Filamin ABP280 repeat

Overview
NameFilamin ABP280 repeat
Smed IDSMED30027720
Length (bp)1433
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Filamin ABP280 repeat (SMED30027720) t-SNE clustered cells

Violin plots show distribution of expression levels for Filamin ABP280 repeat (SMED30027720) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027720

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30027720SMESG000043540.1 Contig4999_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Filamin ABP280 repeat vs. TrEMBL
Match: A0A068YD94 (Filamin ABP280 repeat OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000776000 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 9.757e-101
Identity = 141/268 (52.61%), Postives = 210/268 (78.36%), Query Frame = 3
Query:   45 MAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDLNIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRESRDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRI-KVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKV 845
            M+E QY RKALEEVI+LADEKI + E+  LK+ED FN+F    DDT+KDL+ YF S+ +QLEKWK V++Q+L+  T+   S ++ + +++ E I +LRE R+ SA +++T Q  N D V+ +H  ++ +++ ++  ++ + +C+PLKF+G+LN DS +K ++G+LE+LAD + AEILP KLPKIKLGQLF ++FRISK++C+A K++++++V+K D +  KV +YL DN+DG++ LSFPITAI+PHTV+IY+LGEHIRNSPYTI+FKV
Sbjct:    1 MSEKQYARKALEEVIRLADEKIVATEEIVLKKEDDFNEFAHSCDDTVKDLDQYFISIMRQLEKWKHVFIQELQASTSAAASEFQNRNAQIGELIGRLRELRETSAHILATEQFKNTDLVFDVHGCIFSINQAIENMTEFLAECVPLKFVGKLNFDSVQKSDVGSLERLADNNYAEILPSKLPKIKLGQLFNLDFRISKKYCEAAKRFITYSVSKEDGQYQKVCAYLHDNKDGSYALSFPITAIIPHTVHIYYLGEHIRNSPYTIVFKV 268          
BLAST of Filamin ABP280 repeat vs. TrEMBL
Match: A0A0R3W8W8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6846 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 1.394e-100
Identity = 142/268 (52.99%), Postives = 210/268 (78.36%), Query Frame = 3
Query:   45 MAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDLNIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRESRDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRI-KVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKV 845
            M+E QY RKALEEVI+LADEKI + E+  LK+ED FN+F    DDT+KDL  YF S+ +QLEKWK V++Q+L+  T+   S ++ + +++ E I +LRE R+ SA +++T Q  N D V+ +H  ++ +++ ++  ++ +T+C+PLKF+G+LN DS +K ++G++E+LAD + AEILP KLPKIKLGQLF ++FRISK++C+A K++++++VTK D +  KV +YL DN+DG++ LSFPITAI+PHTV+IY+LGEHIRNSPYTI+FKV
Sbjct:    1 MSEKQYARKALEEVIRLADEKIVATEEIILKKEDDFNEFAHSCDDTVKDLEQYFLSIVRQLEKWKHVFIQELQASTSAAASEFQNRSAQIGELIGRLRELRETSAHILATEQFKNTDLVFDVHGCIFSINQAIENMTEFLTECVPLKFVGKLNFDSVQKSDVGSMERLADNNYAEILPSKLPKIKLGQLFNLDFRISKKYCEAAKRFITYSVTKEDCQYQKVCAYLHDNKDGSYALSFPITAIIPHTVHIYYLGEHIRNSPYTIVFKV 268          
BLAST of Filamin ABP280 repeat vs. TrEMBL
Match: U6J119 (Filamin ABP280 repeat OS=Echinococcus granulosus OX=6210 GN=EGR_00338 PE=4 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 2.081e-100
Identity = 140/268 (52.24%), Postives = 210/268 (78.36%), Query Frame = 3
Query:   45 MAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDLNIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRESRDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRI-KVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKV 845
            M+E QY RKALEEVI+LADEKI + E+  LK+ED FN+F    DDT+KDL+ YF S+ +QLEKWK V++Q+L+  T+   S ++ + +++ E I +LRE R+ SA +++T Q  N D V+ +H  ++ +++ ++  ++ + +C+PLKF+G+LN DS +K ++G++E+LAD + AEILP KLPKIKLGQLF ++FRISK++C+A K++++++V+K D +  KV +YL DN+DG++ LSFPITAI+PHTV+IY+LGEHIRNSPYTI+FKV
Sbjct:    1 MSEKQYARKALEEVIRLADEKIVATEEIVLKKEDDFNEFAHSCDDTVKDLDQYFLSIMRQLEKWKHVFIQELQASTSAAASEFQNRNAQIGELIGRLRELRETSAHILATEQFKNTDLVFDVHGCIFSINQAIENMTEFLAECVPLKFVGKLNFDSVQKSDVGSMERLADNNYAEILPSKLPKIKLGQLFNLDFRISKKYCEAAKRFITYSVSKEDGQYQKVCAYLHDNKDGSYALSFPITAIIPHTVHIYYLGEHIRNSPYTIVFKV 268          
BLAST of Filamin ABP280 repeat vs. TrEMBL
Match: A0A0X3Q3X9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR122634 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.533e-99
Identity = 146/297 (49.16%), Postives = 229/297 (77.10%), Query Frame = 3
Query:   45 MAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDLNIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRESRDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRI-KVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKVXXXXXXXXXXXXXVLPDPSAHMGDDKDLM 932
            M+E QY RKALEEVI+LADEKI S E+  L++++ F+++ +  D+T+K+L+ YF S+ +QLEKWK V++Q+L+  T++  + +  Q ++VNE + KLR+ R+ SA ++++GQ +N + VY +H  ++ +++ ++  +  +++C+PLKF+G+LN ++ +K EIG++E+LAD S AEILP KLPKIKLGQLF+++FRIS+++C+A K +++++VTK D +  KV +YLQDN++G++ LSFPITAI+PHTV+I +LGEHIRNSPYTI+FK+G  Q+   GGG    P  + +MG  KDLM
Sbjct:    1 MSEQQYARKALEEVIRLADEKIMSTEEVLLRKDEDFSEYARSCDETIKELDQYFLSIMRQLEKWKHVFIQELQASTSSAGAEFHNQTARVNELLAKLRDLRETSAHILNSGQFSNSELVYDVHGCIFNINQAVENLTDFLSECLPLKFVGKLNYENVQKAEIGSMERLADLSCAEILPSKLPKIKLGQLFHLDFRISRKYCEAAKNFITYSVTKDDAQYQKVRAYLQDNKNGSYALSFPITAIIPHTVHILYLGEHIRNSPYTIVFKIGPNQSPSNGGGMVGQP-VAGYMGATKDLM 296          
BLAST of Filamin ABP280 repeat vs. TrEMBL
Match: A0A183SDA6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS2204 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.690e-99
Identity = 147/300 (49.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:   36 NALMAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDLNIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRESRDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRI-KVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKVXXXXXXXXXXXXXVLPDPSAHMGDDKDLM 932
            N  M+E QY RKALEEVI+LADEKI S E+  L++++ F+++ +  D+T+K+L+ YF S+ +QLEKWK V++Q+L+  T++  + +  Q ++VNE + KLR+ R+ SA ++++GQ +N + VY +H  ++ +++ ++  +  +++C+PLKF+G+LN ++ +K EIG++E+LAD S AEILP KLPKIKLGQLF+++FRIS+++C+A K +++++VTK D +  KV +YLQDN++G++ LSFPITAI+PHTV+I +LGEHIRNSPYTI+FK+G  Q+   GGG    P  + +MG  KDLM
Sbjct:   13 NTNMSEQQYARKALEEVIRLADEKIMSTEEVLLRKDEDFSEYARSCDETIKELDQYFLSIMRQLEKWKHVFIQELQASTSSAGAEFHNQTARVNELLAKLRDLRETSAHILNSGQFSNSELVYDVHGCIFNINQAVENLTDFLSECLPLKFVGKLNYENVQKAEIGSMERLADLSCAEILPSKLPKIKLGQLFHLDFRISRKYCEAAKNFITYSVTKDDAQYQKVRAYLQDNKNGSYALSFPITAIIPHTVHILYLGEHIRNSPYTIVFKIGPNQSPSNGGGMVGQP-VAGYMGATKDLM 311          
BLAST of Filamin ABP280 repeat vs. Planmine SMEST
Match: SMESG000064507.1 (SMESG000064507.1)

HSP 1 Score: 470.315 bits (1209), Expect = 6.429e-166
Identity = 222/300 (74.00%), Postives = 266/300 (88.67%), Query Frame = 3
Query:   45 MAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDLNIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRESRDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRIKVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKVXXXXXXXXXXXXXVLPDPSAHMGDDKDLMRMKH 944
            MAESQYNRKALEEVIKLADEK + V++YF+KQED F+DFI+ SD+T+KDLN+YFNSLQKQLEKWK V+ QD++QDT +CES YE+QRSKVNE ++KL+E RDQ+AR+ISTGQVTNCD VY+IHNL+Y VDE+LKEF   MT CM LKF+GR+NLD++EK EIGTLEKL+DFSNAEILPIKLPKIKLGQLF+INFRI+KRFC+A KKY+SF+VTKSD+RIKVGSYLQDN+DGTFTLSFPITAIVPHTV+IYFLGEHIRNSPYTILFKVGN Q      G   +PD + H  ++K++ ++K+
Sbjct:    1 MAESQYNRKALEEVIKLADEKTSQVDEYFVKQEDDFSDFIRNSDETLKDLNVYFNSLQKQLEKWKMVFSQDVQQDTTSCESHYEKQRSKVNEYVEKLKECRDQAARLISTGQVTNCDHVYSIHNLIYSVDENLKEFGNHMTQCMALKFVGRINLDNFEKNEIGTLEKLSDFSNAEILPIKLPKIKLGQLFFINFRIAKRFCEATKKYISFSVTKSDERIKVGSYLQDNKDGTFTLSFPITAIVPHTVSIYFLGEHIRNSPYTILFKVGNNQAVGATNGANSVPDYNCHAAEEKEISKVKY 300          
BLAST of Filamin ABP280 repeat vs. Planmine SMEST
Match: SMESG000043540.1 (SMESG000043540.1)

HSP 1 Score: 405.601 bits (1041), Expect = 8.935e-142
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 3
Query:  363 MISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRIKVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKVXXXXXXXXXXXXXVLPDPSAHMGDDKDLMRMKHNPHMDSSSINVHKHN 989
            MISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRIKVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKVGNGQTGPTGGGGGVLPDPSAHMGDDKDLMRMKHNPHMDSSSINVHKHN
Sbjct:    1 MISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIGRLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRFCDAMKKYVSFTVTKSDDRIKVGSYLQDNRDGTFTLSFPITAIVPHTVNIYFLGEHIRNSPYTILFKVGNGQTGPTGGGGGVLPDPSAHMGDDKDLMRMKHNPHMDSSSINVHKHN 209          
The following BLAST results are available for this feature:
BLAST of Filamin ABP280 repeat vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YD949.757e-10152.61Filamin ABP280 repeat OS=Echinococcus multilocular... [more]
A0A0R3W8W81.394e-10052.99Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
U6J1192.081e-10052.24Filamin ABP280 repeat OS=Echinococcus granulosus O... [more]
A0A0X3Q3X92.533e-9949.16Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183SDA62.690e-9949.00Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Filamin ABP280 repeat vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064507.16.429e-16674.00SMESG000064507.1[more]
SMESG000043540.18.935e-142100.00SMESG000043540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027720 ID=SMED30027720|Name=Filamin ABP280 repeat|organism=Schmidtea mediterranea sexual|type=transcript|length=1433bp
ATAAATCTTATATGTTCCAGTTATATAAAAAATAAAACGCTTTAATGGCA
GAATCACAATACAACAGAAAAGCTTTAGAAGAAGTTATTAAATTAGCCGA
TGAAAAAATAAATAGCGTTGAAGACTATTTTCTGAAACAAGAAGACACAT
TTAATGACTTTATTAAAGGAAGCGATGACACTATGAAAGACCTGAACATT
TATTTTAATAGCTTGCAAAAGCAATTGGAAAAATGGAAAAGTGTTTATTT
ACAGGACCTTCGGCAAGACACGGCAAACTGTGAATCGCTTTATGAACGGC
AGAGATCCAAAGTCAACGAATGCATCGACAAATTGCGTGAGTCGCGAGAT
CAATCCGCAAGAATGATATCGACTGGCCAAGTGACAAATTGCGATCAGGT
TTACACCATTCACAATCTCCTATACAAAGTCGATGAGCATTTAAAAGAGT
TCAGTCAAGTCATGACAGACTGCATGCCTTTGAAATTCATTGGCCGACTG
AATTTGGATTCCTATGAAAAACCCGAAATCGGAACTCTGGAAAAGCTGGC
AGATTTTTCCAACGCAGAAATCCTTCCAATAAAACTGCCGAAAATAAAAC
TCGGCCAACTGTTCTACATCAATTTCCGAATCTCGAAACGATTCTGTGAC
GCAATGAAGAAATATGTCTCATTTACCGTAACAAAATCCGATGACCGAAT
AAAAGTCGGCTCGTATTTACAGGACAATCGCGACGGAACGTTCACGCTGA
GTTTTCCGATTACTGCGATTGTTCCTCACACTGTCAACATCTATTTCCTC
GGTGAGCACATCAGAAACAGTCCCTATACGATTCTGTTTAAGGTGGGGAA
CGGACAGACCGGTCCTACTGGGGGCGGCGGGGGAGTCCTGCCTGATCCCA
GTGCTCACATGGGCGACGATAAAGATCTCATGAGAATGAAACACAATCCT
CACATGGACTCGTCCAGTATCAATGTTCACAAGCACAATTAATTACCATT
CAATGACCGATGATAATTGATTCCATAATATACCCAAGCCTGATTTGATT
AAGGTTCCGTTTTATTTCCTACGGTAATAGCTACCGTAATTTGGTTACCC
TCTGTCAACATAGCCTTTTATCCGCAGCATAATTTTCACATGCACATAAA
TATATATCATTATTGTTATTATTATTGGCTTTCATTTTGTGTGGTTTAAC
GATTTATCATTTATTCTGATATTTTCTACACAATTTTTCATTTGTAACTA
TGAGTAAAAATTGATGAAATTGAAAAAAAAACAATTTTTTATTTTGAAAA
GTAAAATGCTGGATTTAATTTTCTCTGGCTGTTGCTATTTTCCATGTATT
GGATCAAAAATAAAGATGTAAACTAGTCTTAAGAGCTTGATATTATGTAT
TTTAACTTAATTCAATATATTTAATTATGAGTG
back to top

protein sequence of SMED30027720-orf-1

>SMED30027720-orf-1 ID=SMED30027720-orf-1|Name=SMED30027720-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MAESQYNRKALEEVIKLADEKINSVEDYFLKQEDTFNDFIKGSDDTMKDL
NIYFNSLQKQLEKWKSVYLQDLRQDTANCESLYERQRSKVNECIDKLRES
RDQSARMISTGQVTNCDQVYTIHNLLYKVDEHLKEFSQVMTDCMPLKFIG
RLNLDSYEKPEIGTLEKLADFSNAEILPIKLPKIKLGQLFYINFRISKRF
CDAMKKYVSFTVTKSDDRIKVGSYLQDNRDGTFTLSFPITAIVPHTVNIY
FLGEHIRNSPYTILFKVGNGQTGPTGGGGGVLPDPSAHMGDDKDLMRMKH
NPHMDSSSINVHKHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001298Filamin/ABP280_rpt
IPR017868Filamin/ABP280_repeat-like
IPR013783Ig-like_fold
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 83..103
IPR001298Filamin/ABP280 repeatSMARTSM00557flmn_3coord: 188..268
e-value: 0.0098
score: 9.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 191..269
e-value: 5.0E-9
score: 38.1
IPR017868Filamin/ABP280 repeat-likePFAMPF00630Filamincoord: 213..262
e-value: 1.1E-6
score: 29.3
IPR017868Filamin/ABP280 repeat-likePROSITEPS50194FILAMIN_REPEATcoord: 193..265
score: 11.746
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 204..264