VNN LD+       A  WEK F++ ++N+S  N  + I+Y++ERS++DEI+R+S +D+ TI +SY+IMF Y+++TLGQ N+       I ++ VDSK+ LGL  V IVL+SV  S+GF+S+L +P TLII EVVPFL LAVGVDN+FILVQ+YQR D    S++L  E +I R+V +VGPSMLLSSL+E++AFF G +T+MPAVK+FSLYA  AV  DFLLQIT  + ++ LDA+R E+ R D+ CCV+++   +          K  G L  +   +Y+  L K  VR +VVI F GW   + + IH + V L+QKLSMP DSY+++YF  L+ YL VGPPVYF+V++G++Y +   QN ICG +GC + SL GQ++ AS  PN + ++   +SWLDD+F W    G+P CCR +  +GSFCP++V +  S C  C  +      P  + F  +L +FL++NP   C KGGHAAYG AV      D  H    +GATYFMTYHTILK  +DY EALK++  IA ++T  +     N  Q++V PYS+FYVFYEQYLT++K     L +C+  + +V FVLLG D+ + L++   I +I+  MFGFMYLW I +NALS+VNLVMAIGISVEF AHI RA+ V    TR+ERAR+ L  MGSSVLSGITLTKLGGIIV+AFSKSQLFQ+FYFRMY+G+VIFGA+H +IFLPV LS+ GP LN+ K+ +Q   K  L+ + EN++ G
Sbjct:   28 CIWYDEC-KTTSTGVQNCAYNGPAKLLTDSAALKRIQHYCPGLYKGPNATETCCSPSQMYTIETNMGLPEQLLRRCPACYYNFLEIYCYLTCSPEQSDSISVKKYTDNNTVVESVNYVMSKDFAFGMYNSCKNVEMPSANELALNMFCGRTADKCTPYNWLQYMGETSNGHTPFEIDFYIQDVPWVSPSTNKSTVPMNSTITPCNKK--YQNQSACSCQDCEASCAPIPPIPAPAVEPTILGIDAWYFITGCCYLVFFIVFGISVMWHNIMTRNAFGIYTAEEQVKSVEDDHYQINGRRKKKKMMKKADPVPLIQQGDISCLERLGEKVESFLQRSFQRWGTFCARHPFIVLAIGVILGGGLCVGIPFLKVTTNPVELWSSPSSTVRTQKDYFDSHFGPFYRTEQLIITRPHNKTYVSHKLPPPSVQSTNYSNLFDKEFLHMLLDLQLQIQNINATYE--NRTIRLEDICFQPLSPDNKGCTIQSPLEYWQESHEKIDAVVWETIYKFNIK-ANYLDHAEYCISAPATTWDTTGLNQSCLSVSGQPVFPWIVMGGF-DGKDYQSATAFVITFVVNNHLDEALNGPAEA--WEKEFISFMKNYSSPN--MTIAYSSERSIEDEINRESNSDILTILISYLIMFLYISLTLGQLNHCYCLGERIDRLLVDSKILLGLAGVTIVLLSVGASIGFFSFLGIPATLIIAEVVPFLALAVGVDNIFILVQSYQR-DVRPPSESL--EDQIGRIVGRVGPSMLLSSLTETVAFFLGALTDMPAVKVFSLYAGMAVFIDFLLQITCFVGLMTLDARRQESHRYDMCCCVQLHEEKSE---------KSEGWLFRVVKDYYSHFLLKEWVRPIVVIVFTGWLSISFALIHKVDVGLDQKLSMPDDSYVLDYFTNLSEYLHVGPPVYFVVEEGHDYITMQGQNDICGGNGCPQDSLAGQVYTASLRPNYSRVAQPVSSWLDDYFSWLNSGGHPQCCRSFINNGSFCPSTVPDNVSLCEPCQLHGAINGHPVKEDFMKFLPWFLSDNPGTICAKGGHAAYGSAV------DLLHNKTGVGATYFMTYHTILKNSTDYIEALKHANSIAENITSLIGQ---NGKQYKVFPYSIFYVFYEQYLTMWKTTITNLSLCVIAIFIVAFVLLGFDFFSALMIVITITMIIIDMFGFMYLWDISLNALSLVNLVMAIGISVEFCAHITRAFAVSLLPTRVERARDALANMGSSVLSGITLTKLGGIIVMAFSKSQLFQVFYFRMYMGMVIFGASHGLIFLPVLLSYIGPPLNKAKLYKQQHAKNTLDHIQENDTAG 1313          
BLAST of Niemann-Pick disease, type C1 vs. TrEMBL
Match: K1PF48 (Niemann-Pick C1 protein OS=Crassostrea gigas OX=29159 GN=CGI_10006575 PE=4 SV=1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 571/1298 (43.99%), Postives = 822/1298 (63.33%), Query Frame = 1
Query:  121 YGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGG---------SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNA--PFQINY------LNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVIS-IYIFIYLKKNK---------YDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKD-----RTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFN--LPIATYMDQIMECIKDPTNIKPTKFKEI-CNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI-----VEQKKLLEKMPENNSWGN 3891
            YG+C +  P   LNC Y GPPKP+N + G + L   CP     D+ P  CC+  QL +    +     +   CP+C  NF+ L+C  TCDP Q +F+ V                + +V Y+++E +  G++NSC +V + S N+ A+D +CG     C    +   +G +TSN   PF INY        ++  MN ++ PC+   G  +  ACSCQDC+A+C   PPP  P +  T+LG+D W F + I F AF ++ +S I + ++  +N+          DK Y +    +       +   + G  +E  L + F RWG F A+  + ++  G+++  V S+GI++ +VTT PV+LWS+ +S AR+ K+YFD +FGPFYRT+Q+II   +     R     INY I  RN  Y  +F+   L +V  L   I N+E   K   +   LEDICF+PL+PD   C + S+++Y+QNN T+LD+I  D+++       Y+D   +C + P ++      ++ C G  G P+FP+++ GGF  +K Y +STALVITF+VNN +D+  KQ + A  WE  FL  ++NFS+   D+ I+Y+AERS++DEI R+S +D++TI +SYI+MF Y++ITLGQ+    +  V SK +LGLC V IVL+SV+ S+G +SY  +  TLII+EVVPFLVLAVGVDN+FILVQ +QR DE +  + L  E +I R++ KVGPSMLL+S SESLAFF G +T+MPAV++FSLY+A AVL DFL Q+TV +AV+ LDAKR E+ R+D+ CCV++                  GIL +IF  FY+  L    VR +V++ FVG+  F+ SQIH I + L+QKLSMP DSY++NYF  L+ YL VG PVYF+V+DG +Y ++  Q+++CG +GC E S++GQ+  A++  N TYI+   ++W+DD+F W +  G+PPCCR+Y   G+FC A+VVN++C  CP + TA  RP ++ F  +L ++L +NP ++C KGGHAAYG AVN+KN +        +GATYFMTYH+I+K   DY   LK + ++AA++T  L+   G  N  +V PYSVFYVFYEQYLT+ +     L +C+  + +VTFVLLG D  +  ++   I +I+  + G M LW I INA+++VNLVMA+GISVEF AHI RA+ V    TR++RA++ +  MGSSVLSGITLTKLGGIIVLAF+KSQLFQ+FYFRMYL IV++GA H +IFLPV LS+ GP +N+ K+      E+  + E+ P +N   N
Sbjct:    2 YGEC-QEGPTGNLNCVYDGPPKPMNESEGLEILRTYCPNIVTSDQ-PLTCCDLAQLRSFKKNMGVPQQLLLRCPSCYYNFLYLFCYFTCDPMQADFLKVSMKMPNIANPSDPREVVYSVDYHVSETYAYGMYNSCKDVQMPSTNAKALDIICGKPAADCSAQDWLNYMG-STSNGQTPFAINYHIDNTSTVDIHPMNHSVTPCDQKYG--NLSACSCQDCQATCAPLPPPPSPREPCTVLGMDCWFFAMLITFIAFCVVFLSFIIVSMFFNRNRPAKTENKWSQDKKYKDS--SSLEGKHRGTVLQRGGLWIETSLEMVFRRWGTFCAKNPVKIIVAGLVLGAVFSVGIVMFEVTTSPVKLWSAENSRARQEKNYFDSHFGPFYRTQQLIITRPENASGVRHEVPGINYGI-YRN--YTSIFDKSFLHKVLDLQLTIQNLEADHK--GSKVALEDICFQPLAPDNTDCTIQSILEYWQNNHTRLDKIKYDDYSGFYVEGDYLDHFSDCARAPASVSDQHHMDLSCLGASGQPIFPWISLGGFTGEK-YNESTALVITFVVNNHVDE--KQNEKARAWELEFLRFMKNFSDP--DMIIAYSAERSIEDEIQRESASDVWTIVISYIVMFGYISITLGQFGRCSRCVVSSKTSLGLCGVCIVLLSVSSSLGLFSYCGIAATLIIIEVVPFLVLAVGVDNIFILVQAFQR-DEGHPDEEL--EDRIGRLLGKVGPSMLLASCSESLAFFLGALTDMPAVRVFSLYSAMAVLLDFLFQVTVFVAVMTLDAKREESNRLDICCCVKLEK--------SKKNEASEGILFKIFKNFYSEALLSKFVRPVVMVLFVGYLCFSASQIHKIEIGLDQKLSMPDDSYVLNYFGNLSEYLHVGAPVYFVVEDGLDYTTKVGQDVVCGGTGCPEDSVVGQISTAAKQANYTYIAHPTSAWIDDYFDWLRPGGDPPCCRVYNQAGNFCTATVVNASCATCPVHKTADSRPVSQDFMKFLPWYLKDNPGIKCAKGGHAAYGSAVNLKNNNKA------VGATYFMTYHSIMKDNKDYITGLKEARKVAANMTNMLRLKTGG-NSTKVFPYSVFYVFYEQYLTIVEDTIKNLSICIAAIFVVTFVLLGFDIISAFLVVLTITMIVIDILGLMALWDISINAVTLVNLVMAVGISVEFCAHITRAFAVSHQTTRVKRAKDAVAHMGSSVLSGITLTKLGGIIVLAFAKSQLFQVFYFRMYLAIVVYGATHGLIFLPVLLSYIGPPVNKVKLDFIESSEEGNVHEQRPHSNGHTN 1264          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Cavefish
Match: npc1 (Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB-GENE-030131-3161])

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 516/1253 (41.18%), Postives = 752/1253 (60.02%), Query Frame = 1
Query:  145 PNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGG-----SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATS-NAPFQINYLNEVKGMNQTMLPCNMNG---GEDDGEA-CSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAF-FMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFT-WINYDI-SARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNCPA-NFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVV-PYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK 3852
            P K  NCNYTGPP PL    G   L +LCP  A    N S+CC+T QL TL   +         CP C  NF+ L+C LTC P+Q  F+   T +       ++  ++Y +N+ F   ++N+C +V   S+N  A+  +CGT  + C P  +   + +  +   PF IN +        T++  +  G     DDG   CSCQDC  +C   P P      +TILG+D    I+ + + +F F+ ++++      +K     +YG        + +  +  +  G + E  L + F  WG F  R  L+V+   ++     S G+   +VTTDPVELWS+P S AR+ KDYFD++FGPF+RTEQ+II     TP+T W  ++  S  N+ + P+FNI LL ++  L   I N+   +        L+DIC  PL+P    C ++SV+ YFQN+   L+   +D F +    Y    M C  +P  +   + F + C G FGGPVFP+L  GG+   + Y ++TALV+T  V N L+   K+ KA L WEK F++ ++N+S  N +L I++++ERS++DEIDR+S +D+ TI +SY+IMF YV++ LG  ++ + + VDSK++LG+  +LIVL SV  S+G +SY  VP+TLI++EV+PFLVLAVGVDN+FI+VQT+QR DE    + L   Q+I R++  V PSMLLSS SE+LAFF G ++ MPAVK FS +A  A++ DF+LQI+  +++L LD KR E  R+D+LCCV++           V + K  GIL   F K YAP +    VR LVV  FVG   F+++ I  + + L+Q+LSMP DSY+++YF  L                                 GCN  SL+ Q++ AS   + + IST+ +SWLDD+F W K   +  CCR Y + G+FC ASVV+ +C +C A   + K RP+   F  +L  FL++NP+++C KGGHAAY  AV +K+ D        +GATYFM+YHTIL   S   +++K + E+A +++     ++G++N+ ++V PYSVFYVFYEQYLT+     + LGV L  +L V+ VLLG +  + +++   I +I+ +MFG M+LWGI +NA+S+VNLVM+ GISVEF +HIVRA+ V    TR+ERA+E L  MGSSV SGITLTK GGI++LA SKSQ+FQ+FYFRMYL IV+ GA H +IFLPV LS+ GP++N+ K +  ++
Sbjct:    4 PEKKYNCNYTGPPIPLPE-DGQVLLKELCPGLAY--GNQSVCCDTKQLSTLKGNVQLPLQFLSRCPACFYNFMTLFCELTCSPHQSLFLNA-TSFSQDHNMTNVVELSYYINQTFADAMYNACKDVQAPSSNMPALSLLCGTDPKDCTPTKWISYMFNINNKQVPFAINPIFAGPPAGMTLMNNDTFGCTESLDDGSGPCSCQDCSKACGPKPIPPPVRPPWTILGLDAMTVIMWVSYVSFLFVFIVALLGAWCYRKRTITSEYG------PIQGNQATCCESVGERFENSLRVCFSLWGSFCVRHPLLVILFSLVFVGGCSSGLARMRVTTDPVELWSAPHSQARQEKDYFDQHFGPFFRTEQLIIT----TPWTDWFIFETTSGPNIPFAPIFNISLLHQILDLQTDIENL--VADYNGENVTLQDICISPLAPYNNNCTILSVLNYFQNDPDVLNHTNSDPFYIYF-DYHTHFMYCASNPVALDDMSTFHDPCMGTFGGPVFPWLVLGGY---EAYNNATALVLTLPVANYLNNTEKRGKA-LAWEKEFISFMKNYS--NPNLTIAFSSERSIEDEIDRESNSDISTILVSYVIMFIYVSLALGHIHSFQTLLVDSKISLGIAGILIVLSSVISSLGIFSYAGVPLTLIVIEVIPFLVLAVGVDNIFIIVQTFQR-DERLQHEEL--HQQIGRILGDVAPSMLLSSFSEALAFFLGSLSHMPAVKTFSFFAGLAIIIDFILQISCFVSLLGLDIKRQERNRLDILCCVKLPE---------VQQEKTEGILFRFFKKIYAPFILNEWVRPLVVAVFVGMVSFSIAVIDKVEIGLDQRLSMPDDSYVLDYFGNLM--------------------------------GCNNDSLVQQIYTASLMSDYSKISTTPSSWLDDYFDWVKPQSS--CCRYYNNTGAFCNASVVDPSCVHCRAMTPSGKQRPNGTDFMKFLPMFLSDNPNIKCGKGGHAAYSTAVVLKDND------TNVGATYFMSYHTILTNSSVSIDSMKMARELAHNIS----VSMGSTNKTDIVFPYSVFYVFYEQYLTIVHDTALNLGVSLVAILTVSTVLLGFELWSAMLVTLTIAMILINMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHIVRAFSVSTKGTRVERAQEALAHMGSSVFSGITLTKFGGILILALSKSQIFQVFYFRMYLAIVLLGATHGLIFLPVLLSYIGPSVNKAKAMAARR 1177          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Cavefish
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:NCBI gene;Acc:103040688])

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 489/1309 (37.36%), Postives = 726/1309 (55.46%), Query Frame = 1
Query:  112 CIWYGQCDKSNP-------NKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFV----TVDTGYGGS----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINY--------LNEVKGM---NQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMI--VISIYIFIYLKKNKYDKDYGNGIVPATPEV----DDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSP---DYEKCAVMSVMQYFQNNITQLDRI-------VTDEFNLPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNF-SETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDG----SFCPASVVNSTC-NNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVE-QKKLLEKMPENN 3879
            C  Y +C  +NP       N  + C   G  + +     ++ L ++CP   + +     CC+  QL++L   L+ +  +   CP+C  NF  ++C  TC PNQ   +    T+     G+    + A    ++ +F    F SC NV + +   +AI T+CG    K C    +    GD+++  AP  I++         +   GM      +L CN       G+ CSCQDC  SCP  PPP  P   F I  +DG + I  I+F    ++  V  I I    KK+K  KD     V  T  +     +I+  DK     + +L   F  WG  +AR  L V+   + +    S G++  ++TTDPV+LWS+P+S ARR KD+ D NF PF+RT Q+I+    R  + + +      N  +  + + DL+ ++  L   I  +E +S+ LN    L+D+C+ PL+P       CAV S+ QYFQN++  L+         VT E +     + D  + C+  P + +  T     C  D+GGPVFP+LA GG+ D+ ++T++ A ++TF +NN    + K  K    WE  FL +V+++ ++ NT+   +Y AERS++DEI+R +  D     +SY ++F Y+ I LG+Y + K+I VDSK+ +GL  +LIV  SV  S+GF+ ++ +P +LII++VVPFLVLAVG DN+FI V  YQR DE  S +  T E++I RV+  V PSMLL SLSES+ FF G ++ MPAVK F+LYAA +VL DFLLQ+T  +A+L LDA+R +A R DV CCVR+ N        P       G L  +  K+YAP L     R +V++ F+     ++  +  + V L+Q+LSMP DSYM+ YF+ L  Y  VG P YF+   G+N+ S    N +C + GC++ SL  ++  A++ P  +Y++   +SW+DDF  W        CCR+Y  G     FCPAS     C   C P       RP+   F+ +L  FL N P +QCPKGG  AY  AV   N         EI A+ FM YHT LK   +YT ALK + E+A ++T  ++   G    FEV PY+V YVFYEQYL++  +  + + +CL    +V  +LLG+D  + L+    I++I     G M LWGI  NA+S++NLV A+GISVEF++H+ R++ +    TR+ERA++   +MGS+V +G+ +T L GIIVLAF+K+QL QIF+FR+ L I + G AH +IFLPVFLS+ GP LN+  ++E QKK  ++M   N
Sbjct:   33 CSMYDECG-TNPTVSGSLLNSSVPCKNYGAARQVV-GEHYKLLKQVCPMLDRGEGQTFACCSVQQLMSLQSSLTLSKAVLLRCPSCAYNFAHVHCVTTCSPNQSQTINITRTIPVNISGTEKEAVVAYQTYISTDFSDASFRSCKNVRIPATGGFAIATMCGRYGAKLCTAQRWLDFQGDSSNGLAPLDIDFRLIPPEQSADVPAGMVAYAGMVLGCN-ETTPTGGKECSCQDCEDSCPPVPPPGPPPGPFMIRDVDGVLVICSILFFFILLMFLVYLIAICCDGKKSKRRKDKNANEVDHTLNLTVHPSEITCTDKASLATQEFLGSMFQSWGTVMARHPLKVIFASVFVVAAFSTGMMNMELTTDPVQLWSAPNSRARREKDFHDANFAPFFRTNQLILTAPGRPSYIYDSILFGRTN--FSGLISKDLILQLLELQQKIQAIEFWSEELNKTASLKDVCYAPLNPTNPSLTDCAVNSLPQYFQNSVENLNAKANMTELGVTKEVD-----WRDHFIYCVNSPLSFQDITALDMSCMSDYGGPVFPFLAVGGYEDE-DFTNAEAFILTFSLNNYARDDPK-FKVVEKWESMFLEIVKDYQNDPNTNFTFAYMAERSLEDEINRTTVEDFPIFMISYGVIFLYIAIALGEYTSFKRILVDSKIVVGLGGILIVGCSVLTSMGFYGWVGIPSSLIIVQVVPFLVLAVGADNIFIFVLEYQR-DERRSGE--TREEQIGRVLGSVAPSMLLCSLSESVCFFLGALSTMPAVKTFALYAALSVLIDFLLQMTAFVALLSLDARRQDANRYDVACCVRVKN--------PPPSKPNQGFLFPLMKKYYAPALLCGFSRIVVMVVFLFMFCASIFLMCHVKVGLDQELSMPTDSYMLRYFEYLNKYFEVGVPTYFVTTKGFNFSSLAGMNAVCSSVGCDQFSLTQKIQYATEYPERSYMAIPASSWVDDFIDWLNPGSR--CCRIYTSGPNTGKFCPASESAFLCLRRCMPLTEDGVVRPNETEFNTFLPSFLGNRPDLQCPKGGLGAYDTAVVADNVTG------EIVASRFMAYHTPLKNSQEYTTALKIARELAHNITMAMRDMNGTDPDFEVFPYTVTYVFYEQYLSIVYEGLVNIALCLLPTFIVCCILLGMDLLSGLLNLLTIVMITVDTVGVMTLWGIDYNAVSLINLVTAVGISVEFVSHMTRSFALSTLPTRVERAKDATAKMGSAVFAGVAMTNLPGIIVLAFAKAQLIQIFFFRLNLVITLLGMAHGLIFLPVFLSYFGPPLNKAVLLEAQKKKAQEMESRN 1310          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Cavefish
Match: ENSAMXT00000012643.2 (patched domain-containing protein 3 [Source:NCBI gene;Acc:103027938])

HSP 1 Score: 162.54 bits (410), Expect = 2.981e-40
Identity = 179/707 (25.32%), Postives = 320/707 (45.26%), Query Frame = 1
Query: 1741 DWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKY-----------------SGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYL-SVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSF 3807
             W   F+ ++ N + + T   +SY    S Q E ++ +++     A++Y I   +  ++  +++N++     +KV L    V+   ++V  S G    LNVP  + +    PFL+L +G+D++FI++  +Q+ + + S      E ++A    +   S+ +++L++ LAF+    +   +V+ F LYA TA+LF +L  IT   A L L+ KR    R   L C+++     P D  P A   Y                   ++   F K+Y P L     +  V++ ++G+   ++     I   ++ K      SY++ Y++A   Y  + GP V   V   + Y  E  ++++     C E+      F A     +T+IS    SWL  F  ++KQ                              N T +       F ++L  FL  +P+++            V++ N+         I A+ F      LKT    +E +         + + L+ T  +     +V Y   +++Y+QY TV     IQ      VV+L   ++L  +    L + F I  ++  + GFM L GI ++++SM+NLV++IG SV+F AHI   +V     +  E+  + L  +G  +L G  L+ + G++VL+ S S +F+ F+  M+L ++ FG  H I F+PVFLSF
Sbjct:  225 SWLNKFVELMTNVTTSIT--QVSYFTSISRQQEFEKSTKSVTHLFAITYFIAILFSVLSCVRFDNVR-----NKVWLACLGVISAGLAVLSSFGLLLLLNVPFAITVASS-PFLILGIGIDDMFIMISCWQQTNVHDS-----VEDRLAATYKEAAISITITTLTDVLAFYLSFSSPFGSVQSFCLYAGTAILFCYLYNITFFGACLALNGKREGGNR-HWLTCMKV-----PEDCPPEASRGYIACCVGGSYDHKTGAEEEHLMQGFFRKYYGPFLTTVWAKAAVIVLYIGYISVSVYGCTTIKEGIDLKNLAIDQSYLVQYYEAEKEYFHNYGPIVMLAVNGSFPYWDEAKRDLL---ESCIEE------FKA-----LTFISDLSVSWLHSFERYAKQEN---------------------------LNITTEAE-----FKNHLQTFLQRHPTLRLD----------VSLANES--------IQASRFF-----LKTSKPPSEKI---------MLQSLRETAQSCEVQPLVVYHPAFIYYDQY-TVIASNTIQTVSVATVVMLAISLILIPNPVCALWVAFAIASVIVGVAGFMALLGINLDSISMINLVISIGFSVDFSAHISYTFVSSTKASVDEKVVDALSNLGYPILQG-ALSTILGVVVLSVSVSYIFRTFFTIMFL-VISFGLLHGIAFIPVFLSF 831          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Cavefish
Match: ENSAMXT00000001333.2 (patched domain-containing protein 3-like [Source:NCBI gene;Acc:103042169])

HSP 1 Score: 146.362 bits (368), Expect = 4.773e-35
Identity = 180/741 (24.29%), Postives = 324/741 (43.72%), Query Frame = 1
Query: 1744 WEKAFLNVV-QNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLC------CVRMNNVVTPVDAVPVAKVKYSGI-----LHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGSFCPASVVNSTCNNCP-------ANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVF---YVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSF---CGPALNRKKIVEQKKLLEKMPENNSWGN 3891
            W   FL V   N S     +  S +  R V+ E + +    LF+I  +Y+I   +  ++  +++ ++     +KV +    VL   ++V  S G   ++ VP  + +    PFL+L +GVD++FIL+  +Q+     ++ +   E ++A    +   S+ +++L++ LAF+ G+MT   +V+ F LY +T++LF ++  IT   A L+L+ +R    +  + C      C    +    +  V  A   ++G      ++  F K+Y P L K+  +  V++                              YM+        YL+V     F +K+G + ++  + +        +EK+     + +   PN+  I  S  S+ D+       S    C   + + SF    +  S   +          N +A+H     VF D L  FL            ++ + Q VN  N          I A+ F      + T  D    L                 L ++ Q   VP  V+   +++++QY  +     IQ       V+L+  +LL  +   +L + F I  ++  + GFM LW + ++ +SM+ LV+ IG SV+F AHI  ++V  +  +  E+A + L  +G  +L G   T L G++VL+ SK+ +F+ F+  M+L ++ FG  H I F+PVFL+F   C    +  K+ + K+ LE     NS GN
Sbjct:  218 WLNEFLKVFPSNLSTKFIKVTYSTSLSRQVEFEANTKDVIPLFSI--TYVIAIAFSILSCLRFDCVR-----NKVWVATFGVLSAGLAVLSSFGMMLHIGVPFVMTVANS-PFLILGIGVDDMFILISCWQQ-----TNVHDQVEDRLANTYKEAAISITITTLTDVLAFYIGLMTPFRSVQSFCLYTSTSILFCYIYSITFFGAFLVLNGRRENRNQHWLTCKEVPEECPTDQSKWHELCCVGGAYDLHTGSEEVQPMNHFFKKYYGPFLTKSWTKVFVILL-----------------------------YML--------YLTVSIYGCFQIKEGIDLRNLAADDSYVVRYYDDEKA-----YFSEYGPNIMVIVRSEFSYWDE----KNMSDLESCVEDFKNLSFIEKDIFTSWIKSYKYYGYHKNLNLSAEH-----VFKDNLGTFLR----------FYSDFRQDVNFTNN--------SIYASRFFIQTVNISTALDEMNMLNK---------------LRDTAQRCPVPLLVYHPAFIYHDQYAVIVSNT-IQNIAVTTAVMLLISLLLIPNPLCSLWVTFSIASVIVGVTGFMALWDVNLDTISMIILVVCIGFSVDFSAHISYSFVSSKKLSANEKAVDALFSLGYPILQGAVSTIL-GVVVLSASKNYIFRTFFKIMFL-VIFFGLFHGITFIPVFLTFFDMCSGMYD--KVNKDKQGLEDQATGNSHGN 856          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Cavefish
Match: ENSAMXT00000043761.1 (patched domain-containing protein 3-like [Source:NCBI gene;Acc:103042169])

HSP 1 Score: 146.362 bits (368), Expect = 5.242e-35
Identity = 180/741 (24.29%), Postives = 324/741 (43.72%), Query Frame = 1
Query: 1744 WEKAFLNVV-QNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLC------CVRMNNVVTPVDAVPVAKVKYSGI-----LHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGSFCPASVVNSTCNNCP-------ANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVF---YVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSF---CGPALNRKKIVEQKKLLEKMPENNSWGN 3891
            W   FL V   N S     +  S +  R V+ E + +    LF+I  +Y+I   +  ++  +++ ++     +KV +    VL   ++V  S G   ++ VP  + +    PFL+L +GVD++FIL+  +Q+     ++ +   E ++A    +   S+ +++L++ LAF+ G+MT   +V+ F LY +T++LF ++  IT   A L+L+ +R    +  + C      C    +    +  V  A   ++G      ++  F K+Y P L K+  +  V++                              YM+        YL+V     F +K+G + ++  + +        +EK+     + +   PN+  I  S  S+ D+       S    C   + + SF    +  S   +          N +A+H     VF D L  FL            ++ + Q VN  N          I A+ F      + T  D    L                 L ++ Q   VP  V+   +++++QY  +     IQ       V+L+  +LL  +   +L + F I  ++  + GFM LW + ++ +SM+ LV+ IG SV+F AHI  ++V  +  +  E+A + L  +G  +L G   T L G++VL+ SK+ +F+ F+  M+L ++ FG  H I F+PVFL+F   C    +  K+ + K+ LE     NS GN
Sbjct:  222 WLNEFLKVFPSNLSTKFIKVTYSTSLSRQVEFEANTKDVIPLFSI--TYVIAIAFSILSCLRFDCVR-----NKVWVATFGVLSAGLAVLSSFGMMLHIGVPFVMTVANS-PFLILGIGVDDMFILISCWQQ-----TNVHDQVEDRLANTYKEAAISITITTLTDVLAFYIGLMTPFRSVQSFCLYTSTSILFCYIYSITFFGAFLVLNGRRENRNQHWLTCKEVPEECPTDQSKWHELCCVGGAYDLHTGSEEVQPMNHFFKKYYGPFLTKSWTKVFVILL-----------------------------YML--------YLTVSIYGCFQIKEGIDLRNLAADDSYVVRYYDDEKA-----YFSEYGPNIMVIVRSEFSYWDE----KNMSDLESCVEDFKNLSFIEKDIFTSWIKSYKYYGYHKNLNLSAEH-----VFKDNLGTFLR----------FYSDFRQDVNFTNN--------SIYASRFFIQTVNISTALDEMNMLNK---------------LRDTAQRCPVPLLVYHPAFIYHDQYAVIVSNT-IQNIAVTTAVMLLISLLLIPNPLCSLWVTFSIASVIVGVTGFMALWDVNLDTISMIILVVCIGFSVDFSAHISYSFVSSKKLSANEKAVDALFSLGYPILQGAVSTIL-GVVVLSASKNYIFRTFFKIMFL-VIFFGLFHGITFIPVFLTFFDMCSGMYD--KVNKDKQGLEDQATGNSHGN 860          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Sea Lamprey
Match: npc1 (Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB-GENE-030131-3161])

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 552/1285 (42.96%), Postives = 782/1285 (60.86%), Query Frame = 1
Query:  112 CIWYGQCDKSNPN--KILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV-DTGY----GGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNA--PFQINYL------NEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPA---------TPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTK--LEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIK-PTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMA--IGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKI---VEQKKLLEK 3864
            C+WYG+C   NP   K  NC Y G  KPL +  G++ L +LCP  + +  N S CCN  QL TL   ++        CP+C  N +  YC LTC  NQ  F+ V  T Y    G SI  + Y +++ F  G+FNSC +V   S+N  A+  +CG   + C+   + + +  +TSN   PFQI+ +      + +  MN   L CN +  +D G  CSCQDC   C   P P      +TI G+D  V I+ + + +F  I +SI + ++    K+       + PA           +   +S F++ G + E+ L   F RWG       L VL   +++  V S G+ L  +TTDPVELWS+PSS ARR KDYFD  FGPF+RTEQ+II   D    T+  Y  S   + +GP   +D+L +V  L   +  MEV     +N TK  L+DIC  PL+P    C ++SV+ YFQN+  QL+R V D+F +  A Y    + C++ PT++   T   + C G FGGPVFP+LA GG+ D  NY ++TALVITF V N    NS+++ A L WE+ F+++V+N++  N +L I Y+AERS++DEI+R+S  D+ T+ +SY +MF Y+++ LG   +I  + VDSK++L +  + IVL SV+ S+G +SY  +P+TLI++EV+PFLVLAVGVDN+FILVQ YQR +     K     ++I R++  + PSMLL+S SE+LAFF G +++MPAV+ FSL+A  AVL DFLLQ+T  ++++ LDA+R E    D++CC++         +VP       G+L   F   +AP+L    VR +V+  FV    F+++ ++ I + L+Q+LSMP DSY++ YF AL  +L  GPPVYF+V+DG++Y +   QN+ICG  GCN  SL+ QL++A+Q PN T I  + +SW+DD+F W K   +  CCR++   G FC AS+    C  C P     K RP    F  +L  FL++NPSM C KGGHAAYG AV++    + SH    +GATYFM+YHTIL    D+  AL+N+  IA ++T  L  TL   +++ V  YSVFYVFYEQYLT+       L + LG V LV+ +LLGL+  + L L   I +I+  M G M+LWGI +NA+S+VNLVM   +GISVEF +HIVRA+ V    TR  RA+E L  MGSSV SGIT+TK GGI+VLAFSKSQ+F+IFYFRMYL +V+ GAAH +IFLPV LS+ G  +N+ K+   +E++K  E+
Sbjct:   26 CVWYGECGL-NPQTQKAYNCFYNGTAKPLPHE-GYELLKELCP--SMVQENVSTCCNVKQLRTLKENMALPLQFLSRCPSCFYNLMTFYCELTCSVNQSTFLNVTQTEYSNTTGTSITRLQYYISKTFANGMFNSCKDVTSPSSNDKALGLLCGRDAKDCNATNWIEYMC-STSNGQTPFQIDPVFTDAPEDPMVPMNVATLGCNKSVDDDTGP-CSCQDCALMCGPKPQPPPTPPPWTIFGLDAMVVIMVLSYMSFLWIFLSIVVCMFCYYRKFFT-----VTPAHMVYSFSNNAGDTQSVSLFERLGERFESSLREGFARWGATCVLHPLPVLLCSLVLVAVCSAGLALMTITTDPVELWSAPSSQARREKDYFDSKFGPFFRTEQLIIQAIDMNSSTYSPYP-SGNAVPFGPPLGLDILFQVLDLQTAVEMMEV----PHNGTKVTLKDICLAPLAPTNNNCTIISVLNYFQNSYKQLNRTVGDDFFV-WADYHSHFLYCVRAPTSVNDTTPLHDPCLGTFGGPVFPWLALGGY-DGDNYNNATALVITFPVVN-YHNNSEKMAAILAWEQGFIDLVKNYN--NPNLSIVYSAERSIEDEINRESTGDVRTVLISYAVMFVYISLALGHIRSIFTLAVDSKISLAMAGIAIVLCSVSSSLGIFSYAGIPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERRAEEK---AHEQIGRILGDIAPSMLLTSTSETLAFFLGALSDMPAVRTFSLFAGMAVLIDFLLQVTCFVSLMGLDARRQEEGHFDIVCCLK--------TSVPPPDESQHGLLFRFFKNLFAPVLLSECVRPVVMSVFVAALAFSVAVVNKIEIGLDQRLSMPDDSYVLTYFTALNRFLHSGPPVYFVVEDGHDYLTLEGQNVICGGVGCNNNSLVEQLYLAAQLPNYTRIGYAPSSWIDDYFDWVKPQSS--CCRVFNSTGDFCNASLPGPDCVPCRPLTREGKQRPLGDNFTHFLPMFLSDNPSMYCAKGGHAAYGSAVSV----NGSH----VGATYFMSYHTILTESGDFIAALRNARTIATNITAALGPTL---SKYRVFAYSVFYVFYEQYLTIVNDTVFNLSLSLGAVFLVSILLLGLEVWSALTLTLTIAMILTDMLGVMWLWGISLNAVSLVNLVMTCCVGISVEFCSHIVRAFSVSTQPTRALRAKEALAHMGSSVFSGITVTKFGGIVVLAFSKSQIFKIFYFRMYLSMVLLGAAHGLIFLPVLLSYVGAPVNKAKVLAALERRKGTER 1265          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Sea Lamprey
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:HGNC Symbol;Acc:HGNC:7898])

HSP 1 Score: 330.102 bits (845), Expect = 2.443e-98
Identity = 226/678 (33.33%), Postives = 349/678 (51.47%), Query Frame = 1
Query:  202 TGF--QTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGSIQAV------TYNL--NENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINY---------LNEVKGMNQ---TMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEK---CAVMSVMQYFQNNITQLDRIVT---DEFNLPIATYMDQIMEC-IKDPTNIKPTKFKEI-CNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNT-DLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQR 2136
            +GF  + L  LCP   K + N + CC  DQL++L   +  +  I   CP+C+ NF  L+C   C P+Q  +V V   +   +  V       +N        +  F SC +V + +   +AID +CG      C    +    GD ++  AP  I +           E +GM Q   T   C     E DG ACSCQDC  +CP+ PPP  P   +    +D  + I  +VF    ++        +L            +     +     T +      +  L   F RWG+ VA   + V+   +++   LS+G++  ++TTDPVELWSSPSS AR+ K++ D NFGPF+RT Q+I+  K      + +     +N  +     ++LL  +  L   + ++EV   +      L+DICF PLSP+  K   CAV S++QYFQNN T+L        D   +  A + D  M C  + P + K     E+ C  D+G PVFP+LA GG+ D++ +T+S AL++TF  NN   ++  + +  L WE  F+  V  + +  T +  + + AERS++DEI+R +  DL   A+SY ++F Y+ + LG+Y++ K++ +DSKVTLGL  + +VL SV  ++G ++Y  VP +L+ILEVVPFL+LAVG DN+FI V   +R
Sbjct:   39 SGFALELLRDLCPMLYKGEGNTTACCGNDQLVSLKNSMDLSVPILARCPSCLYNFRLLHCTNICSPDQSLYVNVTRTFETVVDGVNKTGVLAFNCLYTRRLAEEAFESCQSVAIPATGGFAIDAMCGVFGSTLCTAQRWLDFQGDISNGLAPIDIVFDLIPDGETAPQESQGMRQFNDTTFKCT-EAVEVDGPACSCQDCVKACPSVPPPPDPPGPWMFGRLDAPLAIGLVVFAGLTLLFTVFAALSHL------------LGRGRSKGGGGGTSESWARTRQGLLAAAFRRWGVLVAHNPIPVIIASVVVVAALSVGLVFIELTTDPVELWSSPSSRARQEKEFHDANFGPFFRTNQLILRSKGGKGSLYKSVLFGTQN--FSSTLQLNLLLELLELQTQLQDIEV--DVNGTAVSLKDICFAPLSPEQPKDTDCAVNSLLQYFQNNRTRLLATAEQKGDGGQMGTADWHDHFMYCSFRSPLSFKDVTALELSCMADYGAPVFPFLAVGGYHDER-FTESEALILTFSTNN-FARDHPKFEFVLAWEAEFIRRVHKYKDDPTSNFTVVFMAERSLEDEINRTTAEDLPIFAISYAVIFAYIALALGEYSSWKRVLIDSKVTLGLGGIFVVLASVAAAMGVFAYAGVPSSLVILEVVPFLILAVGADNIFIFVLELRR 697          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Sea Lamprey
Match: scap (SREBF chaperone [Source:ZFIN;Acc:ZDB-GENE-040107-41])

HSP 1 Score: 68.9366 bits (167), Expect = 8.662e-12
Identity = 58/204 (28.43%), Postives = 100/204 (49.02%), Query Frame = 1
Query: 1777 FSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIP-VDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSE 2385
            +  TN  L          Q+E+      +L  +  +YII+F Y+      Y + +KI  V SK  L L AV  V+ S+  SVG  +   +  TL   E+ P+LVL +G++N+ +L ++        +  +   + +IA+ +S  G S++ +  +E      G  T +PA++ F L+A   ++ DF LQ+     VL +D +R E
Sbjct:  263 YPATNASLREDSMVHVHFQEEV---GVAELVPLVTTYIILFAYI------YFSTRKIDLVKSKWGLALAAVATVISSLLISVGLCTLFGLTPTLNGGEIFPYLVLVIGLENILVLTKSV-----VSTPVDQDVKFRIAQGLSNEGWSIVKNMATELFIVLIGYFTMVPAIQEFCLFALVGIVSDFFLQMFFFTTVLAIDIRRME 452          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Yeast
Match: NCR1 (Vacuolar membrane protein; transits through the biosynthetic vacuolar protein sorting pathway, involved in sphingolipid metabolism; cells lacking Ncr1p exhibit high levels of long chain bases (LCB), similar to the accumulation of high amounts of lipids observed in patients with Neimann-Pick C, a disease caused by loss-of-function mutations in NPC1, the functional ortholog of Ncr1p [Source:SGD;Acc:S000005927])

HSP 1 Score: 431.795 bits (1109), Expect = 6.847e-131
Identity = 359/1247 (28.79%), Postives = 586/1247 (46.99%), Query Frame = 1
Query:  112 CIWYGQCDKSNP-NKILNCN--YTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS-----IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDAT---SNAPFQINYLNEVKGMNQTMLPCN--MNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDY--GNGIVPATPEVDDIST-----FDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVT--TDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGT-SGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPD-GSFCPASVVNSTCNNC----PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEM---GSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVI 3759
            C  YG C K +     L C    +  P  L++ T  + L ++C +  K  R    CC  DQ++ L   L  A  +   CP C++NF  L+C  TC  +Q  FV +            +  +   +N ++    ++SC N+  S+ N YA+D + G          F K LGDA      +PFQINY  ++    +     N  +   +D    C+C DC+ SCP   P +        L       ++     A F      +++ YL K K +      + IVP +  +D+  T     F+         L   F + G F       +L   +    V S  II +  T  TDP+ LW S +S   + K+YFD+NFGPFYRTEQI +V +                   GPV + + L     + N I+  E+ S     Y   +D+CF+P   +   C + S  QYFQ  +   D            ++  ++ EC K P N  PT         F  P+   L F       +  ++ A V+T ++ N         ++A  WE+     + +  +    L IS+  E S++ E++  +  D+ T+A+SY++MF Y T  L + +        +++ LG+  +LIVL S+ C+ GF +   +  TLII EV+PFL+LA+G+DN+F++   Y R  E       + +QKI   + ++ PS+L+S L ++  F       MPAV  F++Y+  +V+F+ +LQ+T  +++L L  KRS   ++         N  T                      FY  ML +   + L++I F  W   +L  +  I   L+Q L++P+DSY+++YF  + ++L+VGPPVY +VK+    K +N Q  ICG  + C   SL   L    Q  + + I+   A+WLDD+F++     N  CCRL       CP S  +  C  C      N+     P+ K F +YL+ ++ N PS  CP GG A Y  A+         +    + A+ F T H  L++  D+ +A  + + I++S  E            ++  YS FY+F+ QY T+   L ++L     +++     +   + +++ +L   + +I+  +   M L GI +NA+S+VNL++ +G+ VEF  HIVR++ V  S+T+ +    VL  +   G SV+ GITLTK  G+ VLAF++S++F +FYFRM+  ++I
Sbjct:   23 CAMYGNCGKKSVFGNELPCPVPRSFEPPVLSDETS-KLLVEVCGEEWKEVRYA--CCTKDQVVALRDNLQKAQPLISSCPACLKNFNNLFCHFTCAADQGRFVNITKVEKSKEDKDIVAELDVFMNSSWASEFYDSCKNIKFSATNGYAMDLIGGGAKNYSQ---FLKFLGDAKPMLGGSPFQINYKYDLANEEKEWQEFNDEVYACDDAQYKCACSDCQESCPHLKPLKDGVCKVGPLPCFSLSVLIFYTICALFA-----FMWYYLCKRKKNGAMIVDDDIVPESGSLDESETNVFESFNNETNFFNGKLANLFTKVGQFSVENPYKILITTVFSIFVFSF-IIFQYATLETDPINLWVSKNSEKFKEKEYFDDNFGPFYRTEQIFVVNET------------------GPVLSYETLHWWFDVENFITE-ELQSSENIGY---QDLCFRP--TEDSTCVIESFTQYFQGALPNKD------------SWKRELQECGKFPVNCLPT---------FQQPLKTNLLFS----DDDILNAHAFVVTLLLTN-------HTQSANRWEERLEEYLLDL-KVPEGLRISFNTEISLEKELNNNN--DISTVAISYLMMFLYATWALRRKDG------KTRLLLGISGLLIVLASIVCAAGFLTLFGLKSTLIIAEVIPFLILAIGIDNIFLITHEYDRNCE--QKPEYSIDQKIISAIGRMSPSILMSLLCQTGCFLIAAFVTMPAVHNFAIYSTVSVIFNGVLQLTAYVSILSLYEKRSNYKQI-------TGNEETK---------------ESFLKTFYFKMLTQ---KRLIIIIFSAWFFTSLVFLPEIQFGLDQTLAVPQDSYLVDYFKDVYSFLNVGPPVYMVVKNLDLTKRQNQQK-ICGKFTTCERDSLANVL---EQERHRSTITEPLANWLDDYFMFLNPQ-NDQCCRLKKGTDEVCPPSFPSRRCETCFQQGSWNYNMSGFPEGKDFMEYLSIWI-NAPSDPCPLGGRAPYSTAL--------VYNETSVSASVFRTAHHPLRSQKDFIQAYSDGVRISSSFPE-----------LDMFAYSPFYIFFVQYQTL-GPLTLKLIGSAIILIFFISSVFLQNIRSSFLLALVVTMIIVDIGALMALLGISLNAVSLVNLIICVGLGVEFCVHIVRSFTVVPSETKKDANSRVLYSLNTIGESVIKGITLTKFIGVCVLAFAQSKIFDVFYFRMWFTLII 1139          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Nematostella
Match: EDO42868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0G1])

HSP 1 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 535/1288 (41.54%), Postives = 755/1288 (58.62%), Query Frame = 1
Query:  115 IWYGQCDKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGS------IQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSN--APFQINYLNEVKG----MNQTMLPCN---MNGGEDDGEA-CSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKY----DKDYGNGIV--PATPEVDDIST--------FDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDI--SARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTK---LEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRI-VTDEFNLPIATYMDQIMECIKDPTNIKPTKFKE-ICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSE--TNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-------------PDGS--FCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGP 3816
            +WYGQC K      LNC Y  P K LN+      L  LCP+ A+  +    CC+  QL  LD  L+        CP C +N + +YC  TC P+Q  F+   +  G        I  + Y +       LF SC +V+    N   ++ +CG + E C P    + +G +TSN  APF I+Y   ++     MNQT   C+   +N   +   A CSCQDC+ SCP  PP     K  TI+G+    F++ +VF  FF++ + I  +    K  Y    D     G+V     P  + I+         F+  G  +E  L   F  WG++ +     V++  I+   +L+ G+    +  DPV+LWS+P S AR+ KD FD  F PFYRTEQ+II      P     Y      + + +GP+F++DLL +   L N++++M V     N  T    LED+CFKPL+P   KC + SV QYFQN+   L++   TD F+     + D I+ C   PT+++  K+    C G+ G PV P +A GGF +  +Y +++AL+ITF+V N  D+  K+   A  WEKAF++ ++++ +   N++L IS+++ERS+QDE+DR+SETD+ TI +SY IMF Y+TI LGQ N+ ++I +DSK TLG C ++IVL SV CS+GFWSY+ VP TLII+EV+PFLVLAVGVDN FI+VQ YQR + Y    N    +KI+  + +V PSMLLSSLSES+AF  G M++MPAVK+FSLYA+ AV  DF+LQIT  +A++ LDAKR E  R D++CCV+                +  G +++I   FYAP L    VR  V++ F G    +++    I V L+Q +++PKDS+++++F  +  YL VGPPVYF++   Y+++   +QN ICG++GC+  SL+ Q+F AS   N + I+   +SWLDD+F W   S    CCR+              P+G   FC A+V N  C  C        RP    FD YL F+L +NP + C KG    Y  + N  N        +   A+YFM+YHTILKT  D+  ALKN+ EIA ++T    T LG+ +  +V PYSVFYVFYEQYLT     W  L  C+  V +VTF+ +G +    LI+ F + +I+ ++ G MYLW I +NA+S+VNLVMA+GISVEF +HI RA+ V   +T+ ERA E L+EMGSSVLSGITLTK GGIIVLAF+KS++F+IFYFRMY+GIV+FGA H ++FLPV LS+ GP
Sbjct:    2 VWYGQCTKPGQTPALNCLYNEPAKELNDTKAMNILKNLCPKIAQGGKT---CCDLRQLEALDSNLNTLRQFTSRCPACWQNMLDMYCESTCSPDQSLFMDPTSVVGFPPYTPYMINTINYYIAPEHKDQLFKSCKDVIFPGNNEKILNLLCGQSAETCSPQKLLEYMG-STSNGQAPFDIHYPEIIRPNMTWMNQTSYKCSESFINPLTNRTSAKCSCQDCQGSCPVLPPEPPTPKQKTIIGLSILSFVLLVVFIGFFILFMGISCYKIFNKPAYMRLPDNVVARGVVYTEERPPSNVINVEIARKPGCFEVMGVAMEQKLRKIFSLWGLWCSNHPYTVIAGCIVFVGILAGGVGYYSIIKDPVKLWSAPQSRARQEKDLFDSKFSPFYRTEQLIITVNQNYPQNHTGYKQYPDDKFIPFGPIFHLDLLNQALDLQNYLTDM-VVPHTENGKTTNITLEDVCFKPLAPLNTKCTIQSVFQYFQNSKELLNKCRTTDYFH---DDFHDHILYCTSAPTSLEDFKWGGGPCLGENGVPVNPNIALGGF-EGTDYNNASALIITFVVENHRDE--KKNAKAESWEKAFIDHMKSYVKHPENSNLTISFSSERSIQDELDRESETDIATILVSYTIMFVYITIALGQINSCERIMIDSKFTLGFCGIIIVLCSVICSIGFWSYVGVPATLIIIEVIPFLVLAVGVDNFFIMVQAYQRINRY---SNEPVSKKISCALGEVAPSMLLSSLSESVAFGFGAMSDMPAVKVFSLYASFAVAVDFILQITWFVALMSLDAKRQETNRWDIMCCVKQKKT---------EHREQDGFIYQIMKHFYAPALLSDFVRPCVIVLFTGMLFTSIALTPHISVGLDQDIALPKDSFLLDWFKDMRQYLHVGPPVYFVLDGKYDFEHSKTQNRICGSAGCDPDSLIQQVFTASLRSNRSKIAMPASSWLDDYFNWIDPSTT--CCRILYENTTSGVVPAKGPNGGLVFCNATVKNDLCMPCMNKSQQGERPTPSEFDMYLPFYLKDNPELVCAKG----YVMSPN-GNIFLLISLMLSPSASYFMSYHTILKTSDDFISALKNAREIADNMT----TALGDPD-IKVFPYSVFYVFYEQYLTAATNAWKNLLYCIAAVFVVTFLWMGFNLSIALIVTFTVAMIITNLLGLMYLWSISLNAISIVNLVMAVGISVEFCSHIARAFAVNTRNTKRERAEEALIEMGSSVLSGITLTKFGGIIVLAFAKSRIFEIFYFRMYVGIVLFGALHGLVFLPVLLSYVGP 1254          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Nematostella
Match: EDO36972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH24])

HSP 1 Score: 119.398 bits (298), Expect = 3.272e-27
Identity = 91/374 (24.33%), Postives = 178/374 (47.59%), Query Frame = 1
Query: 1639 FGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVL-CCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMI 2757
            +    + T ++A+ +T+++    D + +      ++E  F+N ++   +  +   + YTAERS+ D I   + +D+  I++++ +M T+    LG++ N    P+     L    V  V + V    G    + +P  + ++ V+PFL+L +G+D++FILV    R D       L+    I  V+   G ++ ++++++ +AF     T  P+++ F +YAA +V   +L+ IT  +A+   D +R +A R D L CC        P +  P          +++  K YA +L KTPVR LVV+  +G    ++     I    +++L    +SY   + +A   +  +   V  ++    +Y     Q+ I
Sbjct:  184 YNSNGHLTSASAIQVTYLIQAPTDTDVED--KVFEFETDFINKMKGLQKDLSCAKMFYTAERSLDDAISESAGSDITLISITFAVMITFACTMLGKFCN----PLTGHSLLANAGVFAVALGVLAGFGLSLAVGIPF-ISLVGVLPFLILGIGIDDMFILVDELDRQD-----NKLSVIDTIKMVMRHSGMTVTMTTVTDLVAFAVSTSTAFPSIRYFCIYAALSVTLSYLMIITYFVAIATFDVRRIKANRRDCLPCCF----APIPKEGEPKWDEPRLQGANKVM-KQYARLLMKTPVRILVVLLSMGLLGISIWGAMNISESFDRRLLAKDNSYFKEFINAQERHYELSLEVSIVMDAKLDYGMARIQDDI 540          

HSP 2 Score: 83.9593 bits (206), Expect = 2.770e-16
Identity = 67/180 (37.22%), Postives = 105/180 (58.33%), Query Frame = 1
Query: 3271 NSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLI--LGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLS 3804
            N    +  P S F++F+EQY ++ +   I+        +L+      L  + TL+  LGF  +++   +F  M +W + +NA+SM+NLVMAIG SV++ AHI  A+V     T   R    L  +G+SVL G   T LG I+ +  S S++F+IF F+M+LGIV+ G  H ++FLPV++S
Sbjct:  642 NDKSLKAYPISRFFIFFEQY-SLIQSETIRNLAIAAAAVLLITWPFLLSIRVTLLVFLGFSALIV--ELFALMSVWDVSLNAISMINLVMAIGFSVDYSAHIAHAFVTSSEPTAELRVEHALSTLGTSVLLGGISTFLGMIVTVG-SSSKIFRIF-FKMFLGIVLLGLLHGLVFLPVYMS 816          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Nematostella
Match: EDO39186 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAU6])

HSP 1 Score: 118.242 bits (295), Expect = 3.722e-27
Identity = 91/374 (24.33%), Postives = 178/374 (47.59%), Query Frame = 1
Query: 1639 FGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVL-CCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMI 2757
            +    + T ++A+ +T+++    D + +      ++E  F+N ++   +  +   + YTAERS+ D I   + +D+  I++++ +M T+    LG++ N    P+     L    V  V + V    G    + +P  + ++ V+PFL+L +G+D++FILV    R D       L+    I  V+   G ++ ++++++ +AF     T  P+++ F +YAA +V   +L+ IT  +A+   D +R +A R D L CC        P +  P          +++  K YA +L KTPVR LVV+  +G    ++     I    +++L    +SY   + +A   +  +   V  ++    +Y     Q+ I
Sbjct:    3 YNSNGHLTSASAIQVTYLIQAPTDTDVED--KVFEFETDFINKMKGLQKDLSCAKMFYTAERSLDDAISESAGSDITLISITFAVMITFACTMLGKFCN----PLTGHSLLANAGVFAVALGVLAGFGLSLAVGIPF-ISLVGVLPFLILGIGIDDMFILVDELDRQD-----NKLSVIDTIKMVMRHSGMTVTMTTVTDLVAFAVSTSTAFPSIRYFCIYAALSVTLSYLMIITYFVAIATFDVRRIKANRRDCLPCCF----APIPKEGEPKWDEPRLQGANKVM-KQYARLLMKTPVRILVVLLSMGLLGISIWGAMNISESFDRRLLAKDNSYFKEFINAQERHYELSLEVSIVMDAKLDYGMARIQDDI 359          

HSP 2 Score: 72.4034 bits (176), Expect = 8.589e-13
Identity = 45/132 (34.09%), Postives = 71/132 (53.79%), Query Frame = 1
Query: 3271 NSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLI--LGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSG 3660
            N    +  P S F++F+EQY ++ +   I+        +L+      L  + TL+  LGF  +++   +F  M +W + +NA+SM+NLVMAIG SV++ AHI  A+V     T   R    L  +G+SVL G
Sbjct:  461 NDKSLKAYPISRFFIFFEQY-SLIQSETIRNLAIAAAAVLLITWPFLLSIRVTLLVFLGFSALIV--ELFALMSVWDVSLNAISMINLVMAIGFSVDYSAHIAHAFVTSSEPTAELRVEHALSTLGTSVLLG 589          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Nematostella
Match: EDO46942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK5])

HSP 1 Score: 115.546 bits (288), Expect = 8.147e-26
Identity = 105/390 (26.92%), Postives = 178/390 (45.64%), Query Frame = 1
Query: 1741 DWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNV---PMTLIILEVVPFLVLAVGVDNLFILVQTYQRYD-EYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPV--YFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQS 2892
            DWEK F  ++ N   T    +  Y +  +  D      + D+  ++  Y+++  YV I LGQ+  ++      K  LG+  V+ V +S+  S G  S   V   P    +  V+PFL+L +GVD++F++VQ +     E + +K +   ++IA  +   G S+ ++SL++ LAF  G  T +P ++ F +YA   +L DF+LQIT+  A L LD +R +  R    CC     +V PVD    ++     ++   F+ +Y   +   P + +V+I  +   LF LS        L   L + +D      FDA+  +L        Y I  D +   S     +  G     E  L           +   + +S  SW DD+  W+K++
Sbjct:  816 DWEKEFGKILDNLPSTAPGTYY-YFSRYTFSDAAGNSIQGDVTLLSAGYMLIIVYVVIMLGQFTRLRL-----KAWLGVAGVICVGLSIGVSFGMSSAFGVFYGP----VHSVLPFLLLGIGVDDMFVIVQAWNNLTPEEHKTKEV--HERIALTLQHAGCSITITSLTDFLAFLIGASTVLPGLQSFCIYAGLGILIDFILQITLFSAFLTLDGRREDRKRDGCCCCC----IVLPVDYTE-SQCGSRELMKVFFESYYCKAILSLPGKVIVMI--ITGVLFGLS--------LYGTLMLKQD------FDAIW-FLPTKSMAYKYTIENDKFFPSSGERAALYAGKINYFEDQLKLHKLREVTIADSGVVDSSVKSWFDDYMDWAKKT 1171          

HSP 2 Score: 85.8853 bits (211), Expect = 8.884e-17
Identity = 51/152 (33.55%), Postives = 85/152 (55.92%), Query Frame = 1
Query: 3475 GFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPA-------------LNRKKIVEQKKLLEKMPENNSWGN 3891
            GFMY WG+ I+ ++ + LV+A+G++V++ +HI   +++    T  +RAR  + +MG +VL+G   T L   ++LA S S +F +F F+++  +V+FG  H + +LPV LS  GPA               R   V  K    ++PE N+ G 
Sbjct: 1309 GFMYFWGLTIDTITTIQLVLAVGLAVDYSSHIGHMFMIT-PGTHEDRARITMRDMGPAVLNGGFSTFL-AFVLLAASDSYIFGVF-FKIFFLVVLFGMWHGMAYLPVLLSSIGPAPYLSAQVSDRHNKSGRASPVHPKSENVELPEKNTRGQ 1457          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Nematostella
Match: EDO32433 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV27])

HSP 1 Score: 111.309 bits (277), Expect = 1.742e-25
Identity = 70/201 (34.83%), Postives = 120/201 (59.70%), Query Frame = 1
Query: 3247 EQLKTTLGNSNQFEVVP---YSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLS-FC--GPALNRK 3831
            + + T   + ++F  VP    S  ++++EQY    +   ++  V  G+ +LV      +D   T+++ F  + ++  +FG MY+WG+ +N +SM+NL+MAIG +V++ AHI  AYV+       +R  + L  +G+SVL G   T + G+++LAF+ SQ+F+IF F+M+ GIV  G  H + FLPV+L+ FC   P  +R+
Sbjct:  273 DAMVTLREDVDEFSTVPAYPISKPFLYFEQYAITLRAT-VRNLVIAGIAILVITCPFLVDLSVTILVFFGFVALVFELFGLMYVWGVSLNGVSMINLIMAIGFAVDYSAHIAHAYVMSSKALPEDRVVDALRTLGASVLMGGASTFI-GMVMLAFASSQIFRIF-FKMFFGIVFLGLLHGLCFLPVYLTIFCRSAPTSHRE 470          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Medaka
Match: npc1 (NPC intracellular cholesterol transporter 1 [Source:NCBI gene;Acc:101159535])

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 540/1268 (42.59%), Postives = 770/1268 (60.73%), Query Frame = 1
Query:  109 KCIWYGQC-DKSNPNKILNCNYTGPPKPLNNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKAL-GDATSNAPFQINYL---NEVKG---MNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIY-LKKNKYDKDYG---NGIVPATPEVDDI-----STFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKF-KEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLY-PDGSFCPASVVNSTCNNC-PANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKK 3852
             CIWYG+C D   P K  NCNYTGPP PL     +  LT+LCP Y   +R  SLCCN +QL TL   L         CP C  N + L+C LTC P+Q  F         ++  V Y + + F   ++N+C +V   S+N  A+  +CG   ++C+   + + +   +   APF IN +    EV G   MN     C   G ED    CSCQDC  +C   P P      +TI G+D    I+   + +F ++ +   +  +  ++     +YG   +   P +   DD+     S  +  G + E +L + F  WG F  R   +V+   +++ +  S G+   ++TTDPVELWSSP+S AR+ KDYFD +FGPF+RT Q+II    +  FT+  Y     N+ + P+F+ +LL +V  L   ++   + +        L+DIC  PL+P    C ++S++ YFQN+ + LD I  DEF    A +    + C+  P ++  T    + C G FGGPVFP+LA GG+ D  NY ++TALVITF +NN L+ +S ++   L WEK F+  ++NFS  N++L ++++AERSV+DEI+R+S +D+ TI +SYIIMF Y+++ LG  ++     VDSK++LG+  +LIVL SV+ S+G +SY  +P+TLI++EV+PFLVLAVGVDN+FI+VQT QR D      N    Q+I R++  V PSM LSSLSE++AFF G ++ MPAV+ FSL+A  A+  DFLLQI+  +++L LDAKR E  R+D+ CCV++             ++K  GIL   F K YAP++ +  VR ++V  FVG   F+++ ++ + + L+QKLSMP DSY+++YF  L+ YL  G PVYF+V+DG NY S + QN++CG  GCN  SL+ Q++ AS   N T I+ + +SWLDD+F W K      CCR Y   G FC ASV+N +C +C P     K RP  + F  +L  FL++NP+ +C KGGHAAY  AV++K  D        +GATYFMTYHTILK   D+  ALK    +A ++++ +     N   F    YSVFYVFYEQYLT+     + LGV L  + +VT VLLG +  + L++   I +I+ +MFG M+LW I +NA+S+VNLVM+ GISVEF +HIVRA+ +    +R+ERA E L  MGSSV SGITLTK GGI+VLAFSKSQ+FQ+FYFRMYL IV+ GAAH +IFLPV LS+ GP+ N+ K++   K
Sbjct:   31 HCIWYGECGDSPVPGKKFNCNYTGPPLPLE-PEAYDLLTELCPGYDYGNR--SLCCNANQLRTLKGSLQLPLQFLSRCPACFYNLMNLFCELTCSPHQSQFTKATKFNDSNVMEVQYYIGKTFASAMYNACSDVQAPSSNVKALSLLCGKVAQECNATNWIQYMFSTSNGQAPFPINPIFSDVEVSGFTPMNNKTYACT-EGLEDGSGPCSCQDCTNACGPKPIPPVVPPPWTIFGVDAMNVIMWFSYLSFLLVFLGAVLGAWCYRRRTVMSEYGPILDSNNPLSLNSDDLGQASPSCCETLGERFENFLRVLFSSWGSFCVRNPFVVILGSLLLVVAFSYGLRYMRITTDPVELWSSPASQARQEKDYFDSHFGPFFRTAQLIITTSTKNNFTYSPY-FGGSNVPFKPIFDKELLHQVLDL--QLAIQSLVATYEGQNVTLKDICVAPLAPYNNNCTILSILNYFQNSHSVLDHIAGDEF-FTYADFHSHFLYCVSAPASLNDTTLLHDPCLGTFGGPVFPWLALGGY-DDTNYNNATALVITFPLNNYLN-DSVRLGKVLAWEKEFIGFMKNFS--NSNLTVAFSAERSVEDEINRESNSDINTILISYIIMFVYISLALGHIHSFSMFLVDSKISLGIAGILIVLSSVSSSLGIFSYFGIPLTLIVIEVIPFLVLAVGVDNIFIIVQTLQRDDRM---PNEELHQQIGRILGDVAPSMFLSSLSETVAFFLGALSIMPAVRTFSLFAGLAIFIDFLLQISCFVSLLGLDAKRQERNRLDICCCVKLPES---------QQIKSDGILFRFFKKIYAPVILQEWVRPIIVAVFVGMLSFSIAAVNKVQIGLDQKLSMPDDSYVLDYFKNLSEYLHTGAPVYFVVEDGLNYTSLDGQNVVCGGVGCNNNSLVQQVYTASLISNYTTIAYTPSSWLDDYFDWIKPQST--CCRFYNSTGEFCNASVINPSCVSCRPMTPAGKERPVGEEFMRFLPMFLSDNPNPKCGKGGHAAYATAVDLKPNDGG------VGATYFMTYHTILKDSPDFINALKMGRVLAENISQSI-----NHKAFA---YSVFYVFYEQYLTIAYDTALNLGVSLAAIFVVTTVLLGFEVWSALMVSITIAMILVNMFGVMWLWDISLNAVSLVNLVMSCGISVEFCSHIVRAFSISTKRSRVERAEEALAHMGSSVFSGITLTKFGGIVVLAFSKSQIFQVFYFRMYLAIVLLGAAHGLIFLPVLLSYIGPSPNKAKVLATNK 1258          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Medaka
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:NCBI gene;Acc:101160914])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 483/1297 (37.24%), Postives = 730/1297 (56.28%), Query Frame = 1
Query:  112 CIWYGQCDKSNPN-------KILNC-NYTGPPKPLNNATG--FQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV----DTGYGG----SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYLNEVKGMNQTMLPCNM---NGGE--------DDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDK---------DYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD---YEKCAVMSVMQYFQN---------NITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSET-NTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYP----DGSFCPASVVNSTCNN--CPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPAL 3822
            C +Y +C + NP+        I+ C NY+    P  + TG  ++   ++CP   + + N   CC+  QL +L+  LS +  +   CP+C  NF  ++C  TC PNQ   V V    +  Y G    ++ A +  +N  F +  F SC NV L +   +AI T+CG      C P  +Y   GD+++  AP  I++ + +KG + T LP  +   NG             E CSCQDC+ SCP+ PPP  P   F + G+DG++ I  I+     +    +Y+F+  + +   K         D    I        +++  +K     + +L+  F RWG  +A   L VL    ++  VLS+G+   ++TTDPVELWS+P+S AR+ KD+ D++FGPF+RT Q+I+   D+    + +     +N  +  + + DL+ ++  L   I  +E +S+ LN    L+D+C+ PL+P       CAV S+ QYFQN         N+T+L   VT E +     + D ++ C+  P + K  T     C  D+G PVF +LA GG+ D  +YT++ AL++TF +NN   ++ K  K AL WEK FL +VQ++ +   T+   +Y AERS++DEI+R +  D+    +SY+++F Y+ + LG+Y++ K++ VDSK  +GL  +L+V  SV  S+GF+S++ +P +L+IL+VVPFLVLAVG DN+FI V  YQR D   + +  T EQ I RV+  V PSMLL SLSES+ FF G ++ MPAV+ F+LYAA AVL DF LQ+T  +A+L LDA+R    R ++ CCV +        +   +     G L  +  K+YAP L     R  V++ F+     ++  +  + V L+Q+L+MP DSYM+ YF  L  Y  VG PVYF+ K G+N+ SE   N +C + GC++ SL  ++  A+  P+++YI+    SW+DDF  W        CCRLY      G FCPA++ +  C      A+ T+  RP  ++F+ +L  FL N P +QC KGG  AY  +V I           EI A+ FM YHT L    +YT AL+   E+A+S+TE ++   G S  FEV  Y++  VFYEQYLT+  +    + +CL    +V  +LLGLD  + L+    II+I+    G M LW I  NA+S++NLV A+GISVEF++H+ R++ +    TR+ERA E    MGS+V +G+ +T L GI+VLAF+K+QL QIF+FR+ L I + G AH +IFLPV L++ G  L
Sbjct:   20 CAFYDECGR-NPSLGDTLIPPIVPCLNYS----PARHLTGEHYRRFKEVCPMLDQGEENTYGCCSLGQLTSLERSLSLSKGVLNRCPSCAENFAHMHCMATCSPNQTVAVKVTKVMNVTYLGQPKDAVVAYSAYINNQFAETAFQSCKNVRLPATGGFAISTMCGRYGATLCTPQRWYDFQGDSSNGLAPLDIDF-HLIKGHDTTGLPEGVIPYNGQALKCNEVTPSGSEPCSCQDCKDSCPSLPPPPPPPAPFRLAGMDGFLLI-SIILSCVLICAFLLYVFVSFRMSSKKKKDQGGGKRKDKTKDIFQRKIHPSEVTCANKTSLVAQDFLSSLFQRWGTLMASYPLTVLLFSAVVVAVLSVGLKSIELTTDPVELWSAPNSQARQEKDFHDKHFGPFFRTNQLILTAPDKKGSIYDSLLFGKQN--FSGIVSKDLIIQLLELQQKIQQIEFWSEDLNRTASLKDVCYAPLNPSNPSLTDCAVNSLPQYFQNSLENINAKANMTELG--VTKEVD-----WRDHLIYCLNSPLSFKDITALGMSCMADYGAPVFTFLAVGGYEDD-DYTNAEALILTFSLNNFPREDPK-FKVALQWEKEFLKIVQDYQKNPATNFTFAYMAERSLEDEINRTTAEDIPIFMISYLVIFVYIAVALGEYSSCKRLLVDSKFLVGLGGILVVGCSVLASMGFYSWIGIPSSLVILQVVPFLVLAVGADNIFIFVLEYQR-DVRRAGE--TREQHIGRVLGHVAPSMLLCSLSESVCFFLGALSTMPAVRSFALYAALAVLMDFALQMTAFVALLSLDARRQVKNRCELFCCVSV--------SAKHSNKPNEGFLLPLMRKYYAPALLNRYTRIFVMVVFILMFCASIFLMLHVKVGLDQELAMPTDSYMLRYFSYLHKYFEVGVPVYFVTKRGFNFTSEEGMNAVCSSVGCDQFSLTQKIQYATNFPDLSYIAIPANSWVDDFIDWLNPGSR--CCRLYTLGPNQGEFCPANISSLLCGRKCMNASATSAIRPSVELFNRFLPDFLGNRPDLQCSKGGLGAYDTSVVIDGGG-------EIIASRFMAYHTTLTNSQEYTAALQKGRELASSITEAMRKVPGTSPDFEVFTYTLTNVFYEQYLTIVPEGLFNISMCLLPTFVVCCLLLGLDLLSGLLNLITIIMIVVDTVGVMTLWSIDYNAVSLINLVTAVGISVEFVSHMTRSFALSTKPTRVERAAEATANMGSAVFAGVAMTNLPGILVLAFAKAQLIQIFFFRLNLVITLLGLAHGLIFLPVLLTYFGTDL 1278          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Medaka
Match: NPC1L1 (NPC1 like intracellular cholesterol transporter 1 [Source:NCBI gene;Acc:101160914])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 469/1241 (37.79%), Postives = 704/1241 (56.73%), Query Frame = 1
Query:  250 DRNPSLCCNTDQLLTLDMQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTV----DTGYGG----SIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEK-CDPVAFYKALGDATSN-APFQINYLNEVKGMNQTMLPCNM---NGGE--------DDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDK---------DYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPD---YEKCAVMSVMQYFQN---------NITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKP-TKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSET-NTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYP----DGSFCPASVVNSTCNN--CPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPAL 3822
            + N   CC+  QL +L+  LS +  +   CP+C  NF  ++C  TC PNQ   V V    +  Y G    ++ A +  +N  F +  F SC NV L +   +AI T+CG      C P  +Y   GD+++  AP  I++ + +KG + T LP  +   NG             E CSCQDC+ SCP+ PPP  P   F + G+DG++ I  I+     +    +Y+F+  + +   K         D    I        +++  +K     + +L+  F RWG  +A   L VL    ++  VLS+G+   ++TTDPVELWS+P+S AR+ KD+ D++FGPF+RT Q+I+   D+    + +     +N  +  + + DL+ ++  L   I  +E +S+ LN    L+D+C+ PL+P       CAV S+ QYFQN         N+T+L   VT E +     + D ++ C+  P + K  T     C  D+G PVF +LA GG+ D  +YT++ AL++TF +NN   ++ K  K AL WEK FL +VQ++ +   T+   +Y AERS++DEI+R +  D+    +SY+++F Y+ + LG+Y++ K++ VDSK  +GL  +L+V  SV  S+GF+S++ +P +L+IL+VVPFLVLAVG DN+FI V  YQR D   + +  T EQ I RV+  V PSMLL SLSES+ FF G ++ MPAV+ F+LYAA AVL DF LQ+T  +A+L LDA+R    R ++ CCV +        +   +     G L  +  K+YAP L     R  V++ F+     ++  +  + V L+Q+L+MP DSYM+ YF  L  Y  VG PVYF+ K G+N+ SE   N +C + GC++ SL  ++  A+  P+++YI+    SW+DDF  W        CCRLY      G FCPA++ +  C      A+ T+  RP  ++F+ +L  FL N P +QC KGG  AY  +V I           EI A+ FM YHT L    +YT AL+   E+A+S+TE ++   G S  FEV  Y++  VFYEQYLT+  +    + +CL    +V  +LLGLD  + L+    II+I+    G M LW I  NA+S++NLV A+GISVEF++H+ R++ +    TR+ERA E    MGS+V +G+ +T L GI+VLAF+K+QL QIF+FR+ L I + G AH +IFLPV L++ G  L
Sbjct:    6 EENTYGCCSLGQLTSLERSLSLSKGVLNRCPSCAENFAHMHCMATCSPNQTVAVKVTKVMNVTYLGQPKDAVVAYSAYINNQFAETAFQSCKNVRLPATGGFAISTMCGRYGATLCTPQRWYDFQGDSSNGLAPLDIDF-HLIKGHDTTGLPEGVIPYNGQALKCNEVTPSGSEPCSCQDCKDSCPSLPPPPPPPAPFRLAGMDGFLLI-SIILSCVLICAFLLYVFVSFRMSSKKKKDQGGGKRKDKTKDIFQRKIHPSEVTCANKTSLVAQDFLSSLFQRWGTLMASYPLTVLLFSAVVVAVLSVGLKSIELTTDPVELWSAPNSQARQEKDFHDKHFGPFFRTNQLILTAPDKKGSIYDSLLFGKQN--FSGIVSKDLIIQLLELQQKIQQIEFWSEDLNRTASLKDVCYAPLNPSNPSLTDCAVNSLPQYFQNSLENINAKANMTELG--VTKEVD-----WRDHLIYCLNSPLSFKDITALGMSCMADYGAPVFTFLAVGGYEDD-DYTNAEALILTFSLNNFPREDPK-FKVALQWEKEFLKIVQDYQKNPATNFTFAYMAERSLEDEINRTTAEDIPIFMISYLVIFVYIAVALGEYSSCKRLLVDSKFLVGLGGILVVGCSVLASMGFYSWIGIPSSLVILQVVPFLVLAVGADNIFIFVLEYQR-DVRRAGE--TREQHIGRVLGHVAPSMLLCSLSESVCFFLGALSTMPAVRSFALYAALAVLMDFALQMTAFVALLSLDARRQVKNRCELFCCVSV--------SAKHSNKPNEGFLLPLMRKYYAPALLNRYTRIFVMVVFILMFCASIFLMLHVKVGLDQELAMPTDSYMLRYFSYLHKYFEVGVPVYFVTKRGFNFTSEEGMNAVCSSVGCDQFSLTQKIQYATNFPDLSYIAIPANSWVDDFIDWLNPGSR--CCRLYTLGPNQGEFCPANISSLLCGRKCMNASATSAIRPSVELFNRFLPDFLGNRPDLQCSKGGLGAYDTSVVIDGGG-------EIIASRFMAYHTTLTNSQEYTAALQKGRELASSITEAMRKVPGTSPDFEVFTYTLTNVFYEQYLTIVPEGLFNISMCLLPTFVVCCLLLGLDLLSGLLNLITIIMIVVDTVGVMTLWSIDYNAVSLINLVTAVGISVEFVSHMTRSFALSTKPTRVERAAEATANMGSAVFAGVAMTNLPGILVLAFAKAQLIQIFFFRLNLVITLLGLAHGLIFLPVLLTYFGTDL 1213          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Medaka
Match: ptch1 (patched 1 [Source:NCBI gene;Acc:101166055])

HSP 1 Score: 112.464 bits (280), Expect = 1.950e-24
Identity = 69/238 (28.99%), Postives = 129/238 (54.20%), Query Frame = 1
Query: 1705 LDQNSKQIKAALD-WEKAFLN-VVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCC 2412
            ++ N ++  A L+ W++ +   V+Q+ +  ++   +S+T   +++D +   SE  +  +A  Y++M  Y  +T+ +++  K     S+  +GL  VL+V +SV   +G  S L +       +V+PFL L VGVD++F+L   +    E   +K +  E +    + + G S+ L+S+S   AFF   +  +PA++ FSL AA  V+F+F + + +  A+L +D  R E  R D+ CC
Sbjct:  372 INWNEEKAAAILEAWQRRYSEAVLQSVAANSSQRVLSFTTT-TLEDILKSFSEISVIRVASGYLLMLAYACLTMLRWDCAK-----SQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAF---SETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRCDIFCC 600          

HSP 2 Score: 63.5438 bits (153), Expect = 1.560e-9
Identity = 58/193 (30.05%), Postives = 100/193 (51.81%), Query Frame = 1
Query: 3295 PYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKMPE 3873
            P    ++F+EQY+++   L + + V L    LV  + L   W A +I+   + L+   +FGFM L GI ++A+ +V L+ ++GI VEF  H+  A++    D R +RA   L  M + VL G   + L G+++LA S+      ++F +   + + G  + ++ LPV LS+ GP         + +L    PE
Sbjct: 1081 PNGYPFLFWEQYVSLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIV-LVLSLMTVELFGFMGLMGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD-RHKRAVLALEHMFAPVLDG-AFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPYPEVSPADGRSRLPTPSPE 1270          
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Medaka
Match: ptch1 (patched 1 [Source:NCBI gene;Acc:101166055])

HSP 1 Score: 112.079 bits (279), Expect = 2.325e-24
Identity = 69/238 (28.99%), Postives = 129/238 (54.20%), Query Frame = 1
Query: 1705 LDQNSKQIKAALD-WEKAFLN-VVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCC 2412
            ++ N ++  A L+ W++ +   V+Q+ +  ++   +S+T   +++D +   SE  +  +A  Y++M  Y  +T+ +++  K     S+  +GL  VL+V +SV   +G  S L +       +V+PFL L VGVD++F+L   +    E   +K +  E +    + + G S+ L+S+S   AFF   +  +PA++ FSL AA  V+F+F + + +  A+L +D  R E  R D+ CC
Sbjct:  372 INWNEEKAAAILEAWQRRYSEAVLQSVAANSSQRVLSFTTT-TLEDILKSFSEISVIRVASGYLLMLAYACLTMLRWDCAK-----SQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAF---SETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRCDIFCC 600          

HSP 2 Score: 63.1586 bits (152), Expect = 1.989e-9
Identity = 55/174 (31.61%), Postives = 95/174 (54.60%), Query Frame = 1
Query: 3295 PYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGP 3816
            P    ++F+EQY+++   L + + V L    LV  + L   W A +I+   + L+   +FGFM L GI ++A+ +V L+ ++GI VEF  H+  A++    D R +RA   L  M + VL G   + L G+++LA S+      ++F +   + + G  + ++ LPV LS+ GP
Sbjct:  977 PNGYPFLFWEQYVSLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIV-LVLSLMTVELFGFMGLMGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD-RHKRAVLALEHMFAPVLDG-AFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGP 1147          
BLAST of Niemann-Pick disease, type C1 vs. Planmine SMEST
Match: SMESG000005000.1 (SMESG000005000.1)

HSP 1 Score: 2373.2 bits (6149), Expect = 0.000e+0
Identity = 1196/1197 (99.92%), Postives = 1196/1197 (99.92%), Query Frame = 1
Query:  301 MQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNAPFQINYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCXXXXXXXXXSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPXXXXXXXXXXXAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQXXXXXXXXXXXXXXXXXXDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKMPENNSWGN 3891
            MQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNAPFQINYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCPAPPPPQKPSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDIS RNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPSMLLSSLSESLAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQLGVCLGVVLLVTFVLLGLDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKMPENNSWGN
Sbjct:    1 MQLSPASIIFGGCPNCMRNFIRLYCALTCDPNQDNFVTVDTGYGGSIQAVTYNLNENFYQGLFNSCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNAPFQINYLNEVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCPAPPPPQKPSKTFTILGIDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDDISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIILKKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTWINYDISPRNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDICFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMECIKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFIVNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEIDRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLIVLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYDEYYSSKNLTTEQKIARVVSKVGPSMLLSSLSESLAFFCGVMTEMPAVKIFSLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPVDAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQIHLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSENSQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQSGNPPCCRLYPDGSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFLTNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTPSDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVFKQLWIQLGVCLGVVLLVTFVLLGLDWKATLILGFHIILIMNSMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLPVFLSFCGPALNRKKIVEQKKLLEKMPENNSWGN 1197          
BLAST of Niemann-Pick disease, type C1 vs. Planmine SMEST
Match: SMESG000053118.1 (SMESG000053118.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.051e-10
Identity = 47/144 (32.64%), Postives = 79/144 (54.86%), Query Frame = 1
Query: 3418 WKATL-ILGFHIILIMN-----SMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAA-HAIIFLPVFLSFCGPALNR 3828
            W ATL +  F IILI       S+   +Y+ G  +  L  +NL + +G++++++ H+  AY   +   R ER  ++L EMG S+LSG++ T LG    L F +++   +F F +++   IF A  +++IFLP      GP+  R
Sbjct:  726 WFATLNVHTFLIILIGTCLSTLSVTSLIYITGWNLGLLESINLTVVVGLTIDYLVHMGLAYNSSQKKHRDERTEDMLEEMGVSILSGMS-TTLGSSFFLFFCQTKF--LFQFGVFVFATIFSAGIYSMIFLPCMFLVFGPSQGR 866          
BLAST of Niemann-Pick disease, type C1 vs. Planmine SMEST
Match: SMESG000053118.1 (SMESG000053118.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.431e-10
Identity = 47/144 (32.64%), Postives = 79/144 (54.86%), Query Frame = 1
Query: 3418 WKATL-ILGFHIILIMN-----SMFGFMYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAA-HAIIFLPVFLSFCGPALNR 3828
            W ATL +  F IILI       S+   +Y+ G  +  L  +NL + +G++++++ H+  AY   +   R ER  ++L EMG S+LSG++ T LG    L F +++   +F F +++   IF A  +++IFLP      GP+  R
Sbjct:  768 WFATLNVHTFLIILIGTCLSTLSVTSLIYITGWNLGLLESINLTVVVGLTIDYLVHMGLAYNSSQKKHRDERTEDMLEEMGVSILSGMS-TTLGSSFFLFFCQTKF--LFQFGVFVFATIFSAGIYSMIFLPCMFLVFGPSQGR 908          
BLAST of Niemann-Pick disease, type C1 vs. Planmine SMEST
Match: SMESG000053129.1 (SMESG000053129.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.583e-10
Identity = 37/111 (33.33%), Postives = 70/111 (63.06%), Query Frame = 1
Query: 3481 MYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAA-HAIIFLP-VFLSF 3807
            +Y+ G  +  L  +NL + +G++++++ H+  AY     +++ +R +E+L EMG S+LSG+  T LG    L F +++   +F F +++ I IF A  +++IFLP +FL+F
Sbjct:   49 IYIIGWNLGLLESINLTVVVGLTIDYLVHMGLAYKSSEKESKEDRVQEMLGEMGISILSGMA-TTLGSSFFLLFCQTKF--LFQFGIFVFITIFSAGVYSMIFLPCIFLTF 156          
BLAST of Niemann-Pick disease, type C1 vs. Planmine SMEST
Match: SMESG000053129.1 (SMESG000053129.1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.915e-10
Identity = 37/111 (33.33%), Postives = 70/111 (63.06%), Query Frame = 1
Query: 3481 MYLWGIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMGSSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAA-HAIIFLP-VFLSF 3807
            +Y+ G  +  L  +NL + +G++++++ H+  AY     +++ +R +E+L EMG S+LSG+  T LG    L F +++   +F F +++ I IF A  +++IFLP +FL+F
Sbjct:  742 IYIIGWNLGLLESINLTVVVGLTIDYLVHMGLAYKSSEKESKEDRVQEMLGEMGISILSGMA-TTLGSSFFLLFCQTKF--LFQFGIFVFITIFSAGVYSMIFLPCIFLTF 849          
The following BLAST results are available for this feature:
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPC10.000e+042.60NPC intracellular cholesterol transporter 1 [Sourc... [more]
NPC1L10.000e+036.57NPC1 like intracellular cholesterol transporter 1 ... [more]
NPC1L10.000e+036.15NPC1 like intracellular cholesterol transporter 1 ... [more]
NPC1L10.000e+035.36NPC1 like intracellular cholesterol transporter 1 ... [more]
NPC11.641e-3249.86NPC intracellular cholesterol transporter 1 [Sourc... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncr-17.564e-13526.96NPC intracellular cholesterol transporter 1 homolo... [more]
ncr-17.564e-13526.96NPC intracellular cholesterol transporter 1 homolo... [more]
ncr-24.412e-10224.96NPC intracellular cholesterol transporter 1 homolo... [more]
ptr-22.751e-2224.42PaTched Related family [Source:UniProtKB/TrEMBL;A... [more]
ptc-31.887e-2023.25pep chromosome:WBcel235:II:2845384:2852128:-1 gene... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npc1a0.000e+038.75gene:FBgn0024320 transcript:FBtr0303907[more]
Npc1a0.000e+038.75gene:FBgn0024320 transcript:FBtr0303906[more]
Npc1a0.000e+038.75gene:FBgn0024320 transcript:FBtr0079957[more]
Npc1a0.000e+038.75gene:FBgn0024320 transcript:FBtr0303905[more]
Npc1a0.000e+038.85gene:FBgn0024320 transcript:FBtr0343610[more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npc10.000e+043.55Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB... [more]
npc10.000e+043.38Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB... [more]
npc10.000e+043.33Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB... [more]
NPC1L10.000e+036.47NPC1-like 1 [Source:NCBI gene;Acc:100616532][more]
ptch11.940e-2428.69patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196][more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fosl10.000e+040.39FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl10.000e+040.44FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl10.000e+040.08FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl10.000e+040.19FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-625... [more]
fosl10.000e+040.09FOS-like antigen 1 [Source:Xenbase;Acc:XB-GENE-625... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npc10.000e+042.18NPC intracellular cholesterol transporter 1 [Sourc... [more]
Npc1l10.000e+037.54NPC1 like intracellular cholesterol transporter 1 ... [more]
Ptch17.228e-2427.85patched 1 [Source:MGI Symbol;Acc:MGI:105373][more]
Ptch11.059e-2327.85patched 1 [Source:MGI Symbol;Acc:MGI:105373][more]
Ptchd31.235e-2323.90patched domain containing 3 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35604|NPC1_MOUSE0.000e+042.18NPC intracellular cholesterol transporter 1 OS=Mus... [more]
sp|P56941|NPC1_PIG0.000e+042.70NPC intracellular cholesterol transporter 1 OS=Sus... [more]
sp|O15118|NPC1_HUMAN0.000e+042.60NPC intracellular cholesterol transporter 1 OS=Hom... [more]
sp|Q6T3U3|NPCL1_RAT0.000e+036.95NPC1-like intracellular cholesterol transporter 1 ... [more]
sp|Q9VRC9|NPC1B_DROME0.000e+037.00NPC intracellular cholesterol transporter 1 homolo... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IJ920.000e+044.87Niemann-Pick C1 protein isoform X1 OS=Lingula ungu... [more]
A0A1S3IIC00.000e+044.94Niemann-Pick C1 protein isoform X2 OS=Lingula ungu... [more]
A0A267FSF30.000e+043.88SSD domain-containing protein (Fragment) OS=Macros... [more]
A0A210Q4080.000e+044.61Niemann-Pick C1 protein OS=Mizuhopecten yessoensis... [more]
K1PF480.000e+043.99Niemann-Pick C1 protein OS=Crassostrea gigas OX=29... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npc10.000e+041.18Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB... [more]
NPC1L10.000e+037.36NPC1 like intracellular cholesterol transporter 1 ... [more]
ENSAMXT00000012643.22.981e-4025.32patched domain-containing protein 3 [Source:NCBI g... [more]
ENSAMXT00000001333.24.773e-3524.29patched domain-containing protein 3-like [Source:N... [more]
ENSAMXT00000043761.15.242e-3524.29patched domain-containing protein 3-like [Source:N... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
npc10.000e+042.96Niemann-Pick disease, type C1 [Source:ZFIN;Acc:ZDB... [more]
NPC1L12.443e-9833.33NPC1 like intracellular cholesterol transporter 1 ... [more]
scap8.662e-1228.43SREBF chaperone [Source:ZFIN;Acc:ZDB-GENE-040107-4... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NCR16.847e-13128.79Vacuolar membrane protein; transits through the bi... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428680.000e+041.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369723.272e-2724.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391863.722e-2724.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469428.147e-2626.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324331.742e-2534.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npc10.000e+042.59NPC intracellular cholesterol transporter 1 [Sourc... [more]
NPC1L10.000e+037.24NPC1 like intracellular cholesterol transporter 1 ... [more]
NPC1L10.000e+037.79NPC1 like intracellular cholesterol transporter 1 ... [more]
ptch11.950e-2428.99patched 1 [Source:NCBI gene;Acc:101166055][more]
ptch12.325e-2428.99patched 1 [Source:NCBI gene;Acc:101166055][more]
back to top
BLAST of Niemann-Pick disease, type C1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005000.10.000e+099.92SMESG000005000.1[more]
SMESG000053118.11.051e-1032.64SMESG000053118.1[more]
SMESG000053118.11.431e-1032.64SMESG000053118.1[more]
SMESG000053129.11.583e-1033.33SMESG000053129.1[more]
SMESG000053129.14.915e-1033.33SMESG000053129.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027726 ID=SMED30027726|Name=Niemann-Pick disease, type C1|organism=Schmidtea mediterranea sexual|type=transcript|length=4069bp
GATCTGTATTGAAGCGCATATTCAGTTACCATTTTTTATTCGATGAAAAA
TATTTTGATTTTTTCAGTTCTTATCATTTTATTAAGTTTTATTCATTGCA
AGAATGATAAATGCATATGGTATGGACAGTGTGATAAATCTAATCCTAAT
AAAATATTAAATTGTAATTATACTGGTCCTCCAAAACCTTTAAATAATGC
AACCGGTTTTCAAACATTAACAAAATTATGTCCTCAATATGCTAAATTGG
ATAGAAATCCTAGTCTTTGCTGCAATACAGATCAATTATTGACTTTAGAT
ATGCAACTTTCTCCAGCTTCAATCATTTTTGGAGGATGTCCAAATTGCAT
GCGGAACTTCATTCGACTTTATTGTGCTCTTACTTGTGATCCGAATCAAG
ATAATTTTGTTACAGTTGACACTGGTTACGGAGGTTCTATACAAGCGGTT
ACTTACAACTTGAATGAAAATTTTTACCAAGGTTTATTCAATAGCTGCGA
TAATGTGGTTTTGTCATCGGCCAATAGTTATGCAATAGACACAGTTTGTG
GTACTACTCATGAAAAATGTGATCCTGTAGCATTCTATAAAGCCCTGGGA
GATGCAACTTCAAATGCACCATTTCAAATCAACTATCTGAATGAGGTAAA
AGGAATGAATCAAACAATGCTTCCATGTAATATGAATGGTGGTGAGGATG
ATGGTGAAGCTTGTTCTTGTCAAGATTGTAGGGCCTCCTGTCCAGCACCC
CCACCTCCCCAAAAACCTAGCAAAACCTTTACAATATTGGGGATTGATGG
TTGGGTCTTCATCGTGGATATTGTTTTTGGAGCATTCTTTATGATTGTAA
TATCAATTTATATCTTTATTTATCTCAAGAAAAACAAATATGATAAAGAT
TATGGAAATGGAATCGTACCTGCTACACCTGAAGTTGATGATATAAGCAC
ATTTGATAAATGTGGTGCCAAAGTTGAAGCTTATCTGACGTTGTGGTTTT
ATCGATGGGGAATGTTTGTAGCTCGCAGATGCTTAATTGTTTTATCCGTA
GGAATTATCATAGCTATGGTTCTCAGTCTTGGTATTATATTGAAAAAAGT
CACTACAGACCCCGTTGAATTGTGGAGCTCTCCATCTAGCTCTGCAAGAC
GAAATAAAGATTATTTTGATGAAAATTTCGGACCATTTTACAGAACCGAA
CAGATAATCATAGTTCCTAAAGACCGAACACCGTTTACTTGGATAAATTA
TGACATATCGGCTAGAAACCTAACATATGGCCCGGTTTTCAATATAGATC
TTTTACGAAGAGTGGGAACATTGATAAACCATATTTCTAATATGGAAGTA
TTCAGTAAATTATTGAATAATTATACAAAATTAGAAGATATATGTTTCAA
ACCTCTAAGTCCGGATTATGAAAAATGTGCTGTCATGTCTGTTATGCAAT
ATTTCCAAAATAATATTACGCAATTGGACAGAATTGTAACAGACGAGTTT
AATTTACCGATTGCCACTTATATGGACCAAATCATGGAATGCATAAAAGA
TCCCACGAACATTAAACCGACCAAATTTAAAGAGATCTGCAATGGGGATT
TCGGTGGTCCTGTGTTTCCATATCTGGCTTTCGGAGGATTTGGTGATAAA
AAGAATTACACTGATTCGACTGCTTTAGTAATTACATTTATTGTCAACAA
TGCACTTGATCAAAATTCAAAACAAATAAAAGCTGCGTTAGATTGGGAGA
AGGCATTTCTGAATGTAGTTCAAAATTTCTCTGAAACAAATACAGACTTG
CATATCAGTTACACTGCGGAAAGATCTGTGCAAGATGAAATTGATCGACA
ATCAGAAACTGATCTATTTACAATAGCTCTCAGTTATATTATAATGTTTA
CTTACGTAACTATAACTTTGGGTCAATATAACAATATCAAGAAAATTCCA
GTTGATAGCAAAGTCACACTTGGGCTCTGTGCAGTATTAATTGTTTTAAT
TTCGGTTACTTGTTCAGTTGGATTTTGGAGCTATTTAAATGTTCCCATGA
CTCTAATCATACTTGAAGTTGTTCCGTTCTTGGTTCTTGCTGTTGGGGTT
GATAATTTGTTTATTTTGGTACAAACCTATCAGAGATATGATGAATATTA
CTCCAGTAAAAACTTGACTACCGAACAAAAAATTGCCCGTGTGGTGTCTA
AAGTTGGCCCTTCAATGCTTCTTAGCAGTCTTAGTGAATCGTTAGCATTC
TTTTGTGGTGTCATGACTGAAATGCCTGCGGTCAAAATATTTTCTCTTTA
CGCCGCTACAGCAGTTTTATTCGATTTTTTACTTCAAATCACGGTTTTGA
TCGCCGTTCTGATTCTGGATGCAAAACGTTCTGAAGCTATGCGAGTGGAT
GTGCTTTGTTGTGTGAGGATGAATAACGTGGTGACACCAGTCGATGCGGT
ACCGGTAGCTAAAGTTAAATACAGTGGAATTTTACATGAAATTTTTGATA
AATTTTACGCGCCAATGCTTTTTAAAACCCCAGTTCGTTTTCTTGTTGTG
ATATTTTTTGTTGGGTGGAACTTGTTTGCTTTGAGTCAGATTCATCTAAT
TCCGGTAGAACTGAATCAAAAGCTGTCCATGCCTAAGGATTCATATATGA
TTAATTATTTTGATGCTCTCGCTACTTATTTATCAGTTGGGCCTCCGGTT
TATTTTATTGTAAAAGATGGATACAATTACAAATCTGAAAACAGCCAAAA
TATGATCTGTGGTACCAGTGGTTGCAACGAGAAATCTTTATTGGGTCAAT
TGTTTATGGCAAGCCAGAATCCTAATGTAACATATATCTCTACGTCTGGT
GCTTCTTGGCTTGACGATTTCTTTATTTGGTCCAAACAAAGTGGTAATCC
TCCATGTTGTCGATTGTACCCAGATGGATCATTCTGTCCTGCGTCTGTAG
TTAATTCAACATGCAATAATTGCCCTGCCAATTTTACGGCAAAACATAGA
CCGGATGCTAAAGTTTTTGATGATTATTTAGCATTTTTTCTTACAAACAA
TCCCTCAATGCAATGTCCCAAGGGTGGCCACGCTGCTTATGGTCAAGCAG
TAAATATAAAAAATAAAGATGATAAATCTCATAAACCAGTGGAAATAGGA
GCAACATACTTTATGACATATCATACGATTTTGAAAACCCCTTCCGATTA
TACGGAAGCTTTGAAAAATTCAATAGAAATTGCCGCTTCAGTTACAGAAC
AGTTGAAGACGACTCTCGGTAATTCTAACCAATTTGAAGTCGTTCCTTAC
AGTGTATTTTATGTATTCTATGAGCAATACCTCACTGTGTTCAAGCAATT
ATGGATTCAACTCGGTGTTTGTTTGGGTGTCGTTTTGTTGGTGACTTTTG
TTTTATTGGGCCTGGATTGGAAGGCAACATTGATTTTGGGATTCCATATT
ATTTTAATAATGAATAGCATGTTTGGTTTCATGTATTTGTGGGGCATTCC
AATAAATGCTTTATCGATGGTCAATTTAGTCATGGCTATCGGCATAAGCG
TCGAATTTATTGCTCATATAGTTAGAGCTTATGTTGTTGAAAGATCAGAC
ACAAGAATTGAAAGAGCCAGAGAGGTTCTAGTGGAAATGGGAAGTTCAGT
GCTCAGTGGAATAACTTTAACGAAACTCGGTGGCATTATCGTTCTAGCGT
TCTCAAAATCGCAATTATTCCAAATCTTTTATTTTCGAATGTATCTGGGG
ATCGTTATCTTTGGTGCTGCACACGCAATCATATTTTTACCGGTTTTCCT
CAGTTTTTGTGGACCTGCGTTGAATAGAAAGAAAATTGTCGAGCAGAAAA
AACTCCTGGAAAAAATGCCAGAAAACAATTCATGGGGAAATTAAAATTCA
GATAATATATATATTTTCTTTATACCTCTCTTCAGACTGATATCAATATA
TTACTTTATAATTGTGTTATGTCACGGTGGTTTATAACTGTTACAATATC
TATTTCTGTATTTGATAAAAATATCTTATTATCTAATGGTTTATAAATAA
AGATATTATTTTTTTAAAA
back to top

protein sequence of SMED30027726-orf-1

>SMED30027726-orf-1 ID=SMED30027726-orf-1|Name=SMED30027726-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1284bp
MKNILIFSVLIILLSFIHCKNDKCIWYGQCDKSNPNKILNCNYTGPPKPL
NNATGFQTLTKLCPQYAKLDRNPSLCCNTDQLLTLDMQLSPASIIFGGCP
NCMRNFIRLYCALTCDPNQDNFVTVDTGYGGSIQAVTYNLNENFYQGLFN
SCDNVVLSSANSYAIDTVCGTTHEKCDPVAFYKALGDATSNAPFQINYLN
EVKGMNQTMLPCNMNGGEDDGEACSCQDCRASCPAPPPPQKPSKTFTILG
IDGWVFIVDIVFGAFFMIVISIYIFIYLKKNKYDKDYGNGIVPATPEVDD
ISTFDKCGAKVEAYLTLWFYRWGMFVARRCLIVLSVGIIIAMVLSLGIIL
KKVTTDPVELWSSPSSSARRNKDYFDENFGPFYRTEQIIIVPKDRTPFTW
INYDISARNLTYGPVFNIDLLRRVGTLINHISNMEVFSKLLNNYTKLEDI
CFKPLSPDYEKCAVMSVMQYFQNNITQLDRIVTDEFNLPIATYMDQIMEC
IKDPTNIKPTKFKEICNGDFGGPVFPYLAFGGFGDKKNYTDSTALVITFI
VNNALDQNSKQIKAALDWEKAFLNVVQNFSETNTDLHISYTAERSVQDEI
DRQSETDLFTIALSYIIMFTYVTITLGQYNNIKKIPVDSKVTLGLCAVLI
VLISVTCSVGFWSYLNVPMTLIILEVVPFLVLAVGVDNLFILVQTYQRYD
EYYSSKNLTTEQKIARVVSKVGPSMLLSSLSESLAFFCGVMTEMPAVKIF
SLYAATAVLFDFLLQITVLIAVLILDAKRSEAMRVDVLCCVRMNNVVTPV
DAVPVAKVKYSGILHEIFDKFYAPMLFKTPVRFLVVIFFVGWNLFALSQI
HLIPVELNQKLSMPKDSYMINYFDALATYLSVGPPVYFIVKDGYNYKSEN
SQNMICGTSGCNEKSLLGQLFMASQNPNVTYISTSGASWLDDFFIWSKQS
GNPPCCRLYPDGSFCPASVVNSTCNNCPANFTAKHRPDAKVFDDYLAFFL
TNNPSMQCPKGGHAAYGQAVNIKNKDDKSHKPVEIGATYFMTYHTILKTP
SDYTEALKNSIEIAASVTEQLKTTLGNSNQFEVVPYSVFYVFYEQYLTVF
KQLWIQLGVCLGVVLLVTFVLLGLDWKATLILGFHIILIMNSMFGFMYLW
GIPINALSMVNLVMAIGISVEFIAHIVRAYVVERSDTRIERAREVLVEMG
SSVLSGITLTKLGGIIVLAFSKSQLFQIFYFRMYLGIVIFGAAHAIIFLP
VFLSFCGPALNRKKIVEQKKLLEKMPENNSWGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004765NPC1-like
IPR003392Ptc/Disp
IPR000731SSD
IPR032190NPC1_N
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005319lipid transporter activity
Vocabulary: biological process
TermDefinition
GO:0006869lipid transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000731Sterol-sensing domainPFAMPF12349Sterol-sensingcoord: 637..792
e-value: 7.4E-51
score: 172.0
IPR000731Sterol-sensing domainPROSITEPS50156SSDcoord: 607..775
score: 40.787
NoneNo IPR availableGENE3DG3DSA:1.20.1640.10coord: 1062..1271
e-value: 1.2E-12
score: 49.5
NoneNo IPR availablePANTHERPTHR45727FAMILY NOT NAMEDcoord: 22..1271
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.897
NoneNo IPR availableSUPERFAMILYSSF82866Multidrug efflux transporter AcrB transmembrane domaincoord: 567..775
NoneNo IPR availableSUPERFAMILYSSF82866Multidrug efflux transporter AcrB transmembrane domaincoord: 1064..1257
NoneNo IPR availableTMHMMTMhelixcoord: 1203..1220
NoneNo IPR availableTMHMMTMhelixcoord: 753..775
NoneNo IPR availableTMHMMTMhelixcoord: 721..743
NoneNo IPR availableTMHMMTMhelixcoord: 255..277
NoneNo IPR availableTMHMMTMhelixcoord: 1102..1124
NoneNo IPR availableTMHMMTMhelixcoord: 1081..1098
NoneNo IPR availableTMHMMTMhelixcoord: 868..890
NoneNo IPR availableTMHMMTMhelixcoord: 643..665
NoneNo IPR availableTMHMMTMhelixcoord: 1131..1150
NoneNo IPR availableTMHMMTMhelixcoord: 670..692
NoneNo IPR availableTMHMMTMhelixcoord: 608..630
NoneNo IPR availableTMHMMTMhelixcoord: 831..853
NoneNo IPR availableTMHMMTMhelixcoord: 1160..1182
NoneNo IPR availableTMHMMTMhelixcoord: 331..350
NoneNo IPR availableTMHMMTMhelixcoord: 1235..1257
IPR004765NPC1-likeTIGRFAMTIGR00917TIGR00917coord: 24..1256
e-value: 0.0
score: 1233.9
IPR032190Niemann-Pick C1, N-terminalPFAMPF16414NPC1_Ncoord: 22..253
e-value: 2.2E-59
score: 201.0
IPR003392Protein patched/dispatchedPFAMPF02460Patchedcoord: 1064..1256
e-value: 1.2E-27
score: 96.4