slc25a-10

Overview
Nameslc25a-10 (AKN21578.1)
Smed IDSMED30027723
Length (bp)1230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-10 (SMED30027723) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-10 (SMED30027723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-10 (SMED30027723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-10 (SMED30027723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027723

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30027723h1SMcG0008034 dd_Smed_v4_11616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027723h1SMcG0008034 dd_Smed_v4_11616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-10 vs. Ensembl Human
Match: SLC25A42 (solute carrier family 25 member 42 [Source:HGNC Symbol;Acc:HGNC:28380])

HSP 1 Score: 230.72 bits (587), Expect = 2.960e-72
Identity = 130/296 (43.92%), Postives = 176/296 (59.46%), Query Frame = 2
Query:  179 LTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L+ S +S   ++ VL SLL G +AG +AKT +APLDR KI FQ + ++FS +     L  TY   GF  LWRGN+ATM RV PYA IQ+++H  YKR+L   S    + E      +  A      + A +     TYPLDL RARMAVT  + Y N+  V   + +EEGL   Y G  PT++G+IPYAG+ F  +E++K +   ++ R+     E  + G  AGL+GQ   YPLD++RRRMQT  VTG+P  S  + RT R I+  EG + GLYKG SMN +K P A  +SFT +
Sbjct:   20 LSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRIL--GSYYGFRGEALPPWPRLFAGALAGTTAASL-----TYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRAS--IARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVGISFTTF 306          
BLAST of slc25a-10 vs. Ensembl Human
Match: SLC25A16 (solute carrier family 25 member 16 [Source:HGNC Symbol;Acc:HGNC:10986])

HSP 1 Score: 185.652 bits (470), Expect = 9.212e-55
Identity = 112/306 (36.60%), Postives = 154/306 (50.33%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH-------------NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICS-EGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            L S L GGIAGC AKT +APLDR K+  Q  +  +    +   L    +  GF  L++GN A M R+FPY  IQ+ +   YK L+     I     R            + GS+AGMT+V+CTYPLD+ R R+A  V     Y  ++   + I  KE G   FYRG+ PTI+G+ PYAGV F  F ++K +  +H             N   + T    L GG+AG + Q   YP D+ RRRMQ G V    E    M  T + +    G+  GLY+G S+N I+   + AV+FT Y  +  +  L
Sbjct:   37 LRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR-----------LMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHL 331          
BLAST of slc25a-10 vs. Ensembl Human
Match: SLC25A24 (solute carrier family 25 member 24 [Source:HGNC Symbol;Acc:HGNC:20662])

HSP 1 Score: 155.606 bits (392), Expect = 3.231e-42
Identity = 95/291 (32.65%), Postives = 145/291 (49.83%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQTGP-VTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             LL GGIAG V++T  APLDR KI  Q    K     +        K  G   LWRGN   + ++ P   +++ ++  YK+LL  +   +   ER           FI GS+AG T+    YP+++ + R+AV    +Y  + D  + + K EGL AFY+G  P ++GIIPYAG+   V+E +K     +  +        +    G ++   GQ   YPL ++R RMQ    + G P+   NM   FR I S+  I GLY+G + N +K   A  +S+ VY ++   +G+
Sbjct:  178 QLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFER-----------FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQL--NMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGV 455          
BLAST of slc25a-10 vs. Ensembl Human
Match: SLC25A24 (solute carrier family 25 member 24 [Source:HGNC Symbol;Acc:HGNC:20662])

HSP 1 Score: 155.606 bits (392), Expect = 3.231e-42
Identity = 95/291 (32.65%), Postives = 145/291 (49.83%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQTGP-VTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             LL GGIAG V++T  APLDR KI  Q    K     +        K  G   LWRGN   + ++ P   +++ ++  YK+LL  +   +   ER           FI GS+AG T+    YP+++ + R+AV    +Y  + D  + + K EGL AFY+G  P ++GIIPYAG+   V+E +K     +  +        +    G ++   GQ   YPL ++R RMQ    + G P+   NM   FR I S+  I GLY+G + N +K   A  +S+ VY ++   +G+
Sbjct:  178 QLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFER-----------FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQL--NMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGV 455          
BLAST of slc25a-10 vs. Ensembl Human
Match: SLC25A24 (solute carrier family 25 member 24 [Source:HGNC Symbol;Acc:HGNC:20662])

HSP 1 Score: 155.992 bits (393), Expect = 3.352e-42
Identity = 95/291 (32.65%), Postives = 145/291 (49.83%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQTGP-VTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             LL GGIAG V++T  APLDR KI  Q    K     +        K  G   LWRGN   + ++ P   +++ ++  YK+LL  +   +   ER           FI GS+AG T+    YP+++ + R+AV    +Y  + D  + + K EGL AFY+G  P ++GIIPYAG+   V+E +K     +  +        +    G ++   GQ   YPL ++R RMQ    + G P+   NM   FR I S+  I GLY+G + N +K   A  +S+ VY ++   +G+
Sbjct:  197 QLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFER-----------FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQL--NMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGV 474          
BLAST of slc25a-10 vs. Ensembl Celegans
Match: slc-25A42 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q93717])

HSP 1 Score: 238.424 bits (607), Expect = 5.868e-76
Identity = 130/291 (44.67%), Postives = 176/291 (60.48%), Query Frame = 2
Query:  215 DVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQK-FSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMG 1084
             V+ SL  G IAG +AKT IAPLDR KI FQ +  + +SFR+ I+F+  TY+ NGF  L+RGN+ATM+RV PYA +Q+ +   YK+LLKVD    +   ++          +I GSLA  T+ + TYPLD A+AR++V+S  +Y +L  V     KE G+   YRGI PTI+G+IPYAG  F  +E++K +   H      +    L G +AGL+GQ   YPLDI+RRRMQTG +   P     +     I  +EGL  GLYKG SMN +K P A  VSFT Y  + + +G
Sbjct:   13 SVVLSLSAGAIAGALAKTTIAPLDRTKIYFQVSSTRGYSFRSAIKFIKLTYRENGFFALYRGNSATMARVVPYASMQFAAFEQYKKLLKVDENGSRTPVKR----------YITGSLAATTATMITYPLDTAKARLSVSSKLQYSSLKHVFVKTYKEGGIQLLYRGIYPTILGVIPYAGSSFFTYETLKIMYRDHRGEVENSYYRMLFGMLAGLIGQSSSYPLDIVRRRMQTGRI---PSGWSPLRALIHIYHTEGLKRGLYKGLSMNWLKGPIAVGVSFTTYEKVLELVG 290          
BLAST of slc25a-10 vs. Ensembl Celegans
Match: F55A11.4 (pep chromosome:WBcel235:V:11771248:11773490:1 gene:WBGene00010077.1 transcript:F55A11.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F55A11.4)

HSP 1 Score: 126.716 bits (317), Expect = 1.125e-31
Identity = 83/297 (27.95%), Postives = 145/297 (48.82%), Query Frame = 2
Query:  230 LLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIA-FNFIC-GSLAGMTSVLCTYPLDLARARMAVTSIKKYGNL----LDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGLRV 1093
            L+ GG AG V++T  AP DR K+  Q    K +   ++  L   +   G    WRGN   + ++ P + I++  +   KRL++      KK+      N++I+ F  +C GS AG  S    YP+++ + R+A   ++K G L    +     M  +EG+  FY+G  P +IGIIPYAG+   ++E++K     +   N+ +         G  +   GQ   YP  ++R R+Q   +T +      M+  F+ I     + G Y+G + N +K   A ++S+ VY  +   +G+++
Sbjct:  252 LVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLGVMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQ------KKKG-----NEEISTFERLCAGSAAGAISQSTIYPMEVMKTRLA---LRKTGQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPYAGIDLAIYETLKRTYVRYYETNSSEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITRYSPQPDTMFGQFKYILQNEGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGVKM 534          

HSP 2 Score: 73.559 bits (179), Expect = 5.977e-14
Identity = 52/203 (25.62%), Postives = 97/203 (47.78%), Query Frame = 2
Query:  482 DSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIK--KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHN-NRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRM---QTGPVT-GHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            DS I +   +Q M       + + G  AG  S  CT P D  +  + V S K  + G ++  L+++  E G+ +F+RG    +I I P + + F+ ++ +K ++     N +++T E   +G  AG + Q   YP+++++ R+   +TG +  G   ++  M+    I C        YKG+  NLI     + +   +Y +L
Sbjct:  231 DSQIPEDFSQQEMQEGIWWRHLVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLG-VMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNEEISTFERLCAGSAAGAISQSTIYPMEVMKTRLALRKTGQLDRGIIHFAHKMYTKEGIRC-------FYKGYLPNLIGIIPYAGIDLAIYETL 425          
BLAST of slc25a-10 vs. Ensembl Celegans
Match: F55A11.4 (pep chromosome:WBcel235:V:11770456:11773494:1 gene:WBGene00010077.1 transcript:F55A11.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F55A11.4)

HSP 1 Score: 126.716 bits (317), Expect = 1.125e-31
Identity = 83/297 (27.95%), Postives = 145/297 (48.82%), Query Frame = 2
Query:  230 LLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIA-FNFIC-GSLAGMTSVLCTYPLDLARARMAVTSIKKYGNL----LDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGLRV 1093
            L+ GG AG V++T  AP DR K+  Q    K +   ++  L   +   G    WRGN   + ++ P + I++  +   KRL++      KK+      N++I+ F  +C GS AG  S    YP+++ + R+A   ++K G L    +     M  +EG+  FY+G  P +IGIIPYAG+   ++E++K     +   N+ +         G  +   GQ   YP  ++R R+Q   +T +      M+  F+ I     + G Y+G + N +K   A ++S+ VY  +   +G+++
Sbjct:  252 LVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLGVMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQ------KKKG-----NEEISTFERLCAGSAAGAISQSTIYPMEVMKTRLA---LRKTGQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPYAGIDLAIYETLKRTYVRYYETNSSEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITRYSPQPDTMFGQFKYILQNEGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGVKM 534          

HSP 2 Score: 73.559 bits (179), Expect = 5.977e-14
Identity = 52/203 (25.62%), Postives = 97/203 (47.78%), Query Frame = 2
Query:  482 DSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIK--KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHN-NRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRM---QTGPVT-GHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            DS I +   +Q M       + + G  AG  S  CT P D  +  + V S K  + G ++  L+++  E G+ +F+RG    +I I P + + F+ ++ +K ++     N +++T E   +G  AG + Q   YP+++++ R+   +TG +  G   ++  M+    I C        YKG+  NLI     + +   +Y +L
Sbjct:  231 DSQIPEDFSQQEMQEGIWWRHLVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLG-VMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNEEISTFERLCAGSAAGAISQSTIYPMEVMKTRLALRKTGQLDRGIIHFAHKMYTKEGIRC-------FYKGYLPNLIGIIPYAGIDLAIYETL 425          
BLAST of slc25a-10 vs. Ensembl Celegans
Match: C47E12.2 (pep chromosome:WBcel235:IV:10001972:10003348:-1 gene:WBGene00008147.1 transcript:C47E12.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C47E12.2)

HSP 1 Score: 119.783 bits (299), Expect = 1.119e-30
Identity = 83/297 (27.95%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQT--------TDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVT----SIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
             LL GG++  V+KTV+AP++R KI  Q          D++++   +I+  +   K  GF   WRGN   + R FP     +  +  YK      SI+LK  +R+  +        + G LAG +S+   YPLD  R R++      + ++Y  L+D      K EG  A YRG   ++     Y  V F ++++I++ + T + +K+    +F       ++  +  YP D +RRRM    V G    S+      +I+  EG + GLYKG   N+ ++    A+   +Y  +  +M
Sbjct:   24 DLLIGGVSASVSKTVVAPIERVKILLQVQYSHKDIPADKRYN--GIIDAFVRVPKEQGFVSFWRGNMTNVIRYFPTQAFNFAFNDLYK------SILLKNMKRENNVLSYSVRTLVSGGLAGCSSLCIVYPLDFIRTRLSADINHHTKREYKGLVDCTMKTVKNEGFSALYRGFAISLQTYFIYRSVYFGLYDAIRNTINT-DKKKLPFYASFAIAQGVTVLSSYLTYPWDTVRRRMM---VKGQLSTSKAFSAARKIVHEEG-VRGLYKGALANIFRS-AGGALVMALYEEIHKHM 306          
BLAST of slc25a-10 vs. Ensembl Celegans
Match: C47E12.2 (pep chromosome:WBcel235:IV:10001974:10003534:-1 gene:WBGene00008147.1 transcript:C47E12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C47E12.2)

HSP 1 Score: 119.783 bits (299), Expect = 1.119e-30
Identity = 83/297 (27.95%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQT--------TDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVT----SIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
             LL GG++  V+KTV+AP++R KI  Q          D++++   +I+  +   K  GF   WRGN   + R FP     +  +  YK      SI+LK  +R+  +        + G LAG +S+   YPLD  R R++      + ++Y  L+D      K EG  A YRG   ++     Y  V F ++++I++ + T + +K+    +F       ++  +  YP D +RRRM    V G    S+      +I+  EG + GLYKG   N+ ++    A+   +Y  +  +M
Sbjct:   24 DLLIGGVSASVSKTVVAPIERVKILLQVQYSHKDIPADKRYN--GIIDAFVRVPKEQGFVSFWRGNMTNVIRYFPTQAFNFAFNDLYK------SILLKNMKRENNVLSYSVRTLVSGGLAGCSSLCIVYPLDFIRTRLSADINHHTKREYKGLVDCTMKTVKNEGFSALYRGFAISLQTYFIYRSVYFGLYDAIRNTINT-DKKKLPFYASFAIAQGVTVLSSYLTYPWDTVRRRMM---VKGQLSTSKAFSAARKIVHEEG-VRGLYKGALANIFRS-AGGALVMALYEEIHKHM 306          
BLAST of slc25a-10 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0344280)

HSP 1 Score: 224.557 bits (571), Expect = 1.139e-69
Identity = 132/292 (45.21%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQT-TDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPV--TGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            V+ SL+ G  AG +AKTVIAPLDR KINFQ   D  FSFRA + +L NTY   G   LWRGN+ATM+R+ PYA IQ+T+H  ++R+L VD      + R+          F+ GSLAG+TS   TYPLDLARARMAVT     Y  L  V   +  EEG    +RG   T++G+IPYAG  F  +E++K       N K  T  +   G  AG  GQ   YPLDI+RRRMQT  V   G   Y   +    +I   EG+ +G YKG SMN IK P A  +SF+ Y  +  ++
Sbjct:   72 VVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRR----------FLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 353          
BLAST of slc25a-10 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0344282)

HSP 1 Score: 222.631 bits (566), Expect = 7.548e-69
Identity = 132/293 (45.05%), Postives = 169/293 (57.68%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQT-TDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIK-DIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPV--TGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            V+ SL+ G  AG +AKTVIAPLDR KINFQ   D  FSFRA + +L NTY   G   LWRGN+ATM+R+ PYA IQ+T+H  ++R+L VD      + R+          F+ GSLAG+TS   TYPLDLARARMAVT     Y  L  V   +  EEG    +RG   T++G+IPYAG  F  +E++K +      N K  T  +   G  AG  GQ   YPLDI+RRRMQT  V   G   Y   +    +I   EG+ +G YKG SMN IK P A  +SF+ Y  +  ++
Sbjct:   72 VVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRR----------FLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354          
BLAST of slc25a-10 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0089482)

HSP 1 Score: 222.631 bits (566), Expect = 7.548e-69
Identity = 132/293 (45.05%), Postives = 169/293 (57.68%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQT-TDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIK-DIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPV--TGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            V+ SL+ G  AG +AKTVIAPLDR KINFQ   D  FSFRA + +L NTY   G   LWRGN+ATM+R+ PYA IQ+T+H  ++R+L VD      + R+          F+ GSLAG+TS   TYPLDLARARMAVT     Y  L  V   +  EEG    +RG   T++G+IPYAG  F  +E++K +      N K  T  +   G  AG  GQ   YPLDI+RRRMQT  V   G   Y   +    +I   EG+ +G YKG SMN IK P A  +SF+ Y  +  ++
Sbjct:   72 VVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRR----------FLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354          
BLAST of slc25a-10 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0089480)

HSP 1 Score: 222.631 bits (566), Expect = 7.548e-69
Identity = 132/293 (45.05%), Postives = 169/293 (57.68%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQT-TDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIK-DIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPV--TGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            V+ SL+ G  AG +AKTVIAPLDR KINFQ   D  FSFRA + +L NTY   G   LWRGN+ATM+R+ PYA IQ+T+H  ++R+L VD      + R+          F+ GSLAG+TS   TYPLDLARARMAVT     Y  L  V   +  EEG    +RG   T++G+IPYAG  F  +E++K +      N K  T  +   G  AG  GQ   YPLDI+RRRMQT  V   G   Y   +    +I   EG+ +G YKG SMN IK P A  +SF+ Y  +  ++
Sbjct:   72 VVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRR----------FLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354          
BLAST of slc25a-10 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0344281)

HSP 1 Score: 217.238 bits (552), Expect = 9.991e-68
Identity = 129/289 (44.64%), Postives = 166/289 (57.44%), Query Frame = 2
Query:  230 LLFGGIAGCVAKTVIAPLDRAKINFQ-TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIK-DIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPV--TGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            ++ G  AG +AKTVIAPLDR KINFQ   D  FSFRA + +L NTY   G   LWRGN+ATM+R+ PYA IQ+T+H  ++R+L VD      + R+          F+ GSLAG+TS   TYPLDLARARMAVT     Y  L  V   +  EEG    +RG   T++G+IPYAG  F  +E++K +      N K  T  +   G  AG  GQ   YPLDI+RRRMQT  V   G   Y   +    +I   EG+ +G YKG SMN IK P A  +SF+ Y  +  ++
Sbjct:    1 MISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRR----------FLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 279          
BLAST of slc25a-10 vs. Ensembl Zebrafish
Match: slc25a42 (solute carrier family 25 member 42 [Source:NCBI gene;Acc:751743])

HSP 1 Score: 241.506 bits (615), Expect = 1.657e-76
Identity = 128/296 (43.24%), Postives = 168/296 (56.76%), Query Frame = 2
Query:  188 SSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMT-TTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
             S   +  + VL SL+ G  AG VAKT +APLDR KI FQ +  +FS +     +  TY  +GF  LWRGN+ATM RV PYA IQ+ +H  YK +L          L    R            + GSLAG T+ + TYPLD+ RARMAVT  + Y N++DV   + +EEGL   YRG  PTI+G++PYAG+ F  +E++K        R      E  + G  AGL+GQ   YPLD++RRRMQT  VTGH  YS  +     I+  EG++ GLYKG SMN +K P A  +SF  +
Sbjct:   30 QSEGFKQGRSVLNSLVSGAFAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYLKDGFFSLWRGNSATMVRVIPYAAIQFCAHEQYKGILGKYYGFQGKALPPVPR-----------LLAGSLAGTTAAIITYPLDMVRARMAVTPKEMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETLKKTHAEKTGRAHPFPYERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGH-TYSTVLGTMREIVAEEGIVRGLYKGLSMNWVKGPIAVGISFMTF 313          

HSP 2 Score: 69.707 bits (169), Expect = 8.585e-13
Identity = 46/182 (25.27%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  542 NFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRK---EEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            + + G+ AG  +     PLD  +    V+S +      +  R++ +   ++G  + +RG + T++ +IPYA + F   E  K I+  +     + +      L+G +AG       YPLD++R RM   P     E   N+   F  I  E  +  LY+GF+  ++     + +SF  Y +L
Sbjct:   43 SLVSGAFAGAVAKTAVAPLDRTKIIFQVSSNRFSAK--EAYRLIYRTYLKDGFFSLWRGNSATMVRVIPYAAIQFCAHEQYKGILGKYYGFQGKALPPVPRLLAGSLAGTTAAIITYPLDMVRARMAVTP----KEMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETL 218          
BLAST of slc25a-10 vs. Ensembl Zebrafish
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 186.808 bits (473), Expect = 1.882e-55
Identity = 114/317 (35.96%), Postives = 162/317 (51.10%), Query Frame = 2
Query:  170 VNELTKSSTSVEVNKDVLF---SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRK-------------MTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            V+   +      V +D  +   S   GG+AGC AK+ IAPLDR KI  Q  +  +    +   L    K  GF  L++GN A M R+FPY  IQ+ +   YK+ L     I     R            + GS+AGMT+V+CTYPLD+ RAR+A  VT   +Y  +    + I  KE G+  FYRG+ PTIIG+ PYAG  F  F ++K +  TH   +             + T    L GG+AG + Q   YPLD+ RRRMQ G      +   ++ +T + + S+ G+  GLY+G S+N I+   + AV+FT Y
Sbjct:    6 VSSGARPQIPAPVQRDGYYWLRSFTAGGVAGCCAKSTIAPLDRVKILLQAQNPHYKHLGVFATLKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHR-----------LMAGSMAGMTAVICTYPLDVIRARLAFQVTGHHRYTGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKTLGLTHFPEQLGKPSLDNPDVLVLKTQVNLLCGGVAGAIAQTISYPLDVARRRMQLGASLPDHDKCCSLTKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTY 311          

HSP 2 Score: 73.1738 bits (178), Expect = 6.037e-14
Identity = 53/183 (28.96%), Postives = 83/183 (45.36%), Query Frame = 2
Query:  542 NFICGSLAGMTSVLCTYPLDLARARMAVTSIK-KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTT------HNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +F  G +AG  +     PLD  +  +   +   K+  +   L+ + K+EG L  Y+G    +I I PY  + F+ F++ K  + T      H +R M       +G +AG+    C YPLD+IR R+    VTGH  Y+        I   EG I G Y+G    +I     +  SF  + +L
Sbjct:   28 SFTAGGVAGCCAKSTIAPLDRVKILLQAQNPHYKHLGVFATLKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHRLM-------AGSMAGMTAVICTYPLDVIRARLAF-QVTGHHRYTGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTL 202          
BLAST of slc25a-10 vs. Ensembl Zebrafish
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 186.422 bits (472), Expect = 2.231e-55
Identity = 113/317 (35.65%), Postives = 162/317 (51.10%), Query Frame = 2
Query:  170 VNELTKSSTSVEVNKDVLF---SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRK-------------MTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            V+   +      V +D  +   S   GG+AGC AK+ IAPLDR KI  Q  +  +    +   +    K  GF  L++GN A M R+FPY  IQ+ +   YK+ L     I     R            + GS+AGMT+V+CTYPLD+ RAR+A  VT   +Y  +    + I  KE G+  FYRG+ PTIIG+ PYAG  F  F ++K +  TH   +             + T    L GG+AG + Q   YPLD+ RRRMQ G      +   ++ +T + + S+ G+  GLY+G S+N I+   + AV+FT Y
Sbjct:    6 VSSGARPQIPAPVQRDGYYWLRSFTAGGVAGCCAKSTIAPLDRVKILLQAQNPHYKHLGVFATIKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHR-----------LMAGSMAGMTAVICTYPLDVIRARLAFQVTGHHRYSGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKTLGLTHFPEQLGKPSLDNPDVLVLKTQVNLLCGGVAGAIAQTISYPLDVARRRMQLGASLPDHDKCCSLTKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTY 311          

HSP 2 Score: 73.559 bits (179), Expect = 4.968e-14
Identity = 53/183 (28.96%), Postives = 83/183 (45.36%), Query Frame = 2
Query:  542 NFICGSLAGMTSVLCTYPLDLARARMAVTSIK-KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTT------HNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +F  G +AG  +     PLD  +  +   +   K+  +   ++ + K+EG L  Y+G    +I I PY  + F+ F++ K  + T      H +R M       +G +AG+    C YPLD+IR R+    VTGH  YS        I   EG I G Y+G    +I     +  SF  + +L
Sbjct:   28 SFTAGGVAGCCAKSTIAPLDRVKILLQAQNPHYKHLGVFATIKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHRLM-------AGSMAGMTAVICTYPLDVIRARLAF-QVTGHHRYSGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTL 202          
BLAST of slc25a-10 vs. Ensembl Zebrafish
Match: slc25a24 (solute carrier family 25 member 24 [Source:NCBI gene;Acc:447867])

HSP 1 Score: 154.066 bits (388), Expect = 1.137e-41
Identity = 90/291 (30.93%), Postives = 148/291 (50.86%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             L  GG+AG V++T  APLDR K+  Q    K +  +++       K  G   LWRGN   + ++ P   I++ ++  YK+LL  D   ++  ER           F+ GSLAG T+    YP+++ + R+ +    +Y  + D  + + ++EG+ AFY+G  P I+GIIPYAG+   V+E++K+   +H  +        +    G I+   GQ   YPL +IR RMQ    + G  + S +     +I+  EG   GLY+G   N +K   A ++S+ VY  +   +G+
Sbjct:  198 QLAAGGVAGAVSRTGTAPLDRMKVFMQVHSSKTNKISLVNGFKQMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSKDGGKVQSHER-----------FMAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPYAGIDLAVYETLKNTWLSHYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAMASMEGSEQVSMSKL-VKKIMQKEGFF-GLYRGILPNFMKVIPAVSISYVVYEYMRSGLGI 475          
BLAST of slc25a-10 vs. Ensembl Zebrafish
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 149.058 bits (375), Expect = 6.861e-40
Identity = 92/297 (30.98%), Postives = 151/297 (50.84%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLK--VDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            V   L+ G +AG V++T  APLDR K+  Q   Q      +   L    K  G   LWRGN   + ++ P   I++ ++   KRL++   +   LK  ER           F+ GSLAG T+    YP+++ + R+ +    +Y ++ D  + + ++EG+ AFY+G  P ++GIIPYAG+   V+E++K+     +          +    G ++   GQ   YPL +IR RMQ    + G P+ S  M   FR I+  EG++ GLY+G + N +K   A ++S+ VY  +   +G+
Sbjct:  193 VWRQLMAGAVAGSVSRTGTAPLDRLKVFLQVHGQSSDKGNVWSGLRAMVKEGGLTALWRGNGINVLKIAPETAIKFLAYEQIKRLMRGSNEGGTLKVHER-----------FVAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSSVADCAKQILQKEGVRAFYKGYLPNMLGIIPYAGIDLAVYETLKNAWLQRHTEGSADPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQAQASIKGAPQLS--MLTLFRSIVAQEGVV-GLYRGIAPNFLKVIPAVSISYVVYEHMRKVLGV 475          
BLAST of slc25a-10 vs. Ensembl Xenopus
Match: cep152 (centrosomal protein 152kDa [Source:Xenbase;Acc:XB-GENE-988609])

HSP 1 Score: 251.136 bits (640), Expect = 5.270e-80
Identity = 131/289 (45.33%), Postives = 170/289 (58.82%), Query Frame = 2
Query:  209 NKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLK----VDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            +K +L SL+ G +AG VAKT +APLDR KI FQ +  +FS +     +  TY   GF  LWRGN+ATM RV PYA IQ+ +H  YK+LL          L    R            + G+LAG T+ + TYPLDL RARMAVT  + Y N++ V   M +EEGL + YRG  PT++G+IPYAG+ F  +E++K +   H+ R      E  L G  AGL GQ   YPLD++RRRMQT  VTGH  Y   +     I+  EG+I GLYKG SMN +K P A  +SFT +
Sbjct:   38 HKSILNSLMSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYLNEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPR-----------LLAGALAGTTATIITYPLDLVRARMAVTPKEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETLKKLHAEHSGRTQPYPFERLLFGACAGLFGQSASYPLDVVRRRMQTAGVTGH-AYGSIIGTMQEIVAEEGVIRGLYKGLSMNWVKGPVAVGISFTTF 314          

HSP 2 Score: 75.485 bits (184), Expect = 1.453e-14
Identity = 50/188 (26.60%), Postives = 88/188 (46.81%), Query Frame = 2
Query:  524 NKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRK---EEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +K I  + + G+LAG  +     PLD  +    V+S +      +  R++ +    EG L+ +RG + T++ +IPYA + F   E  K ++ ++       +T     L+G +AG       YPLD++R RM   P     E   N+   F  +  E  +  LY+GF+  ++     + +SF  Y +L
Sbjct:   38 HKSILNSLMSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAK--EAYRLIYRTYLNEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRLLAGALAGTTATIITYPLDLVRARMAVTP----KEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETL 219          
BLAST of slc25a-10 vs. Ensembl Xenopus
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:100216243])

HSP 1 Score: 190.274 bits (482), Expect = 9.720e-57
Identity = 115/319 (36.05%), Postives = 169/319 (52.98%), Query Frame = 2
Query:  173 NELTKSSTSVEVNKDV------LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH----------NNRK---MTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIIC-SEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            +E+T SS+   + K        L S + GG+A C AKT IAPLDR KI  Q  +  +    ++       K  GF  L++GN A M R+FPY  IQ+ +   YK++LK   I   +   +LM           GS+AG+T+V+ TYPLD+ RAR+A  V    +Y  ++   + I  KE G+  +YRG+ PTI+G+ PYAG  F  FE++K     H          +N     + T  + L GGIAG + Q   YPLD+ RRRMQ   +    +  + M++T + +C   G+  GLY+G S+N I+   + AV+FT Y
Sbjct:    3 SEVTVSSSGANLPKPAYKEYYWLRSFVAGGVASCCAKTTIAPLDRIKILLQAQNVHYRHLGILATAFAVQKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDKYKKVLKKRFIKHSEHVPRLM----------AGSMAGITAVIFTYPLDMVRARLAFQVKGEHRYNGIIHAFKTIYLKEGGIRGYYRGLVPTIVGMAPYAGFSFFTFETLKTAGLRHAPELLGKPSSDNPDVMVLKTHASLLCGGIAGAIAQSISYPLDVTRRRMQLSAILPDSDKCRTMFQTLKYVCMQHGIRRGLYRGLSLNYIRCIPSQAVAFTTY 311          
BLAST of slc25a-10 vs. Ensembl Xenopus
Match: slc25a24 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 [Source:NCBI gene;Acc:496457])

HSP 1 Score: 154.066 bits (388), Expect = 4.862e-42
Identity = 94/291 (32.30%), Postives = 146/291 (50.17%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             LL GG+AG V++T  APLDR K+  Q    K +   +I  L    K  G   LWRGN   + ++ P   +++ ++  YK+L   +S  L   ER           FI GSLAG T+    YP+++ + R+AV    +Y  + D  + + + EG+ AFY+G  P I+GIIPYAG+   ++E++K     +           +    G  +   GQ   YPL +IR RMQ    + G P+   NM   FR I ++    GLY+G + N +K   A ++S+ VY  +   +G+
Sbjct:  135 QLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNAN-IITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAER-----------FIAGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQL--NMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI 411          
BLAST of slc25a-10 vs. Ensembl Xenopus
Match: slc25a24 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 [Source:NCBI gene;Acc:496457])

HSP 1 Score: 154.066 bits (388), Expect = 5.450e-42
Identity = 94/291 (32.30%), Postives = 146/291 (50.17%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             LL GG+AG V++T  APLDR K+  Q    K +   +I  L    K  G   LWRGN   + ++ P   +++ ++  YK+L   +S  L   ER           FI GSLAG T+    YP+++ + R+AV    +Y  + D  + + + EG+ AFY+G  P I+GIIPYAG+   ++E++K     +           +    G  +   GQ   YPL +IR RMQ    + G P+   NM   FR I ++    GLY+G + N +K   A ++S+ VY  +   +G+
Sbjct:  143 QLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNAN-IITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAER-----------FIAGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQL--NMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI 419          
BLAST of slc25a-10 vs. Ensembl Xenopus
Match: slc25a24 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 [Source:NCBI gene;Acc:496457])

HSP 1 Score: 154.451 bits (389), Expect = 6.208e-42
Identity = 94/291 (32.30%), Postives = 146/291 (50.17%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             LL GG+AG V++T  APLDR K+  Q    K +   +I  L    K  G   LWRGN   + ++ P   +++ ++  YK+L   +S  L   ER           FI GSLAG T+    YP+++ + R+AV    +Y  + D  + + + EG+ AFY+G  P I+GIIPYAG+   ++E++K     +           +    G  +   GQ   YPL +IR RMQ    + G P+   NM   FR I ++    GLY+G + N +K   A ++S+ VY  +   +G+
Sbjct:  157 QLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNAN-IITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAER-----------FIAGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQL--NMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI 433          
BLAST of slc25a-10 vs. Ensembl Mouse
Match: Slc25a42 (solute carrier family 25, member 42 [Source:MGI Symbol;Acc:MGI:1920345])

HSP 1 Score: 223.402 bits (568), Expect = 1.284e-69
Identity = 129/300 (43.00%), Postives = 169/300 (56.33%), Query Frame = 2
Query:  179 LTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L  + +S   ++ VL SLL G +AG +AKT +APLDR KI FQ + ++FS +     L  TY   GF  LWRGN+ATM RV PYA IQ+++H  YKR+L          L    R L                  T+   TYPLDL RARMAVT  + Y N+  V   + +EEGL   Y G  PT++G+IPYAG+ F  +ES+K +   ++ R      E  + G  AGL+GQ   YPLD++RRRMQT  VTGH   S  +  T R I+  EG + GLYKG SMN +K P A  +SFT +
Sbjct:   20 LAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAG-----------TTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGS--ILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTF 306          
BLAST of slc25a-10 vs. Ensembl Mouse
Match: Slc25a42 (solute carrier family 25, member 42 [Source:MGI Symbol;Acc:MGI:1920345])

HSP 1 Score: 223.402 bits (568), Expect = 1.284e-69
Identity = 129/300 (43.00%), Postives = 169/300 (56.33%), Query Frame = 2
Query:  179 LTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L  + +S   ++ VL SLL G +AG +AKT +APLDR KI FQ + ++FS +     L  TY   GF  LWRGN+ATM RV PYA IQ+++H  YKR+L          L    R L                  T+   TYPLDL RARMAVT  + Y N+  V   + +EEGL   Y G  PT++G+IPYAG+ F  +ES+K +   ++ R      E  + G  AGL+GQ   YPLD++RRRMQT  VTGH   S  +  T R I+  EG + GLYKG SMN +K P A  +SFT +
Sbjct:   20 LAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAG-----------TTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGS--ILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTF 306          
BLAST of slc25a-10 vs. Ensembl Mouse
Match: Slc25a16 (solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16 [Source:MGI Symbol;Acc:MGI:1920382])

HSP 1 Score: 183.726 bits (465), Expect = 4.178e-54
Identity = 109/306 (35.62%), Postives = 157/306 (51.31%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH-------------NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            L S L GGIAGC AKT +APLDR K+  Q  ++ +    ++  L    +  G+  L++GN A M R+FPY  IQ+ +   YK  +     +     R            + GS+AGMT+V+CTYPLD+ R R+A  V     Y  ++   + I  KE G L FYRG+ PTI+G+ PYAGV F  F ++K +  ++             N   + T    L GG+AG + Q   YP D+ RRRMQ G V    E    M  T + +  + G+  GLY+G S+N I+   + AV+FT Y  +  +  L
Sbjct:   37 LRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNRHYKHLGVLSTLRAVPQKEGYLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTFITTKLGVSGHVHR-----------LMAGSMAGMTAVICTYPLDVVRVRLAFQVKGEHTYSGIIHAFKTIYAKEGGFLGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSYAPALLGRPSSDNPNVLVLKTHINLLCGGVAGAIAQTISYPFDVTRRRMQLGAVLPEFEKCLTMRETMKYVYGQHGIRRGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHL 331          
BLAST of slc25a-10 vs. Ensembl Mouse
Match: Slc25a16 (solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16 [Source:MGI Symbol;Acc:MGI:1920382])

HSP 1 Score: 174.481 bits (441), Expect = 9.716e-51
Identity = 106/297 (35.69%), Postives = 152/297 (51.18%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAG---MTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH-------------NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSF 1051
            L S L GGIAGC AKT +APLDR K+  Q  ++ +    ++  L    +  G+  L++GN A M R+FPY  IQ+ +   YK  +     +     R            + GS+AG   MT+V+CTYPLD+ R R+A  V     Y  ++   + I  KE G L FYRG+ PTI+G+ PYAGV F  F ++K +  ++             N   + T    L GG+AG + Q   YP D+ RRRMQ G V    E    M  T + +  + G+  GLY+G S+N I+   + AV+F
Sbjct:   37 LRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNRHYKHLGVLSTLRAVPQKEGYLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTFITTKLGVSGHVHR-----------LMAGSMAGKMSMTAVICTYPLDVVRVRLAFQVKGEHTYSGIIHAFKTIYAKEGGFLGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSYAPALLGRPSSDNPNVLVLKTHINLLCGGVAGAIAQTISYPFDVTRRRMQLGAVLPEFEKCLTMRETMKYVYGQHGIRRGLYRGLSLNYIRCIPSQAVAF 322          

HSP 2 Score: 71.2478 bits (173), Expect = 3.410e-13
Identity = 55/186 (29.57%), Postives = 84/186 (45.16%), Query Frame = 2
Query:  542 NFICGSLAGMTSVLCTYPLDLARARM-AVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTT------HNNRKMTTTETFLSGGIAGLMGQ---FCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +F+ G +AG  +     PLD  +  + A     K+  +L  LR + ++EG L  Y+G    +I I PY  + F+ FE  K  +TT      H +R M       +G +AG M      C YPLD++R R+    V G   YS  +     I   EG   G Y+G    ++     + VSF  + +L
Sbjct:   39 SFLAGGIAGCCAKTTVAPLDRVKVLLQAHNRHYKHLGVLSTLRAVPQKEGYLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTFITTKLGVSGHVHRLM-------AGSMAGKMSMTAVICTYPLDVVRVRLAF-QVKGEHTYSGIIHAFKTIYAKEGGFLGFYRGLMPTILGMAPYAGVSFFTFGTL 216          
BLAST of slc25a-10 vs. Ensembl Mouse
Match: Slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:MGI Symbol;Acc:MGI:1914222])

HSP 1 Score: 150.984 bits (380), Expect = 1.461e-40
Identity = 90/291 (30.93%), Postives = 149/291 (51.20%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             L+ G +AG V++T  APLDR K+  Q    K +   ++  L N  +  G   LWRGN   + ++ P + I++ ++   KR ++     L  +ER           F+ GSLAG T+    YP+++ + R+ +    +Y  LLD  + + + EG  AFYRG  P ++GIIPYAG+   V+E++K+      + +       +    G I+   GQ   YPL ++R RMQ    + G P+ S  M    R I S+  + GLY+G + N +K   A ++S+ VY ++   +G+
Sbjct:  187 QLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSLWRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQER-----------FVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNRWLQQYSHESANPGILVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGGPQVS--MVGLLRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGV 464          
BLAST of slc25a-10 vs. UniProt/SwissProt
Match: sp|Q5PQ27|S2542_XENLA (Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis OX=8355 GN=slc25a42 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 1.433e-80
Identity = 134/289 (46.37%), Postives = 170/289 (58.82%), Query Frame = 2
Query:  209 NKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLK----VDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            +K VL SL  G +AG VAKT +APLDR KI FQ +  +FS +     +  TY  +GF  LWRGN+ATM RV PYA IQ+ +H  YK+LL          L    R            + G+LAG T+ L TYPLDL RARMAVT  + Y N++ V   M +EEGL + YRG  PT++G+IPYAG+ F  +E++K +   H+ R    T E  L G  AGL GQ   YPLD++RRRMQT  VTGH  Y   +     I+  EG I GLYKG SMN +K P A  +SFT +
Sbjct:   33 HKSVLNSLTSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYMNDGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPR-----------LLAGALAGTTATLLTYPLDLVRARMAVTQKEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETLKKLHAEHSGRTQPYTFERLLFGACAGLFGQSSSYPLDVVRRRMQTAGVTGH-TYGSIIGTMQEIVAEEGFIRGLYKGLSMNWVKGPVAVGISFTTF 309          

HSP 2 Score: 72.0182 bits (175), Expect = 1.232e-12
Identity = 50/188 (26.60%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  524 NKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRK---EEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +K +  +   G+LAG  +     PLD  +    V+S +      +  R++ +    +G L+ +RG + T++ +IPYA + F   E  K ++ ++       +T     L+G +AG       YPLD++R RM    VT    YS N+   F  +  E  +  LY+GF+  ++     + +SF  Y +L
Sbjct:   33 HKSVLNSLTSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAK--EAYRLIYRTYMNDGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRLLAGALAGTTATLLTYPLDLVRARMA---VTQKEMYS-NIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETL 214          
BLAST of slc25a-10 vs. UniProt/SwissProt
Match: sp|Q05AQ3|S2542_XENTR (Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis OX=8364 GN=slc25a42 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.367e-79
Identity = 131/289 (45.33%), Postives = 170/289 (58.82%), Query Frame = 2
Query:  209 NKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLK----VDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            +K +L SL+ G +AG VAKT +APLDR KI FQ +  +FS +     +  TY   GF  LWRGN+ATM RV PYA IQ+ +H  YK+LL          L    R            + G+LAG T+ + TYPLDL RARMAVT  + Y N++ V   M +EEGL + YRG  PT++G+IPYAG+ F  +E++K +   H+ R      E  L G  AGL GQ   YPLD++RRRMQT  VTGH  Y   +     I+  EG+I GLYKG SMN +K P A  +SFT +
Sbjct:   33 HKSILNSLMSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYLNEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPR-----------LLAGALAGTTATIITYPLDLVRARMAVTPKEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETLKKLHAEHSGRTQPYPFERLLFGACAGLFGQSASYPLDVVRRRMQTAGVTGH-AYGSIIGTMQEIVAEEGVIRGLYKGLSMNWVKGPVAVGISFTTF 309          

HSP 2 Score: 75.8702 bits (185), Expect = 6.173e-14
Identity = 50/188 (26.60%), Postives = 88/188 (46.81%), Query Frame = 2
Query:  524 NKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRK---EEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +K I  + + G+LAG  +     PLD  +    V+S +      +  R++ +    EG L+ +RG + T++ +IPYA + F   E  K ++ ++       +T     L+G +AG       YPLD++R RM   P     E   N+   F  +  E  +  LY+GF+  ++     + +SF  Y +L
Sbjct:   33 HKSILNSLMSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAK--EAYRLIYRTYLNEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRLLAGALAGTTATIITYPLDLVRARMAVTP----KEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETL 214          
BLAST of slc25a-10 vs. UniProt/SwissProt
Match: sp|Q0P483|S2542_DANRE (Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.210e-75
Identity = 128/295 (43.39%), Postives = 168/295 (56.95%), Query Frame = 2
Query:  191 STSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMT-TTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            S   +  + VL SL+ G  AG VAKT +APLDR KI FQ +  +FS +     +  TY  +GF  LWRGN+ATM RV PYA IQ+ +H  YK +L          L    R            + GSLAG T+ + TYPLD+ RARMAVT  + Y N++DV   + +EEGL   YRG  PTI+G++PYAG+ F  +E++K        R      E  + G  AGL+GQ   YPLD++RRRMQT  VTGH  YS  +     I+  EG++ GLYKG SMN +K P A  +SF  +
Sbjct:   26 SEGFKQGRSVLNSLVSGAFAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYLKDGFFSLWRGNSATMVRVIPYAAIQFCAHEQYKGILGKYYGFQGKALPPVPR-----------LLAGSLAGTTAAIITYPLDMVRARMAVTPKEMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETLKKTHAEKTGRAHPFPYERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGH-TYSTVLGTMREIVAEEGIVRGLYKGLSMNWVKGPIAVGISFMTF 308          

HSP 2 Score: 69.707 bits (169), Expect = 7.356e-12
Identity = 46/182 (25.27%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  542 NFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRK---EEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            + + G+ AG  +     PLD  +    V+S +      +  R++ +   ++G  + +RG + T++ +IPYA + F   E  K I+  +     + +      L+G +AG       YPLD++R RM   P     E   N+   F  I  E  +  LY+GF+  ++     + +SF  Y +L
Sbjct:   38 SLVSGAFAGAVAKTAVAPLDRTKIIFQVSSNRFSAK--EAYRLIYRTYLKDGFFSLWRGNSATMVRVIPYAAIQFCAHEQYKGILGKYYGFQGKALPPVPRLLAGSLAGTTAAIITYPLDMVRARMAVTP----KEMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETL 213          
BLAST of slc25a-10 vs. UniProt/SwissProt
Match: sp|Q86VD7|S2542_HUMAN (Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens OX=9606 GN=SLC25A42 PE=1 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 1.422e-71
Identity = 130/296 (43.92%), Postives = 176/296 (59.46%), Query Frame = 2
Query:  179 LTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L+ S +S   ++ VL SLL G +AG +AKT +APLDR KI FQ + ++FS +     L  TY   GF  LWRGN+ATM RV PYA IQ+++H  YKR+L   S    + E      +  A      + A +     TYPLDL RARMAVT  + Y N+  V   + +EEGL   Y G  PT++G+IPYAG+ F  +E++K +   ++ R+     E  + G  AGL+GQ   YPLD++RRRMQT  VTG+P  S  + RT R I+  EG + GLYKG SMN +K P A  +SFT +
Sbjct:   20 LSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRIL--GSYYGFRGEALPPWPRLFAGALAGTTAASL-----TYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRAS--IARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVGISFTTF 306          
BLAST of slc25a-10 vs. UniProt/SwissProt
Match: sp|Q8R0Y8|S2542_MOUSE (Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus OX=10090 GN=Slc25a42 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 8.981e-69
Identity = 129/300 (43.00%), Postives = 169/300 (56.33%), Query Frame = 2
Query:  179 LTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L  + +S   ++ VL SLL G +AG +AKT +APLDR KI FQ + ++FS +     L  TY   GF  LWRGN+ATM RV PYA IQ+++H  YKR+L          L    R L                  T+   TYPLDL RARMAVT  + Y N+  V   + +EEGL   Y G  PT++G+IPYAG+ F  +ES+K +   ++ R      E  + G  AGL+GQ   YPLD++RRRMQT  VTGH   S  +  T R I+  EG + GLYKG SMN +K P A  +SFT +
Sbjct:   20 LAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAG-----------TTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGS--ILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTF 306          
BLAST of slc25a-10 vs. TrEMBL
Match: A0A0H3YKA9 (Slc25a-10 OS=Schmidtea mediterranea OX=79327 GN=slc25a-10 PE=2 SV=1)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 2
Query:  164 MKVNELTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGLRVYKK 1102
            MKVNELTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGLRVYKK
Sbjct:    1 MKVNELTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGLRVYKK 313          
BLAST of slc25a-10 vs. TrEMBL
Match: C1LIV9 (Grave disease carrier protein homolog OS=Schistosoma japonicum OX=6182 GN=GDC PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.687e-98
Identity = 150/289 (51.90%), Postives = 195/289 (67.47%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNN-------RKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIIC-SEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            ++L GG+AGCVAKT IAPLDRAKINFQ+T   F+ R + +FL NTY+  GF  LWRGNTAT++R+FPYA IQY++H  YK LL + S     E   + + +     F+ G  AG TSV+CTYPLD+ARARMAVT+  +Y +L   +R +  EEGL + YRG  P ++GIIPYAG  F  FE++K+I    N        RK+   E    G +AG++GQ   YPLDI+RRRMQT  +TGHPEY +++++T   +   EGLIHGLYKG S+N IK P AS +SFTVYH L
Sbjct:   19 NILTGGLAGCVAKTAIAPLDRAKINFQSTRMPFNVRNLTQFLKNTYQEQGFMCLWRGNTATLARIFPYAAIQYSAHDHYKYLLGISS---TSEISHIRLRR-----FLAGVGAGTTSVICTYPLDVARARMAVTTASRYSSLFHAIRSLYMEEGLHSLYRGFQPALLGIIPYAGTAFFTFETLKEICLDRNQELTGKRPRKLRPLENLCCGAVAGILGQTASYPLDIVRRRMQTANITGHPEYIESVYKTLLFVYKDEGLIHGLYKGLSVNWIKGPVASGISFTVYHQL 299          

HSP 2 Score: 71.633 bits (174), Expect = 4.694e-10
Identity = 51/182 (28.02%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  533 IAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIK-KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT--ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            I  N + G LAG  +     PLD A+     T +     NL   L+   +E+G +  +RG   T+  I PYA + +   +  K ++   +  +++      FL+G  AG     C YPLD+ R RM    VT    YS +++   R +  E  +H LY+GF   L+     +  +F  + +L
Sbjct:   16 IGINILTGGLAGCVAKTAIAPLDRAKINFQSTRMPFNVRNLTQFLKNTYQEQGFMCLWRGNTATLARIFPYAAIQYSAHDHYKYLLGISSTSEISHIRLRRFLAGVGAGTTSVICTYPLDVARARMA---VTTASRYS-SLFHAIRSLYMEEGLHSLYRGFQPALLGIIPYAGTAFFTFETL 193          
BLAST of slc25a-10 vs. TrEMBL
Match: A0A3Q0KNL6 (Mitochondrial carrier protein-related OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 4.342e-97
Identity = 149/290 (51.38%), Postives = 193/290 (66.55%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESI--------KDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIIC-SEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            ++L GG+AGCVAKT IAPLDRAKINFQ+T   F+ R++I+FL NT +  GF  LWRG+TAT++R+FPY+ IQY++H  YK LL + S       R   I+      F+ G  AG TSV CTYPLD+ARARMAVT+  KY +L   +R +  EEGL A YRG  P ++GIIPYAG  F  FE++        KD +T    +K+   E    G +AG++GQ   YPLDI+RRRMQT  +TGHPEY +++++T R +   EG IHGLYKG S+N IK P AS +SFTVYH  
Sbjct:   19 NILTGGLAGCVAKTAIAPLDRAKINFQSTRMPFNVRSLIQFLKNTCQEQGFMRLWRGHTATLARIFPYSAIQYSAHDHYKHLLGISST------RHSEISYIRVRRFLAGVGAGTTSVTCTYPLDVARARMAVTTASKYSSLFHAIRALYTEEGLSALYRGFTPALLGIIPYAGTAFFTFETLKETCLDRNKDPITGKGPKKLYPFENLCCGAVAGILGQTASYPLDIVRRRMQTANITGHPEYLESVYKTLRYVYKDEGFIHGLYKGLSVNWIKGPVASGISFTVYHQF 302          

HSP 2 Score: 70.8626 bits (172), Expect = 6.855e-10
Identity = 50/186 (26.88%), Postives = 89/186 (47.85%), Query Frame = 2
Query:  533 IAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMR---KEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIV----TTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            I  N + G LAG  +     PLD  RA++   S +   N+  +++ ++   +E+G +  +RG   T+  I PY+ + +   +  K ++    T H+         FL+G  AG     C YPLD+ R RM    VT   +YS +++   R + +E  +  LY+GF+  L+     +  +F  + +L
Sbjct:   16 IGINILTGGLAGCVAKTAIAPLD--RAKINFQSTRMPFNVRSLIQFLKNTCQEQGFMRLWRGHTATLARIFPYSAIQYSAHDHYKHLLGISSTRHSEISYIRVRRFLAGVGAGTTSVTCTYPLDVARARMA---VTTASKYS-SLFHAIRALYTEEGLSALYRGFTPALLGIIPYAGTAFFTFETL 195          
BLAST of slc25a-10 vs. TrEMBL
Match: A0A183NVM5 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS6161 PE=3 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 2.978e-93
Identity = 149/305 (48.85%), Postives = 195/305 (63.93%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQ-----------TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAF----NFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESI--------KDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIIC-SEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            ++L GG+AGCVAKT IAPLDRAKINFQ            T   F+ R++I+FL NTY+  GF  LWRG+TAT++R+FPY+ IQY++H  YK LL + S            +  I++     F+ G  AG TSV CTYPLD+ARARMAVT+  KY +L   +R +  EEGL A YRG +P ++GIIPYAG  F  FE++        KD +T    +K+   E    G +AG++GQ   YPLDI+RRRMQT  +TGHPEY +++++T R +   EG IHGLYKG S+N IK P AS +SFTVYH  
Sbjct:   19 NILTGGLAGCVAKTAIAPLDRAKINFQCKALVLILVFLATRMPFNVRSLIQFLKNTYQEQGFMCLWRGHTATLARIFPYSAIQYSAHDHYKHLLGIGS----------TSHSDISYIRLRRFLAGVGAGTTSVTCTYPLDVARARMAVTTASKYSSLFHAIRALYTEEGLSALYRGFSPALLGIIPYAGTAFFTFETLKETCLDRNKDPITGKRPKKLYPFENLCCGAVAGILGQTASYPLDIVRRRMQTANITGHPEYIESVYKTLRYVYKDEGFIHGLYKGLSVNWIKGPVASGISFTVYHQF 313          

HSP 2 Score: 67.781 bits (164), Expect = 9.084e-9
Identity = 50/195 (25.64%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  533 IAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIK------------KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIV----TTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            I  N + G LAG  +     PLD A+      ++                +L+  L+   +E+G +  +RG   T+  I PY+ + +   +  K ++    T+H++        FL+G  AG     C YPLD+ R RM    VT   +YS +++   R + +E  +  LY+GFS  L+     +  +F  + +L
Sbjct:   16 IGINILTGGLAGCVAKTAIAPLDRAKINFQCKALVLILVFLATRMPFNVRSLIQFLKNTYQEQGFMCLWRGHTATLARIFPYSAIQYSAHDHYKHLLGIGSTSHSDISYIRLRRFLAGVGAGTTSVTCTYPLDVARARMA---VTTASKYS-SLFHAIRALYTEEGLSALYRGFSPALLGIIPYAGTAFFTFETL 206          
BLAST of slc25a-10 vs. TrEMBL
Match: G4VNT4 (Mitochondrial carrier protein-related OS=Schistosoma mansoni OX=6183 GN=Smp_142930 PE=3 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 3.378e-93
Identity = 153/315 (48.57%), Postives = 197/315 (62.54%), Query Frame = 2
Query:  185 KSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQ-----------TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESI--------KDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIIC-SEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            KSS  V +  ++L     GG+AGCVAKT IAPLDRAKINFQ            T   F+ R++I+FL NT +  GF  LWRG+TAT++R+FPY+ IQY++H  YK LL + S       R   I+      F+ G  AG TSV CTYPLD+ARARMAVT+  KY +L   +R +  EEGL A YRG  P ++GIIPYAG  F  FE++        KD +T    +K+   E    G +AG++GQ   YPLDI+RRRMQT  +TGHPEY +++++T R +   EG IHGLYKG S+N IK P AS +SFTVYH  
Sbjct:   23 KSSHRVSIGINILT----GGLAGCVAKTAIAPLDRAKINFQCEALDFILIFLATRMPFNVRSLIQFLKNTCQEQGFMRLWRGHTATLARIFPYSAIQYSAHDHYKHLLGISST------RHSEISYIRVRRFLAGVGAGTTSVTCTYPLDVARARMAVTTASKYSSLFHAIRALYTEEGLSALYRGFTPALLGIIPYAGTAFFTFETLKETCLDRNKDPITGKGPKKLYPFENLCCGAVAGILGQTASYPLDIVRRRMQTANITGHPEYLESVYKTLRYVYKDEGFIHGLYKGLSVNWIKGPVASGISFTVYHQF 327          
BLAST of slc25a-10 vs. Ensembl Cavefish
Match: slc25a42 (solute carrier family 25 member 42 [Source:NCBI gene;Acc:103032404])

HSP 1 Score: 245.358 bits (625), Expect = 3.543e-78
Identity = 131/298 (43.96%), Postives = 170/298 (57.05%), Query Frame = 2
Query:  182 TKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTT-ETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            +  S   +  + VL SLL G +AG VAKT +APLDR KI FQ +  +FS +     +  TY+ +GF  LWRGN+ATM RV PYA IQ+ +H  YKRLL          L    R            + GSLAG T+   TYPLD+ RARMAVT  + Y N+L V   + +EEGL   YRG  PTI+G++PYAG+ F  +E++K +      R    + E    G  AGL+GQ   YPLD++RRRMQT  VTGH  Y   +     I+  EG+I GLYKG SMN +K P A  +SF  +
Sbjct:   23 SSQSEGFKQGRSVLNSLLSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYRKDGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKRLLGGYYGFQGKALPPVPR-----------LLAGSLAGTTAASLTYPLDMVRARMAVTPKEMYSNILHVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETLKKLHAEKTGRPQPYSFERLAFGACAGLIGQSSSYPLDVVRRRMQTAGVTGH-TYGTILGTMREIVAEEGVIRGLYKGLSMNWVKGPIAVGISFMTF 308          

HSP 2 Score: 70.8626 bits (172), Expect = 3.528e-13
Identity = 51/188 (27.13%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  524 NKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIK---KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH---NNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
             + +  + + G+LAG  +     PLD  +    V+S +   K    L + R  RK+ G L+ +RG + T++ +IPYA + F   E  K ++  +     + +      L+G +AG       YPLD++R RM   P     E   N+   F  I  E  +  LY+GF+  ++     + +SF  Y +L
Sbjct:   32 GRSVLNSLLSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRL-IYRTYRKD-GFLSLWRGNSATMVRVIPYAAIQFCAHEQYKRLLGGYYGFQGKALPPVPRLLAGSLAGTTAASLTYPLDMVRARMAVTP----KEMYSNILHVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETL 213          
BLAST of slc25a-10 vs. Ensembl Cavefish
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:103033894])

HSP 1 Score: 194.126 bits (492), Expect = 2.144e-58
Identity = 117/297 (39.39%), Postives = 165/297 (55.56%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH----------NNRKMTTTET---FLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L S + GG+AGC AKT IAPLDR KI  Q  +  +    ++  L    K  GF  L++GN A M R+FPY  IQ+ +   YK+ L            QL I+  I    + GS+AGMT+V+CTYPLD+ RAR+A  VT   +Y  + +  + I  KE G+  FYRG+ PTIIG+ PYAG  F  F ++K +   H          +N  +   +T    L GGIAG + Q   YPLD+ RRRMQ G V    +   ++ +T + + S+ G+ +GLY+G S+N I+   + AV+FT Y
Sbjct:   27 LRSFVAGGVAGCCAKTTIAPLDRVKILLQAHNPHYKHLGVLATLKAVPKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDNYKKFLST----------QLGISGHI-HRLMAGSMAGMTAVICTYPLDVIRARLAFQVTGEHRYTGIGNAFQTIYLKEGGISGFYRGLTPTIIGMAPYAGFSFFTFGTLKSLGLAHFPEMLGKPSLDNPDVLVLKTHVNLLCGGIAGAIAQTISYPLDVARRRMQLGAVLPDSDKCLSLTKTLKYVYSQYGVKNGLYRGLSLNYIRCVPSQAVAFTTY 312          
BLAST of slc25a-10 vs. Ensembl Cavefish
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:103033894])

HSP 1 Score: 194.126 bits (492), Expect = 2.144e-58
Identity = 117/297 (39.39%), Postives = 165/297 (55.56%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH----------NNRKMTTTET---FLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            L S + GG+AGC AKT IAPLDR KI  Q  +  +    ++  L    K  GF  L++GN A M R+FPY  IQ+ +   YK+ L            QL I+  I    + GS+AGMT+V+CTYPLD+ RAR+A  VT   +Y  + +  + I  KE G+  FYRG+ PTIIG+ PYAG  F  F ++K +   H          +N  +   +T    L GGIAG + Q   YPLD+ RRRMQ G V    +   ++ +T + + S+ G+ +GLY+G S+N I+   + AV+FT Y
Sbjct:   27 LRSFVAGGVAGCCAKTTIAPLDRVKILLQAHNPHYKHLGVLATLKAVPKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDNYKKFLST----------QLGISGHI-HRLMAGSMAGMTAVICTYPLDVIRARLAFQVTGEHRYTGIGNAFQTIYLKEGGISGFYRGLTPTIIGMAPYAGFSFFTFGTLKSLGLAHFPEMLGKPSLDNPDVLVLKTHVNLLCGGIAGAIAQTISYPLDVARRRMQLGAVLPDSDKCLSLTKTLKYVYSQYGVKNGLYRGLSLNYIRCVPSQAVAFTTY 312          
BLAST of slc25a-10 vs. Ensembl Cavefish
Match: slc25a23a (calcium-binding mitochondrial carrier protein SCaMC-3 [Source:NCBI gene;Acc:103026535])

HSP 1 Score: 157.147 bits (396), Expect = 6.688e-43
Identity = 97/297 (32.66%), Postives = 155/297 (52.19%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL--KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            V   L+ G +AG V++T  APLDR K+  Q   Q     ++ + L    K  G   LWRGN   + ++ P   I++ ++   KR++    D   LK +ER           FI GSLAG T+    YP+++ + R+ +    +Y +++D  R + ++EG+LAFY+G  P I+GIIPYAG+   V+E++K+     +          +    G ++   GQ   YPL +IR RMQ    V G P+ S  M   FR I+  EG++ GLY+G + N +K   A ++S+ VY  +   +G+
Sbjct:  184 VWRQLMAGAMAGSVSRTGTAPLDRLKVFLQVHGQSSDKGSVWKGLKAMVKEGGIRALWRGNGINVLKIAPETAIKFLAYEQIKRMMNGSKDGGSLKVQER-----------FIAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSSVVDCARQILQKEGVLAFYKGYIPNILGIIPYAGIDLAVYETLKNTWLQRHRCDSADPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQAQASVKGGPQLS--MLSLFRSIVAQEGVV-GLYRGIAPNFLKVIPAVSISYVVYEHMRKVLGV 466          
BLAST of slc25a-10 vs. Ensembl Cavefish
Match: slc25a23a (calcium-binding mitochondrial carrier protein SCaMC-3 [Source:NCBI gene;Acc:103026535])

HSP 1 Score: 155.606 bits (392), Expect = 2.882e-42
Identity = 96/291 (32.99%), Postives = 152/291 (52.23%), Query Frame = 2
Query:  218 VLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL--KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            V   L+ G +AG V++T  APLDR K+  Q   Q     ++ + L    K  G   LWRGN   + ++ P   I++ ++   KR++    D   LK +ER           FI GSLAG T+    YP+++ + R+ +    +Y +++D  R + ++EG+LAFY+G  P I+GIIPYAG+   V+E++K+     +          +    G ++   GQ   YPL +IR RMQ    V G P+ S  M   FR I+  EG++ GLY+G + N +K   A ++S+ VY  +
Sbjct:  200 VWRQLMAGAMAGSVSRTGTAPLDRLKVFLQVHGQSSDKGSVWKGLKAMVKEGGIRALWRGNGINVLKIAPETAIKFLAYEQIKRMMNGSKDGGSLKVQER-----------FIAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSSVVDCARQILQKEGVLAFYKGYIPNILGIIPYAGIDLAVYETLKNTWLQRHRCDSADPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQAQASVKGGPQLS--MLSLFRSIVAQEGVV-GLYRGIAPNFLKVIPAVSISYVVYEHM 476          

HSP 2 Score: 70.0922 bits (170), Expect = 1.103e-12
Identity = 48/199 (24.12%), Postives = 96/199 (48.24%), Query Frame = 2
Query:  239 GGIAGCVAKTVIAPLD--RAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRK---EEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIV---TTHNNRKM 811
            G +AG  A+T+I P++  + ++  + T Q   + ++++      +  G    ++G    +  + PYAGI     A Y+ L         +  R    +  +     CG+++     L +YPL L R RM   +  K G  L +L + R    +EG++  YRGI P  + +IP   + ++V+E ++ ++   T H+++++
Sbjct:  303 GSLAGATAQTIIYPMEVLKTRLTLRKTGQ---YSSVVDCARQILQKEGVLAFYKGYIPNILGIIPYAGIDL---AVYETLKNT----WLQRHRCDSADPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQAQASVKGGPQLSMLSLFRSIVAQEGVVGLYRGIAPNFLKVIPAVSISYVVYEHMRVLIFRLTDHSHQEV 491          
BLAST of slc25a-10 vs. Ensembl Sea Lamprey
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 175.252 bits (443), Expect = 1.053e-51
Identity = 109/295 (36.95%), Postives = 153/295 (51.86%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTH----------NNRKMTTTET---FLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSE-GLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            + L GGIAGC AKT IAPLDR KI  Q  +  +    +   L+   +  GF  L++GN A M R+FPY  IQ+T+   YKR+L     I     R L  +      ++     G+T+V+ TYPLD+ RAR+A  V     Y  +L     I +KE G   FY G+ PTIIG+ PYAG  F  F ++K +  T           +N  +    T    L GG AG + Q   YPLD+ RRRMQ   +  + E   +MW+T   +  + G+  GLY+G S+N ++   + AV+FT Y
Sbjct:   38 NFLAGGIAGCCAKTTIAPLDRVKILLQAYNPHYKHLGVFSTLVAIPRKEGFLGLYKGNGAMMVRIFPYGAIQFTAFEKYKRVLSKQMGITGHVHRLLAGSHGW---YLSPCAPGITAVIFTYPLDMVRARLAYQVKGDHGYRGILHAFSLIYKKEGGFRGFYHGLVPTIIGMAPYAGFSFFTFSTLKSVGLTRAPALLGRPSADNPDVLVLRTPINLLFGGTAGAIAQTISYPLDVARRRMQLAGILPNSENFGSMWQTLTNVYKQYGVRRGLYRGLSLNYVRCVPSQAVAFTTY 329          
BLAST of slc25a-10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 7.732e-43
Identity = 89/297 (29.97%), Postives = 148/297 (49.83%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLM---------GQFCCYPLDIIRRRMQTGPVTGHPEYSQ-NMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
             L+ GG AG V++T  APLDR K+  Q    + +   ++  L +  +  G   LWRGN   + ++ P   I++ ++   K+L+ +    +  +ER            + GSLAG T+    YP+++ + R+A+    +Y +++D  R + K EGL AF++G  P ++GIIPYAG+    +E++K+     +  +          GIA L+         GQ   YPL ++R RMQ     G P  SQ  M    R I  +  + GLY+G + N +K   A  +S+ VY +L   +G+
Sbjct:   27 QLVAGGGAGVVSRTCTAPLDRLKVIMQVKASRHNTIGVVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKKLIGMRQEQIGVQER-----------LVAGSLAGATAQTVIYPMEVVKTRLALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANP------GIAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQPGMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLKGALGV 306          
BLAST of slc25a-10 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 149.828 bits (377), Expect = 9.047e-41
Identity = 90/293 (30.72%), Postives = 149/293 (50.85%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQT-GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            L  L+ GG AG V++T  APLDR K+  Q    K +  +++       K  G   LWRGN   + ++ P   I++ ++   K+ +  +++ L   ER           F+ GSLAG T+    YP+++ + R+ +    +Y  ++D  + +  +EG++AFY+G  P IIGIIPYAG+   ++E++K+   T   +        +    G ++   GQ   YPL +IR RMQ    + G P+ S  M   FR I       GLY+G + N +K   A ++S+ VY +L   +G+
Sbjct:  211 LRQLMAGGAAGAVSRTGTAPLDRMKVFMQVHGSKSNNISILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKFIGSNNVSLGIHER-----------FMAGSLAGATAQTIIYPMEVMKTRLTLRKTGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADPGILVLLACGTVSSSCGQVASYPLALIRTRMQAQASMEGGPQLS--MVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRVLGV 490          
BLAST of slc25a-10 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 103.99 bits (258), Expect = 1.468e-25
Identity = 78/295 (26.44%), Postives = 137/295 (46.44%), Query Frame = 2
Query:  191 STSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQ--------TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVT-----SIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRR--MQTGPVTGHPEYSQNM--WRTFRIICSEGLIHGLYKGFSMNLIK 1024
            +T  +V    L   + GGIA  ++KT +AP++R K+  Q          DQ++  + +++ ++   +  GF   WRGN A + R FP   + +     YK+      I L   ++     +  A N   G  AG TS+   YPLD AR R+A       + +++  L D +  + K +GL   Y+G N ++ GII Y    F ++++ K ++    +  +  +   ++  +  + G    YP D +RRR  MQ+G       Y   +  W+  +I+  EG     +KG   N+I+
Sbjct:    1 ATMSDVAIGFLKDFMAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQY--KGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQ------IFLGGVDKHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGQAEREFKGLADCISKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPNPKSTPLVVS-WMIAQSVTAVSG-IVSYPFDTVRRRMMMQSGRKGADIMYRGTIDCWK--KILQQEGG-KAFFKGAWSNVIR 282          

HSP 2 Score: 55.0694 bits (131), Expect = 9.810e-9
Identity = 52/195 (26.67%), Postives = 79/195 (40.51%), Query Frame = 2
Query:  542 NFICGSLAGMTSVLCTYP-------LDLARARMAVTSIKKYGNLLD-VLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDI----VTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTF--------RIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHS 1066
            +F+ G +A   S     P       L +  A   +   ++Y  ++D V+RI R E+G ++F+RG    +I   P   + F   +  K I    V  H            SGG AG       YPLD  R R+      G  E      R F        +I  S+GL  GLY+GF++++       A  F +Y +
Sbjct:   13 DFMAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIMDCVVRIPR-EQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGQAE------REFKGLADCISKIFKSDGL-RGLYQGFNVSVQGIIIYRAAYFGIYDT 199          
BLAST of slc25a-10 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 87.8113 bits (216), Expect = 4.384e-20
Identity = 65/248 (26.21%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  308 TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAV-----TSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRR--MQTGPVTGHPEYSQNM--WRTFRIICSEGLIHGLYKGFSMNLIK 1024
              DQ++  + +I+ ++   +  GF   WRGN A + R FP   + +     YK+      + L   +++    +  A N   G  AG TS+   YPLD AR R+        + +++  L D L  + K +G    Y+G N ++ GII Y    F ++++ K ++    N  +  +   ++  +  + G F  YP D +RRR  MQ+G       Y+  +  WR  +I   EG     +KG   N+++
Sbjct:   12 AVDQQY--KGIIDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQ------VFLGGVDKRKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLGADVGKGNAQREFTGLGDCLTKIFKSDGFRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTPIVVS-WMIAQTVTAVSG-FASYPFDTVRRRMMMQSGRKAADIMYTGTIDCWR--KIARQEG-TRAFFKGAWSNVLR 246          

HSP 2 Score: 46.2098 bits (108), Expect = 6.519e-6
Identity = 36/150 (24.00%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  635 KKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETF----LSGGIAGLMGQFCCYPLDIIRRRM--QTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHS 1066
            ++Y  ++D +  + +E+G ++F+RG    +I   P   + F   +  K +     +++      F     SGG AG       YPLD  R R+    G      E++       +I  S+G   GLY+GF++++       A  F +Y +
Sbjct:   15 QQYKGIIDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKRKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLGADVGKGNAQREFTGLGDCLTKIFKSDGF-RGLYQGFNVSVQGIIIYRAAYFGIYDT 163          
BLAST of slc25a-10 vs. Ensembl Yeast
Match: LEU5 (Mitochondrial carrier protein; involved in the accumulation of CoA in the mitochondrial matrix; homolog of human Graves disease protein SLC25A16, which complements yeast null mutant; does not encode an isozyme of Leu4p, as first hypothesized [Source:SGD;Acc:S000001044])

HSP 1 Score: 154.066 bits (388), Expect = 1.410e-43
Identity = 108/348 (31.03%), Postives = 165/348 (47.41%), Query Frame = 2
Query:  170 VNELTKSSTSVEVN--KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKF-----SFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEG----------------LLAFYRGINPTIIGIIPYAGVGFLVFESIKDI----------------------VTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQT---GPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            +N+ T   TS + N    ++ S L GGI+G  AKT+IAPLDR KI FQT++  +     S   ++E   + +  +G    ++G++AT+ R+FPYA +++ ++   +  L + S   +   R+L          + GSLAG+ SV  TYPLDL R R+A  +  K   L  +++ + KE                     FYRG  PT++G+IPYAGV F   + + D+                      V     R + T    +SGG+AG+  Q   YP +IIRRR+Q     P T +    Q++     II  E  + G + G S+  IK     A SF VY  +
Sbjct:   15 INKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTL-IPSKEFESHWRRL----------VSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERM 351          
BLAST of slc25a-10 vs. Ensembl Yeast
Match: YPR011C_mRNA (Mitochondrial transporter; major substrates are adenosine 5'-phosphosulfate (APS) and 3'-phospho-adenosine 5'-phosphosulfate (PAPS); member of the mitochondrial carrier family; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000006215])

HSP 1 Score: 144.821 bits (364), Expect = 1.579e-40
Identity = 93/312 (29.81%), Postives = 153/312 (49.04%), Query Frame = 2
Query:  206 VNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSF-RAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSH-AFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVT-------------SIKKYGNLLDVL-RIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLS---GGIAGLMGQFCCYPLDIIRRRMQTGPVTGHP---EYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCD 1075
            + +D   + L GG+AG V++TV++P +R KI  Q      S+ R +   +   Y   G   L+RGN     R+FPY+ +Q+  + A  K+L  V+       + QL   +++      G+L G  SV+ TYPLDL + R+++              SI K   +  +L    R E GL   YRG+ PT +G++PY  + F V+E +++     ++ + +          G I+G + Q   YP D++RRR Q   + G+     Y+ ++W     I     + G YKG + NL K   ++AVS+ VY  +CD
Sbjct:   18 LKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNG---NNGQEQLTNTQRL----FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYT-SVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321          

HSP 2 Score: 57.7658 bits (138), Expect = 8.594e-10
Identity = 53/220 (24.09%), Postives = 93/220 (42.27%), Query Frame = 2
Query:  209 NKDVLFSLLFGGIAGCVAKTVIAPLD--RAKINFQTTDQKFSFRA----------MIEFLLNTYK-TNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIA--------FNFICGSLAGMTSVLCTYPLDLARARMAVTSIK------KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIV 787
            N   LFS   G + G  +     PLD  + +++ QT +     R+          + + L  TY+   G   L+RG   T   V PY  + +   A Y++L            R+  +N   A        +    G+++G  +   TYP DL R R  V ++       +Y ++ D L  + + EG+  +Y+G+   +  ++P   V +LV+E + D V
Sbjct:  122 NTQRLFS---GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNF---AVYEQL------------REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCDSV 323          
BLAST of slc25a-10 vs. Ensembl Yeast
Match: AAC3 (Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Aac1p; has roles in maintenance of viability and in respiration; AAC3 has a paralog, PET9, that arose from the whole genome duplication [Source:SGD;Acc:S000000289])

HSP 1 Score: 129.413 bits (324), Expect = 5.682e-35
Identity = 94/311 (30.23%), Postives = 153/311 (49.20%), Query Frame = 2
Query:  188 SSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQ---------TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-------IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHP-EYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            SS + +   +   + L GG++  +AKT  +P++R KI  Q         T D+K+S   +++    T K  G    WRGNTA + R FP   + +     +K  +K+     KKEE      K  A N   G  AG  S+L  Y LD AR R+A  +        +++  L DV +   K +G+   YRG  P+++GI+ Y G+ F +F+S+K +V T  +   +   +FL G +       C YPLD +RRRM     +G   +Y+  +    +I+ SEG +  L+KG   N++++   + V  ++Y  L
Sbjct:    2 SSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYS--GIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFA----FKDKIKL-MFGFKKEEG---YGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLT-GSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMM--TSGQAVKYNGAIDCLKKIVASEG-VGSLFKGCGANILRSVAGAGV-ISMYDQL 297          
BLAST of slc25a-10 vs. Ensembl Yeast
Match: PET9 (Major ADP/ATP carrier of the mitochondrial inner membrane; exchanges cytosolic ADP for mitochondrially synthesized ATP; also imports heme and ATP; required for viability in many lab strains that carry a sal1 mutation; PET9 has a paralog, AAC3, that arose from the whole genome duplication; human homolog SLC25A4 implicated in progressive external ophthalmoplegia can complement yeast null mutant [Source:SGD;Acc:S000000126])

HSP 1 Score: 123.635 bits (309), Expect = 1.263e-32
Identity = 90/318 (28.30%), Postives = 149/318 (46.86%), Query Frame = 2
Query:  161 NMKVNELTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFS-------FRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTS-------IKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFR-IICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            N +V      + + +   + L   L GG++  VAKT  +P++R K+  Q  D+          +  +++    T    G    WRGNTA + R FP    Q  + AF  ++  +     KKEE      K  A N   G  AG  S+L  Y LD AR R+A  S        +++  L+DV +   K +G+   YRG  P+++GI+ Y G+ F +++S+K ++ T  + + +   +FL G +       C YPLD +RRRM     +G        +   R I+ +EG +  L+KG   N+++    + V  ++Y  L
Sbjct:    4 NAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFP---TQALNFAFKDKIKAM--FGFKKEEG---YAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLT-GSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMM--TSGQAVKYDGAFDCLRKIVAAEG-VGSLFKGCGANILRGVAGAGV-ISMYDQL 308          
BLAST of slc25a-10 vs. Ensembl Yeast
Match: AAC1 (Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator; relocalizes from mitochondrion to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000004660])

HSP 1 Score: 121.324 bits (303), Expect = 7.269e-32
Identity = 88/295 (29.83%), Postives = 135/295 (45.76%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFS-------FRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAV-------TSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
              L GG++  +AKT  AP++R K+  Q  ++          ++ +++    T    G    WRGNTA + R FP   + +      K LL  D       ER     K  A N   G  AG  S+L  Y LD AR R+A        TS +++  LLDV +   K +GLL  YRG  P+++GII Y G+ F +++S K ++ T    + +   +FL G +  +      YPLD +RRRM     +G            R I  +   + L+KG   N+ +   A+ V  ++Y  L
Sbjct:   16 DFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYD------RERD-GYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLT-GALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMM--TSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGV-ISLYDQL 299          
BLAST of slc25a-10 vs. Ensembl Nematostella
Match: EDO38453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCS6])

HSP 1 Score: 260.381 bits (664), Expect = 7.971e-85
Identity = 138/297 (46.46%), Postives = 190/297 (63.97%), Query Frame = 2
Query:  215 DVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTT-HNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTG--HPEYSQNMWRTFRIIC-SEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGLRV 1093
            ++L SL  G IAG VAKT IAPLDR KI FQT++ +FS + ++  L  TY TNGF  L+RGN+ATM RV PYA IQ+TSH  YK+LL++D      E +  +   +    F+ GSLAGMT+ L TYPLD+ RAR+A+T  KKY  L++    + ++EG+  FYRG  PT+IGI+PYAG+ F  +E+ K      ++ +K T       G  AGL GQ   YP++I+RRRMQ   + G   PEY+ +MW T + +  +EGL  GLYKG S+N +K P A  +SFTVY  +  ++G R+
Sbjct:    2 EILSSLTSGAIAGAVAKTAIAPLDRTKIIFQTSNTRFSVQGVVHVLTQTYTTNGFTGLFRGNSATMMRVVPYASIQFTSHEQYKKLLRID------EGKGALPPVR---RFVAGSLAGMTAALLTYPLDMVRARLAITQKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCKKAFGEFYDGKKPTPFHRLAFGACAGLFGQSATYPIEIVRRRMQADGIYGPRRPEYA-HMWSTAKYVYKTEGLRTGLYKGLSLNWVKGPVAVGISFTVYDLMQAFIGKRI 288          
BLAST of slc25a-10 vs. Ensembl Nematostella
Match: EDO37153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGK5])

HSP 1 Score: 167.548 bits (423), Expect = 8.086e-49
Identity = 102/301 (33.89%), Postives = 149/301 (49.50%), Query Frame = 2
Query:  206 VNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKY---GNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKD-----------IVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQ-TGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYH 1063
            V+   + + + GG++ C AKT  APL+R KI FQ  ++ +   ++   L   YK  G    ++GN A M RVFPY  IQ+ S+  YK L +             + N  ++   + G LAG+T+  CTYPLD+ R+R+A     ++   G    V +I   E G++A YRG  PT + +IP  G+GF  FES KD           I        +T     L G +AG   Q   YPLD++RRRMQ  G V    +YS  +     +   +G+  GLY+G S+N ++     AV F VY 
Sbjct:    2 VDYKTINTFVAGGLSTCCAKTTTAPLERLKILFQAQNKHYKNMSVFGALKAIYKKEGLQGYYKGNGAMMVRVFPYGSIQFVSYEQYKLLFE-----------NALQNSHLS-KIVAGGLAGLTACSCTYPLDIVRSRLAFQVADEHTYCGICQTVKQIFMTEGGMVALYRGFTPTSLSMIPAVGIGFYAFESFKDFFVAMKGVLTRIHPETGETVLTAPGGLLCGALAGATSQTLAYPLDVVRRRMQLAGTVADGHKYSTCINTFISVYTEDGIRRGLYRGLSINYLRVCPQVAVMFAVYE 290          

HSP 2 Score: 73.1738 bits (178), Expect = 1.648e-14
Identity = 50/189 (26.46%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  518 MINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNL--LDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDY 1078
            M++ K    F+ G L+   +   T PL+  +      + K Y N+     L+ + K+EGL  +Y+G    ++ + PY  + F+ +E  K +    N  + +     ++GG+AGL    C YPLDI+R R+       H  Y        +I  +EG +  LY+GF+   +    A  + F  + S  D+
Sbjct:    1 MVDYKTINTFVAGGLSTCCAKTTTAPLERLKILFQAQN-KHYKNMSVFGALKAIYKKEGLQGYYKGNGAMMVRVFPYGSIQFVSYEQYKLLF--ENALQNSHLSKIVAGGLAGLTACSCTYPLDIVRSRLAFQVADEH-TYCGICQTVKQIFMTEGGMVALYRGFTPTSLSMIPAVGIGFYAFESFKDF 185          

HSP 3 Score: 69.707 bits (169), Expect = 2.050e-13
Identity = 54/199 (27.14%), Postives = 92/199 (46.23%), Query Frame = 2
Query:  221 LFSLLFGGIAGCVAKTVIAPLD--RAKINFQTTDQKFSFRAMIEFLLNTYKTNG-FHYLWRGNTATMSRVFPYAGIQ-YTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARM----AVTSIKKYGNLLDVLRIMRKEEGLL-AFYRGINPTIIGIIPYAGVGFLVFESIKDIVT 790
            L  ++ GG+AG  A +   PLD  R+++ FQ  D+  ++  + + +   + T G    L+RG T T   + P  GI  Y   +F    + +  ++ +                +CG+LAG TS    YPLD+ R RM     V    KY   ++    +  E+G+    YRG++   + + P   V F V+E +K ++T
Sbjct:  100 LSKIVAGGLAGLTACSCTYPLDIVRSRLAFQVADEH-TYCGICQTVKQIFMTEGGMVALYRGFTPTSLSMIPAVGIGFYAFESFKDFFVAMKGVLTRIHPETGETVLTAPGGLLCGALAGATSQTLAYPLDVVRRRMQLAGTVADGHKYSTCINTFISVYTEDGIRRGLYRGLSINYLRVCPQVAVMFAVYEVVKQLLT 297          
BLAST of slc25a-10 vs. Ensembl Nematostella
Match: EDO31058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ11])

HSP 1 Score: 162.155 bits (409), Expect = 6.900e-47
Identity = 100/291 (34.36%), Postives = 152/291 (52.23%), Query Frame = 2
Query:  236 FGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA--VTSIKKYGNLLDVLR-IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKD------IVTTHNNRKMTTTET-----FLSGGIAGLMGQFCCYPLDIIRRRMQ-TGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYH 1063
            F G++ C A+T +APL+R KI  Q  ++ +    ++      Y+  G    ++GN A M R FPY  +Q+ S+  Y ++L+  S           INK +A     GSLAGMT+  CTYPLD+ R+R+A  V   + Y  +   +R I  KE G  A Y+G  PT++ I+P  G+GF +FE++K       I  T+ N      E      F+ GG+AG + Q   YPLD++RRRMQ  G V    +Y+  +     +   +G+  GLY+G S+N ++     A+ F VY 
Sbjct:    5 FLGLSTCCARTTMAPLERLKILLQANNRHYKGMKVLTAFRAIYRNEGLLAYFKGNGAMMLRTFPYGAVQFLSYEHYSKVLQTSSP---------AINKLVA-----GSLAGMTACACTYPLDMVRSRLAFQVAQDQGYTTITQTIRCISVKEGGPKALYKGFVPTLLTIVPAMGIGFYMFETMKAYFLETRIAFTNTNPDTLCPELSIIGGFVCGGVAGAVSQTIAYPLDVVRRRMQLAGAVPDGHKYNTCINTLVNVYKDDGIRRGLYRGLSINYLRVCPQVAIMFGVYE 281          

HSP 2 Score: 60.8474 bits (146), Expect = 1.985e-10
Identity = 52/207 (25.12%), Postives = 84/207 (40.58%), Query Frame = 2
Query:  191 STSVEVNKDVLFSLLFGGIAGCVAKTVIAPLD--RAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQ-YTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARM----AVTSIKKYGNLLDVLRIMRKEEGLL-AFYRGINPTIIGIIPYAGVGFLVFESIKDIV 787
            S  ++ +   +  L+ G +AG  A     PLD  R+++ FQ    +            + K  G   L++G   T+  + P  GI  Y         L+            L     I   F+CG +AG  S    YPLD+ R RM    AV    KY   ++ L  + K++G+    YRG++   + + P   + F V+E  K  +
Sbjct:   81 SKVLQTSSPAINKLVAGSLAGMTACACTYPLDMVRSRLAFQVAQDQGYTTITQTIRCISVKEGGPKALYKGFVPTLLTIVPAMGIGFYMFETMKAYFLETRIAFTNTNPDTLCPELSIIGGFVCGGVAGAVSQTIAYPLDVVRRRMQLAGAVPDGHKYNTCINTLVNVYKDDGIRRGLYRGLSINYLRVCPQVAIMFGVYEVTKQFL 287          
BLAST of slc25a-10 vs. Ensembl Nematostella
Match: EDO34426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF1])

HSP 1 Score: 161.77 bits (408), Expect = 2.282e-46
Identity = 93/296 (31.42%), Postives = 148/296 (50.00%), Query Frame = 2
Query:  230 LLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSI-KKYGNLLDVLRIMRKEEGLL---AFYRGINPTIIGIIPYAGVGFLVFESIK--------------DIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYH 1063
            LL GGIAG V++T ++PL+R KI  Q   +   F+ ++  L+   K  G    ++GN   + R+FPY+ +Q+ ++  YK+LL +        E Q  I +      + G++AG+TS+  TYPLDL R R++     +KY  ++   R +  EEG       YRG+ PT +GI PY G+ F V+E++K               +     +R++      + G +AG + Q   YPLD++RRRMQ   +     Y   +     I+  EG   GLYKG   N++K   +  + F  Y 
Sbjct:   38 LLAGGIAGAVSRTSVSPLERVKILLQIQVKNPKFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKKLLNIPD----DPEHQTPIKR-----LVAGAMAGVTSITATYPLDLIRTRLSAQGADRKYRGIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETLKGFLFSTVMASSQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKGIRADFAYKSTLHAFSSIVKLEGF-RGLYKGMWPNILKVAPSVGIQFAAYE 323          

HSP 2 Score: 47.3654 bits (111), Expect = 6.551e-6
Identity = 27/104 (25.96%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  182 TKSSTSVEVNKD----VLFSLLFGGIAGCVAKTVIAPLD--RAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL 475
            ++ ++   + KD    V F L+ G +AG V++T   PLD  R ++  +     F++++ +    +  K  GF  L++G    + +V P  GIQ+ ++   K  L
Sbjct:  226 SQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKGIRADFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILKVAPSVGIQFAAYELSKSFL 329          
BLAST of slc25a-10 vs. Ensembl Nematostella
Match: EDO32185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT7])

HSP 1 Score: 154.836 bits (390), Expect = 1.953e-42
Identity = 89/287 (31.01%), Postives = 150/287 (52.26%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQ---TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDI-VTTHNNRKMTTTETFL--SGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
             L+ GG AG V++T  APLDR K+  Q   ++  +F   +  + +L   +  G   LWRGN A + ++ P +GI++ ++   K+L+  D+  L   +R            + GS+AG+ S    YPL++ + R+A+    +Y  LL    ++ ++EG+ +FYRG+ P+++GIIPYAG+   V+E++K+  +  H N+        L   G  +   GQ   YPL ++R R+Q            NM    R I +E    GLY+G + N +K   A ++S+ VY +L
Sbjct:  192 QLVAGGGAGVVSRTATAPLDRLKVLLQVQASSTNRFGIVSGFKMML---REGGIKSLWRGNGANVIKIAPESGIKFFAYEKAKKLVGSDTKALGVTDR-----------LLAGSMAGVASQTSIYPLEVLKTRLAIRKTGQYRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGIDLAVYETLKNFYLNYHKNQSADPGVLVLLACGTASSTCGQLASYPLSLVRTRLQAQAREKGGGQGDNMVSVLRKIITEDGFKGLYRGLAPNFLKVAPAVSISYVVYENL 464          

HSP 2 Score: 72.7886 bits (177), Expect = 5.694e-14
Identity = 50/189 (26.46%), Postives = 91/189 (48.15%), Query Frame = 2
Query:  230 LLFGGIAGCVAKTVIAPLD--RAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYG----NLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIK 778
            LL G +AG  ++T I PL+  + ++  + T Q   +R ++      Y+  G    +RG   ++  + PYAGI     A Y+ L    +  L   + Q   +  +     CG+ +     L +YPL L R R+   + +K G    N++ VLR +  E+G    YRG+ P  + + P   + ++V+E+++
Sbjct:  287 LLAGSMAGVASQTSIYPLEVLKTRLAIRKTGQ---YRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGIDL---AVYETL---KNFYLNYHKNQ-SADPGVLVLLACGTASSTCGQLASYPLSLVRTRLQAQAREKGGGQGDNMVSVLRKIITEDGFKGLYRGLAPNFLKVAPAVSISYVVYENLR 465          
BLAST of slc25a-10 vs. Ensembl Medaka
Match: ENSORLT00000031788.1 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 246.514 bits (628), Expect = 1.659e-78
Identity = 132/286 (46.15%), Postives = 173/286 (60.49%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNR-KMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            SLL G  AG VAKTVIAPLDR KI FQ + ++FS R     +  TY  +G   LWRGN+ATM RV PYA IQ+ SH  YK+LL  D      +ER L    ++    + GSLAG T+   TYPLD+ RARMAVT+ + Y N++ V   + +EEG+   YRG  PTI+G+IPYAG+ F  +E++K +      R +    E  + G  AGL+GQ   YPLD++RRRMQT  VTG   YS  +     I+  EG++ GLYKG SMN +K P A  +SFT +    D +
Sbjct:   40 SLLCGAFAGAVAKTVIAPLDRTKIIFQVSSKRFSAREAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYKKLLGGD---YGSQERALPPFPRL----LAGSLAGTTAATLTYPLDVVRARMAVTAKEMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTYETLKKLHAERTKRCQPYPHERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGS-SYSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLL 317          
BLAST of slc25a-10 vs. Ensembl Medaka
Match: ENSORLT00000000948.2 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 246.514 bits (628), Expect = 1.659e-78
Identity = 132/286 (46.15%), Postives = 173/286 (60.49%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNR-KMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            SLL G  AG VAKTVIAPLDR KI FQ + ++FS R     +  TY  +G   LWRGN+ATM RV PYA IQ+ SH  YK+LL  D      +ER L    ++    + GSLAG T+   TYPLD+ RARMAVT+ + Y N++ V   + +EEG+   YRG  PTI+G+IPYAG+ F  +E++K +      R +    E  + G  AGL+GQ   YPLD++RRRMQT  VTG   YS  +     I+  EG++ GLYKG SMN +K P A  +SFT +    D +
Sbjct:   40 SLLCGAFAGAVAKTVIAPLDRTKIIFQVSSKRFSAREAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYKKLLGGD---YGSQERALPPFPRL----LAGSLAGTTAATLTYPLDVVRARMAVTAKEMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTYETLKKLHAERTKRCQPYPHERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGS-SYSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLL 317          
BLAST of slc25a-10 vs. Ensembl Medaka
Match: ENSORLT00000035929.1 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 246.514 bits (628), Expect = 1.659e-78
Identity = 132/286 (46.15%), Postives = 173/286 (60.49%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNR-KMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            SLL G  AG VAKTVIAPLDR KI FQ + ++FS R     +  TY  +G   LWRGN+ATM RV PYA IQ+ SH  YK+LL  D      +ER L    ++    + GSLAG T+   TYPLD+ RARMAVT+ + Y N++ V   + +EEG+   YRG  PTI+G+IPYAG+ F  +E++K +      R +    E  + G  AGL+GQ   YPLD++RRRMQT  VTG   YS  +     I+  EG++ GLYKG SMN +K P A  +SFT +    D +
Sbjct:   40 SLLCGAFAGAVAKTVIAPLDRTKIIFQVSSKRFSAREAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYKKLLGGD---YGSQERALPPFPRL----LAGSLAGTTAATLTYPLDVVRARMAVTAKEMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTYETLKKLHAERTKRCQPYPHERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGS-SYSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLL 317          
BLAST of slc25a-10 vs. Ensembl Medaka
Match: SLC25A42 (mitochondrial coenzyme A transporter SLC25A42 [Source:NCBI gene;Acc:101165762])

HSP 1 Score: 246.128 bits (627), Expect = 1.792e-78
Identity = 131/298 (43.96%), Postives = 171/298 (57.38%), Query Frame = 2
Query:  182 TKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLL----KVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMT-TTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVY 1060
            ++S  S E  + VL SL  G +AG VAKT +APLDR KI FQ +  +FS +     +  TY  +GF  LWRGN+ATM RV PYA IQ+ +H  YKRLL         +L    R            + GSLAG T+ + TYPLD+ RARMAVT  + Y N+L V   + +EEG+   +RG  PTI+G++PYAG+ F  +E++K +      R    + E    G  AGL+GQ   YPLD++RRRMQT  VTGH  Y         I+  EG I GLYKG SMN +K P A  +SFT +
Sbjct:   24 SQSEGSYEQTRSVLNSLFSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSAKEAYRLIYRTYLKDGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKRLLGGYYGFQGKVLPPVPR-----------LLAGSLAGTTAAMLTYPLDVVRARMAVTPKEMYSNILHVFARISQEEGIKTLFRGFTPTILGVVPYAGLSFFTYETLKKLHAERTGRAHPYSYERLTFGACAGLIGQSASYPLDVVRRRMQTAGVTGH-TYGTIFGTMREIVSEEGFIRGLYKGLSMNWVKGPIAVGISFTTF 309          
BLAST of slc25a-10 vs. Ensembl Medaka
Match: ENSORLT00000000947.2 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 234.958 bits (598), Expect = 4.823e-74
Identity = 131/289 (45.33%), Postives = 171/289 (59.17%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQ---TTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNR-KMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYM 1081
            SLL G  AG VAKTVIAPLDR KI FQ   +    FS +     +  TY  +G   LWRGN+ATM RV PYA IQ+ SH  YK+LL  D      +ER L    ++    + GSLAG T+   TYPLD+ RARMAVT+ + Y N++ V   + +EEG+   YRG  PTI+G+IPYAG+ F  +E++K +      R +    E  + G  AGL+GQ   YPLD++RRRMQT  VTG   YS  +     I+  EG++ GLYKG SMN +K P A  +SFT +    D +
Sbjct:   40 SLLCGAFAGAVAKTVIAPLDRTKIIFQGKISGIGPFSVQEAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYKKLLGGD---YGSQERALPPFPRL----LAGSLAGTTAATLTYPLDVVRARMAVTAKEMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTYETLKKLHAERTKRCQPYPHERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGS-SYSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLL 320          
BLAST of slc25a-10 vs. Planmine SMEST
Match: SMESG000046455.1 (SMESG000046455.1)

HSP 1 Score: 304.294 bits (778), Expect = 3.591e-92
Identity = 155/194 (79.90%), Postives = 156/194 (80.41%), Query Frame = 2
Query:  212 KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTT 793
            KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMI                                      KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVT+
Sbjct: 2316 KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMI--------------------------------------KYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTS 2471          
BLAST of slc25a-10 vs. Planmine SMEST
Match: SMESG000046455.1 (SMESG000046455.1)

HSP 1 Score: 219.164 bits (557), Expect = 1.081e-62
Identity = 104/106 (98.11%), Postives = 105/106 (99.06%), Query Frame = 2
Query:  212 KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINK 529
            KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMI +
Sbjct: 2286 KDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMIKE 2391          
BLAST of slc25a-10 vs. Planmine SMEST
Match: SMESG000074820.1 (SMESG000074820.1)

HSP 1 Score: 151.369 bits (381), Expect = 6.335e-41
Identity = 85/291 (29.21%), Postives = 158/291 (54.30%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDI-VTTHNNRKMTTTETFL---SGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            +L+ GGIAGCV++T  APLDR K+  Q    K +   +I  +       G   LWRGN     ++ P + I++ ++  YK+L+       + E   + + +K    F+ G++AG T+    YP+++ + RM +    +Y ++ D  + +   EG+  F+RG  P I+GIIPYAG+   ++E+ K++ + + N+ K  +T  ++   SG ++ + GQ   YPL ++R ++Q    +      +N+ R   II +EG++ G Y+G   N++K   A ++S+ V+     ++G+
Sbjct:  187 TLVAGGIAGCVSRTATAPLDRLKVTMQAHGAKAANHGIINAIKYMVNEGGVSSLWRGNGVNCIKIAPESAIKFLAYESYKKLI---VNFTQNETGNVTLGEK----FVAGAMAGATAQTLIYPMEVLKTRMCLRKSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSINHDKSASTPIYVSLCSGAVSSVCGQVATYPLALVRTKLQAMSKSDGKISMKNVSRD--IIKNEGVL-GFYRGIGPNMLKVIPAVSISYAVFEQTRHFLGI 467          
BLAST of slc25a-10 vs. Planmine SMEST
Match: SMESG000074801.1 (SMESG000074801.1)

HSP 1 Score: 150.599 bits (379), Expect = 1.208e-40
Identity = 84/291 (28.87%), Postives = 150/291 (51.55%), Query Frame = 2
Query:  227 SLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNR----KMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGPVTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYHSLCDYMGL 1087
            +L+ GG+AGCV++T  APLDR K+  Q    K +   +I  + +     G   LWRGN  +  ++ P + I++ S+  YK+ +     I       + + ++    F  G+LAG TS    +P+++ + RM +    +Y ++ D  + + + EG   F+RG  P ++GI+PYAG+   +FE+ K+I    NN     ++    + LSG  + + GQF  YPL ++R ++Q  P++   + +  M   FR I  +    G Y+G   N +K   A ++S+ V+      +G+
Sbjct:  184 TLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFV---CRITNNTTGDVTLMER----FYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMSDSQKIT--MVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 465          
BLAST of slc25a-10 vs. Planmine SMEST
Match: SMESG000062314.1 (SMESG000062314.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.000e-31
Identity = 76/231 (32.90%), Postives = 113/231 (48.92%), Query Frame = 2
Query:  209 NKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTTDQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFYKRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARARMA-----------------VTSIKKYGNLLDVLR----------------------IMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDI 784
             KD  +  + GGIAG  AKT +APLDR KI  Q   + +      + L+  YK NG   L++GN   + RVFPY+ +Q+ +++ Y      ++I L+     + + K     F+ GSLAGMT+   TYPLDL RAR+A                 +T +  YG  L++ +                      I + E G+   Y+G +PT+IG+ PYAG  F  FES+K +
Sbjct:    5 KKDPFYRFIIGGIAGITAKTTVAPLDRVKILIQGRKKTYVNLGPFQILIEVYKENGIKGLFQGNLTQLLRVFPYSAVQFFTYSMYSD--ACNTIGLRTA---VGLEK-----FVSGSLAGMTACTLTYPLDLIRARIAFQDKHSKFYHLVHKEKVLTDVSFYGPDLEIQKNPNSFPRFQHHYYKGIWDAFVTIFKYENGIFGLYKGFSPTLIGMAPYAGTSFYTFESMKKL 225          

HSP 2 Score: 72.7886 bits (177), Expect = 2.381e-14
Identity = 61/215 (28.37%), Postives = 90/215 (41.86%), Query Frame = 2
Query:  539 FNFICGSLAGMTSVLCTYPLDLARARMAVTSIKK-YGNL--LDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLVFESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQ-----------------------TGP---VTGHP--------EYSQNMWRTFRIICS-EGLIHGLYKGFSMNLIKTPTASAVSFTVYHSL 1069
            + FI G +AG+T+     PLD  R ++ +   KK Y NL    +L  + KE G+   ++G    ++ + PY+ V F  +    D   T   R     E F+SG +AG+      YPLD+IR R+                         GP   +  +P         Y + +W  F  I   E  I GLYKGFS  LI     +  SF  + S+
Sbjct:   10 YRFIIGGIAGITAKTTVAPLD--RVKILIQGRKKTYVNLGPFQILIEVYKENGIKGLFQGNLTQLLRVFPYSAVQFFTYSMYSDACNTIGLRTAVGLEKFVSGSLAGMTACTLTYPLDLIRARIAFQDKHSKFYHLVHKEKVLTDVSFYGPDLEIQKNPNSFPRFQHHYYKGIWDAFVTIFKYENGIFGLYKGFSPTLIGMAPYAGTSFYTFESM 222          
The following BLAST results are available for this feature:
BLAST of slc25a-10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A422.960e-7243.92solute carrier family 25 member 42 [Source:HGNC Sy... [more]
SLC25A169.212e-5536.60solute carrier family 25 member 16 [Source:HGNC Sy... [more]
SLC25A243.231e-4232.65solute carrier family 25 member 24 [Source:HGNC Sy... [more]
SLC25A243.231e-4232.65solute carrier family 25 member 24 [Source:HGNC Sy... [more]
SLC25A243.352e-4232.65solute carrier family 25 member 24 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-25A425.868e-7644.67SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
F55A11.41.125e-3127.95pep chromosome:WBcel235:V:11771248:11773490:1 gene... [more]
F55A11.41.125e-3127.95pep chromosome:WBcel235:V:11770456:11773494:1 gene... [more]
C47E12.21.119e-3027.95pep chromosome:WBcel235:IV:10001972:10003348:-1 ge... [more]
C47E12.21.119e-3027.95pep chromosome:WBcel235:IV:10001974:10003534:-1 ge... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DPCoAC1.139e-6945.21gene:FBgn0067783 transcript:FBtr0344280[more]
DPCoAC7.548e-6945.05gene:FBgn0067783 transcript:FBtr0344282[more]
DPCoAC7.548e-6945.05gene:FBgn0067783 transcript:FBtr0089482[more]
DPCoAC7.548e-6945.05gene:FBgn0067783 transcript:FBtr0089480[more]
DPCoAC9.991e-6844.64gene:FBgn0067783 transcript:FBtr0344281[more]
back to top
BLAST of slc25a-10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a421.657e-7643.24solute carrier family 25 member 42 [Source:NCBI ge... [more]
slc25a161.882e-5535.96solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
slc25a162.231e-5535.65solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
slc25a241.137e-4130.93solute carrier family 25 member 24 [Source:NCBI ge... [more]
slc25a23a6.861e-4030.98solute carrier family 25 member 23a [Source:ZFIN;A... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep1525.270e-8045.33centrosomal protein 152kDa [Source:Xenbase;Acc:XB-... [more]
slc25a169.720e-5736.05solute carrier family 25 member 16 [Source:NCBI ge... [more]
slc25a244.862e-4232.30solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a245.450e-4232.30solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a246.208e-4232.30solute carrier family 25 (mitochondrial carrier; p... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a421.284e-6943.00solute carrier family 25, member 42 [Source:MGI Sy... [more]
Slc25a421.284e-6943.00solute carrier family 25, member 42 [Source:MGI Sy... [more]
Slc25a164.178e-5435.62solute carrier family 25 (mitochondrial carrier, G... [more]
Slc25a169.716e-5135.69solute carrier family 25 (mitochondrial carrier, G... [more]
Slc25a231.461e-4030.93solute carrier family 25 (mitochondrial carrier; p... [more]
back to top
BLAST of slc25a-10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PQ27|S2542_XENLA1.433e-8046.37Mitochondrial coenzyme A transporter SLC25A42 OS=X... [more]
sp|Q05AQ3|S2542_XENTR1.367e-7945.33Mitochondrial coenzyme A transporter SLC25A42 OS=X... [more]
sp|Q0P483|S2542_DANRE1.210e-7543.39Mitochondrial coenzyme A transporter SLC25A42 OS=D... [more]
sp|Q86VD7|S2542_HUMAN1.422e-7143.92Mitochondrial coenzyme A transporter SLC25A42 OS=H... [more]
sp|Q8R0Y8|S2542_MOUSE8.981e-6943.00Mitochondrial coenzyme A transporter SLC25A42 OS=M... [more]
back to top
BLAST of slc25a-10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKA90.000e+0100.00Slc25a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
C1LIV91.687e-9851.90Grave disease carrier protein homolog OS=Schistoso... [more]
A0A3Q0KNL64.342e-9751.38Mitochondrial carrier protein-related OS=Schistoso... [more]
A0A183NVM52.978e-9348.85Uncharacterized protein OS=Schistosoma mattheei OX... [more]
G4VNT43.378e-9348.57Mitochondrial carrier protein-related OS=Schistoso... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a423.543e-7843.96solute carrier family 25 member 42 [Source:NCBI ge... [more]
slc25a162.144e-5839.39solute carrier family 25 member 16 [Source:NCBI ge... [more]
slc25a162.144e-5839.39solute carrier family 25 member 16 [Source:NCBI ge... [more]
slc25a23a6.688e-4332.66calcium-binding mitochondrial carrier protein SCaM... [more]
slc25a23a2.882e-4232.99calcium-binding mitochondrial carrier protein SCaM... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a161.053e-5136.95solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
ENSPMAT00000004577.17.732e-4329.97pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
slc25a23a9.047e-4130.72solute carrier family 25 member 23a [Source:ZFIN;A... [more]
slc25a41.468e-2526.44solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
slc25a44.384e-2026.21solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
LEU51.410e-4331.03Mitochondrial carrier protein; involved in the acc... [more]
YPR011C_mRNA1.579e-4029.81Mitochondrial transporter; major substrates are ad... [more]
AAC35.682e-3530.23Mitochondrial inner membrane ADP/ATP translocator;... [more]
PET91.263e-3228.30Major ADP/ATP carrier of the mitochondrial inner m... [more]
AAC17.269e-3229.83Mitochondrial inner membrane ADP/ATP translocator;... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384537.971e-8546.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371538.086e-4933.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310586.900e-4734.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344262.282e-4631.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321851.953e-4231.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031788.11.659e-7846.15mitochondrial coenzyme A transporter SLC25A42-like... [more]
ENSORLT00000000948.21.659e-7846.15mitochondrial coenzyme A transporter SLC25A42-like... [more]
ENSORLT00000035929.11.659e-7846.15mitochondrial coenzyme A transporter SLC25A42-like... [more]
SLC25A421.792e-7843.96mitochondrial coenzyme A transporter SLC25A42 [Sou... [more]
ENSORLT00000000947.24.823e-7445.33mitochondrial coenzyme A transporter SLC25A42-like... [more]
back to top
BLAST of slc25a-10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046455.13.591e-9279.90SMESG000046455.1[more]
SMESG000046455.11.081e-6298.11SMESG000046455.1[more]
SMESG000074820.16.335e-4129.21SMESG000074820.1[more]
SMESG000074801.11.208e-4028.87SMESG000074801.1[more]
SMESG000062314.11.000e-3132.90SMESG000062314.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027723
GenBankAKN21578.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027723 ID=SMED30027723|Name=slc25a-10|organism=Schmidtea mediterranea sexual|type=transcript|length=1230bp
TTAAATTTAAAATATCTTTTTTTTCATTAGAATGTTTTATTTTGTGTAAT
TATTTGGATTTTTTTCTTTTTTGCTTTATATCTATCTTATTGGATTTAGT
ATTATTCTATAAAATATTAGTTCTATTATTATATAACAATGTTGTACTTA
TAATCTTGTCAATATGAAGGTTAATGAGCTCACAAAATCGTCAACAAGTG
TTGAAGTCAATAAAGACGTACTATTTTCATTACTTTTCGGTGGAATAGCT
GGGTGTGTGGCCAAAACTGTTATTGCGCCATTGGATCGAGCTAAAATCAA
CTTCCAAACAACAGATCAGAAATTTTCATTTCGTGCAATGATTGAATTTT
TACTAAACACATATAAAACTAATGGATTTCATTATTTATGGCGTGGAAAT
ACTGCAACGATGAGTCGAGTTTTCCCGTATGCTGGCATACAGTATACGTC
ACATGCTTTCTATAAACGACTACTTAAAGTTGATAGTATAATTTTGAAAA
AGGAAGAACGCCAATTAATGATCAACAAAAAAATTGCTTTCAACTTCATT
TGTGGTTCTTTGGCAGGAATGACATCTGTATTATGTACTTATCCATTAGA
TCTCGCCAGGGCAAGAATGGCTGTGACTAGCATTAAAAAATATGGAAATC
TTTTAGATGTTCTAAGAATAATGAGAAAAGAAGAAGGGTTACTAGCATTT
TACAGAGGCATCAATCCTACTATTATAGGTATAATACCATATGCAGGAGT
TGGATTTCTAGTATTTGAAAGTATAAAAGATATTGTAACTACACACAATA
ACAGAAAAATGACTACAACAGAAACATTTTTGTCTGGTGGCATCGCTGGT
TTAATGGGACAGTTTTGTTGTTATCCTTTAGATATTATCAGAAGACGTAT
GCAAACAGGTCCTGTAACAGGTCATCCAGAATACTCTCAAAATATGTGGA
GGACATTTAGAATTATATGTTCTGAGGGTTTAATTCATGGGTTATATAAA
GGATTTTCTATGAATTTAATCAAAACACCAACAGCGTCAGCTGTTAGTTT
TACCGTATATCATAGTCTTTGTGATTACATGGGATTGCGAGTGTATAAAA
AATAGTGTCAAAAAAAATCTGCGAATAGCTTCTAGATTATGTAAATATAA
TTATTTTTAAAATTTATGATCGCTAGGAAATATCCATGCACGTTTAATAT
CTAGGTTCTGTTTGATTGGCTTTTTTATGT
back to top

protein sequence of SMED30027723-orf-1

>SMED30027723-orf-1 ID=SMED30027723-orf-1|Name=SMED30027723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MKVNELTKSSTSVEVNKDVLFSLLFGGIAGCVAKTVIAPLDRAKINFQTT
DQKFSFRAMIEFLLNTYKTNGFHYLWRGNTATMSRVFPYAGIQYTSHAFY
KRLLKVDSIILKKEERQLMINKKIAFNFICGSLAGMTSVLCTYPLDLARA
RMAVTSIKKYGNLLDVLRIMRKEEGLLAFYRGINPTIIGIIPYAGVGFLV
FESIKDIVTTHNNRKMTTTETFLSGGIAGLMGQFCCYPLDIIRRRMQTGP
VTGHPEYSQNMWRTFRIICSEGLIHGLYKGFSMNLIKTPTASAVSFTVYH
SLCDYMGLRVYKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
GO:0015217ADP transmembrane transporter activity
GO:0015228coenzyme A transmembrane transporter activity
GO:0080122AMP transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0006839mitochondrial transport
GO:0015866ADP transport
GO:0035349coenzyme A transmembrane transport
GO:0080121AMP transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR002167Graves_DC
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 22..35
score: 46.84
coord: 78..98
score: 30.68
coord: 225..247
score: 37.13
coord: 180..198
score: 47.28
coord: 35..49
score: 43.93
coord: 137..155
score: 47.02
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 216..305
e-value: 1.5E-19
score: 69.7
coord: 124..211
e-value: 1.9E-22
score: 79.0
coord: 21..105
e-value: 9.1E-19
score: 67.2
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 216..305
score: 17.321
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 122..207
score: 24.594
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 17..103
score: 17.643
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 13..311
e-value: 2.0E-79
score: 268.4
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 18..299
NoneNo IPR availablePANTHERPTHR24089:SF621MITOCHONDRIAL COENZYME A TRANSPORTER SLC25A42coord: 12..301
NoneNo IPR availablePANTHERPTHR24089FAMILY NOT NAMEDcoord: 12..301
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..31
score: 5.0
NoneNo IPR availableTMHMMTMhelixcoord: 20..39
NoneNo IPR availableTMHMMTMhelixcoord: 179..201
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 54..76