JmjC domain-containing protein

Overview
NameJmjC domain-containing protein
Smed IDSMED30027717
Length (bp)1555
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of JmjC domain-containing protein (SMED30027717) t-SNE clustered cells

Violin plots show distribution of expression levels for JmjC domain-containing protein (SMED30027717) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of JmjC domain-containing protein (SMED30027717) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for JmjC domain-containing protein (SMED30027717) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: KDM8 (lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:25840])

HSP 1 Score: 77.0258 bits (188), Expect = 1.958e-14
Identity = 59/228 (25.88%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSY---NDSDI------YMVNNLPNFLNEDIHFPWPLQCDLFD--ENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F E F+   +P+++K  A ++P M+KW  EY   +      P  V    T ++ ++TL    M   +FI  Y      D+       + + +P  L +DI  P    C L D  E    +  WF    T S +H D  +N    + G K   L  P++ G   P      +  S +DV+  D  K+ K     F+   +  G+ L+IP  + H VR+   + +++ W+
Sbjct:  195 FREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTL----MTVNEFISKYIVNEPRDVGYLAQHQLFDQIPE-LKQDISIP--DYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 415          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: KDM8 (lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:25840])

HSP 1 Score: 77.0258 bits (188), Expect = 2.346e-14
Identity = 59/228 (25.88%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSY---NDSDI------YMVNNLPNFLNEDIHFPWPLQCDLFD--ENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F E F+   +P+++K  A ++P M+KW  EY   +      P  V    T ++ ++TL    M   +FI  Y      D+       + + +P  L +DI  P    C L D  E    +  WF    T S +H D  +N    + G K   L  P++ G   P      +  S +DV+  D  K+ K     F+   +  G+ L+IP  + H VR+   + +++ W+
Sbjct:  233 FREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTL----MTVNEFISKYIVNEPRDVGYLAQHQLFDQIPE-LKQDISIP--DYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 453          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD7 (jumonji domain containing 7 [Source:HGNC Symbol;Acc:HGNC:34397])

HSP 1 Score: 75.485 bits (184), Expect = 2.773e-14
Identity = 57/269 (21.19%), Postives = 110/269 (40.89%), Query Frame = 1
Query:  133 VSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKK---KENRTLKNMEMNFK-DFI------KSYNDSDIYM---VNNLPNFLNE-----DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVDRV-------------DFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            +++ + +    P+ F+  +V  N+P +++ A +++PA++KW   YF     S      V  +      + +R +   E      F+      ++ +   +Y+    +NLP+ L +     + H PW    +   +    V  W       + +H D  EN+ C++ G K F L  P      IP          + +EG +  +D + +             D ++Y        +   + AG+ LY+P LW H V+     IA+N W+
Sbjct:   27 LAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLESHVPW--ASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHF-LFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWY 292          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD7 (jumonji domain containing 7 [Source:HGNC Symbol;Acc:HGNC:34397])

HSP 1 Score: 59.6918 bits (143), Expect = 1.580e-9
Identity = 38/161 (23.60%), Postives = 64/161 (39.75%), Query Frame = 1
Query:  406 MVNNLPNFLNE-DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVDRV-------------DFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            + + LP  L + + H PW    +   +    V  W       + +H D  EN+ C++ G K F L  P      IP          + +EG +  +D + +             D ++Y        +   + AG+ LY+P LW H V+     IA+N W+
Sbjct:   36 LPSELPQLLPDLESHVPW--ASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHF-LFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWY 193          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: TYW5 (tRNA-yW synthesizing protein 5 [Source:HGNC Symbol;Acc:HGNC:26754])

HSP 1 Score: 56.9954 bits (136), Expect = 3.326e-8
Identity = 42/136 (30.88%), Postives = 60/136 (44.12%), Query Frame = 1
Query:  427 FLNEDIHFPWPLQCDLF-DENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVP 825
             L  DI FP     + F +E  F  +   SS       H D M+N+   + G K  VL  P    D   +  +G  S++ ++D  D +KY            +EAGD L+IP LW H V S    + +NI W  +P
Sbjct:  127 LLKGDIKFP-----EFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPR---DAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLP 254          
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Match: jmjd-5 (JuMonJi (Transcription factor) Domain protein [Source:UniProtKB/TrEMBL;Acc:Q17765])

HSP 1 Score: 93.9745 bits (232), Expect = 4.212e-20
Identity = 66/219 (30.14%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  184 SFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMV-----NNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSD---IDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            S VQ N PL++++ + N PA+EKW   + L    S  +P  V I TK  +    + + M FK+FI++  +  +Y+      + +P+ L  D+  P     +  +     + MW    +T S +HTD  +N+   + GTK F +V PE      P   +G  S+   +DV+  D   +   E V+ + A +  GD ++IP+ W H VRS   +I+I+ WF
Sbjct:  365 SAVQNNTPLIVRRHSSNMPAIEKWSFPFLLQELHSRTFP--VEIGTKYSDENWSQKL-MTFKEFIRNSENERLYLAQHRLFDQVPH-LKRDVIIPDVCFGESSNPENVDMNMWIGPQDTVSPLHTDPRKNMFVQVHGTKLFRMVAPESSESVYPF--DGILSNTSQVDVENPDLKIFPNFEQVEVLDAVINPGDAIFIPEKWWHFVRSTSPSISISFWF 577          
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Match: JMJD5 (gene:FBgn0035166 transcript:FBtr0300712)

HSP 1 Score: 68.5514 bits (166), Expect = 4.427e-12
Identity = 58/227 (25.55%), Postives = 96/227 (42.29%), Query Frame = 1
Query:  193 QKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKK-ENRTLKNMEMNFKDFIK-------SYNDSDI-YMVNN-----LPNFLNEDIHFPWPLQCDLFDENIFQVI---MWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKE--GAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            +  +P L+    +++PA+ KW D   LN  L +    TV IE      +       +  +DF+        S    +I Y+  +     +P  L EDI  P    C + +E+    +    W     T S +H D   N+ C + G+K  +L  P    +  P   E     + ID  ++D   Y  +  V F    ++ GDCLY+P  W H VRS   + +++ W+
Sbjct:  180 EAGQPTLLLNTIQHWPALHKWLD---LNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPA-LKEDISIP--DYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 400          
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Match: JMJD5 (gene:FBgn0035166 transcript:FBtr0331402)

HSP 1 Score: 68.5514 bits (166), Expect = 4.484e-12
Identity = 58/227 (25.55%), Postives = 96/227 (42.29%), Query Frame = 1
Query:  193 QKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKK-ENRTLKNMEMNFKDFIK-------SYNDSDI-YMVNN-----LPNFLNEDIHFPWPLQCDLFDENIFQVI---MWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKE--GAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            +  +P L+    +++PA+ KW D   LN  L +    TV IE      +       +  +DF+        S    +I Y+  +     +P  L EDI  P    C + +E+    +    W     T S +H D   N+ C + G+K  +L  P    +  P   E     + ID  ++D   Y  +  V F    ++ GDCLY+P  W H VRS   + +++ W+
Sbjct:  173 EAGQPTLLLNTIQHWPALHKWLD---LNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPA-LKEDISIP--DYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 393          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: jmjd7 (jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-050417-86])

HSP 1 Score: 79.7221 bits (195), Expect = 6.494e-16
Identity = 59/268 (22.01%), Postives = 106/268 (39.55%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS-----MYYPNTVNIETKKKENRTLKNMEMNFKDFI-----KSYNDSDIYMVNNLPNFLNE--------DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVD-------------RVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            ++ + +  + P+ F+  ++  NKP +++ A  ++PA+ KW+  Y      S        PN              +  +M+F   +     K  + +  Y+     N + E          H PW    +   +    V  W    +  + +H D  EN+ C+I G K FVL+ P      IP           K +G +  +D +             + DF ++    +   +   ++AG+ LY+P LW H VR  H  IA+N W+
Sbjct:   23 AVPYLDEPLSPLQFYRDWIGPNKPCIIRNAFNDWPALSKWNPTYLREKVGSKVISVAVTPNGFADAVNGNRFVMPEERQMSFSSLLDIVEGKIKSSAVFYVQKQCSNLMEEIPELTGDVQTHIPW--MSEALGKLPDAVNFWLGEESAVTSMHKDHYENLYCVISGQKEFVLLPPTDR-PFIPYELYQPATYRQKDDGTFEIVDEENSPKVPWIPLDPLKPDFERFPSYRHAKALHCTVKAGEMLYLPSLWFHHVRQSHGCIAVNFWY 287          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: kdm8 (lysine (K)-specific demethylase 8 [Source:NCBI gene;Acc:436936])

HSP 1 Score: 65.0846 bits (157), Expect = 7.509e-11
Identity = 57/221 (25.79%), Postives = 93/221 (42.08%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEK--WDDEYFLNLNLSMYYPNTVNIETKKK---ENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F   F+   KP++++    ++PA  +  W  +Y   +        TV IE   K   E  + K + +N  DFI      D Y+   +P  L EDI  P        DE+   +  WF  G T S +H D  +N    + G K   L  PE+     P + +  +  S ++V+  D  K+       +    +  GD L+IP    H VRS   + +++ W+
Sbjct:  182 FRSDFLDSKKPVIIEGITDHWPAFTQHPWSIDYLRTVAGC----RTVPIEVGSKYTDEEWSQKLITVN--DFI------DRYITGTVPE-LKEDIRIPDYCCLGEGDEDDITINAWFGPGGTVSPLHQDPQQNFLAQVVGRKYIRLYSPEETKSLYPHESQLLHNTSQVEVENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFWW 389          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: kdm8 (lysine (K)-specific demethylase 8 [Source:NCBI gene;Acc:436936])

HSP 1 Score: 60.8474 bits (146), Expect = 1.830e-9
Identity = 58/231 (25.11%), Postives = 95/231 (41.13%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEK--WDDEYFLNLNLSMYYPNTVNIETKKK---ENRTLKNMEMNFKDFIKSY-----NDSDIYMV-----NNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F   F+   KP++++    ++PA  +  W  +Y   +        TV IE   K   E  + K + +N  DFI  Y      D   Y+      + +P  L EDI  P        DE+   +  WF  G T S +H D  +N    + G K   L  PE+     P + +  +  S ++V+  D  K+       +    +  GD L+IP    H VRS   + +++ W+
Sbjct:  182 FRSDFLDSKKPVIIEGITDHWPAFTQHPWSIDYLRTVAGC----RTVPIEVGSKYTDEEWSQKLITVN--DFIDRYITGTEEDGVGYLAQHQLFDQVPE-LKEDIRIPDYCCLGEGDEDDITINAWFGPGGTVSPLHQDPQQNFLAQVVGRKYIRLYSPEETKSLYPHESQLLHNTSQVEVENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFWW 405          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: kdm8 (lysine (K)-specific demethylase 8 [Source:NCBI gene;Acc:436936])

HSP 1 Score: 60.8474 bits (146), Expect = 1.830e-9
Identity = 58/231 (25.11%), Postives = 95/231 (41.13%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEK--WDDEYFLNLNLSMYYPNTVNIETKKK---ENRTLKNMEMNFKDFIKSY-----NDSDIYMV-----NNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F   F+   KP++++    ++PA  +  W  +Y   +        TV IE   K   E  + K + +N  DFI  Y      D   Y+      + +P  L EDI  P        DE+   +  WF  G T S +H D  +N    + G K   L  PE+     P + +  +  S ++V+  D  K+       +    +  GD L+IP    H VRS   + +++ W+
Sbjct:  182 FRSDFLDSKKPVIIEGITDHWPAFTQHPWSIDYLRTVAGC----RTVPIEVGSKYTDEEWSQKLITVN--DFIDRYITGTEEDGVGYLAQHQLFDQVPE-LKEDIRIPDYCCLGEGDEDDITINAWFGPGGTVSPLHQDPQQNFLAQVVGRKYIRLYSPEETKSLYPHESQLLHNTSQVEVENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFWW 405          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:557725])

HSP 1 Score: 57.3806 bits (137), Expect = 1.349e-8
Identity = 37/131 (28.24%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  430 LNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR 819
            L ED H P   + + F  ++F++    SS       H D M+N+   + G K  VL  PE   D + +   G  S++ D+D  D   Y +          +E GD L+IP LW H   +    + +N+++R
Sbjct:  129 LAEDFHVPQFFEPEQFFSSVFRI----SSPGLQLWTHYDVMDNLLAQVTGKKRVVLYSPE---DALHLYLTGDKSEVLDIDSPDLQLYPEFVKARRYECFLEPGDLLFIPALWFHNTLALQFGVGVNVFWR 252          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:496732])

HSP 1 Score: 75.8702 bits (185), Expect = 1.622e-14
Identity = 61/270 (22.59%), Postives = 104/270 (38.52%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS-----MYYPNTVNIETKKKENRTLKNMEMNFKDFI----KSYNDSDIYMVNNLPNFLNEDI---------HFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDK--IPMK----------KEGAYSDIDVDRV-------------DFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            S+ + +    P+ F   +V  N+P +++ A  ++PA+ KW   Y      S        PN       K      +   M   DF+    K  N   ++ +    + L E+          H PW    +   ++   V  W       + +H D  EN+ C+I G K F+L  P    D+  IP +          ++G++  +D +               D  +Y   +    +   + AG+ LY+P LW H VR  H  IA+N W+
Sbjct:   27 SVPYLDAPPSPLQFHRDWVSPNRPCIIRNAFTHWPALHKWTFGYLRTHIGSKKVSVAVTPNGYADAVYKNRFVMPEERTMFLSDFLDIVEKKSNTPGVFYIQKQCSNLTEEFPELVEDVENHIPW--MSETLGKSPDAVNFWLGESAAITSLHKDHYENLYCVISGEKHFILHPP---SDRPFIPYEMFQPATYHVYEDGSFKVVDHESAEKVPWIPLDPLEPDLIRYPSYKQTKPLHCTVRAGEMLYLPSLWFHHVRQSHGCIAVNFWY 291          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: TYW5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:100493826])

HSP 1 Score: 57.7658 bits (138), Expect = 1.610e-8
Identity = 48/186 (25.81%), Postives = 80/186 (43.01%), Query Frame = 1
Query:  298 PNTVNIETKKKENRTLKNMEMNFKDFIKSYND---SDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVPEMFFE 840
            P  + ++   +E  T   +  N K +++S  +    DI  ++     L  DI  P   + D F  ++F++    SS       H D M+N+   + G K  VL  P    D   +   G  S++ DVD  D  KY    +       +EAGD L+IP LW H   +    + +N+ W  +P   ++
Sbjct:   83 PFDIFVQRAAEEKHTAFFISENEKYYLRSLGEDPRKDIADISKQFPHLATDIQIPEFFEKDQFFSSVFRI----SSPGLQLWTHYDVMDNLLIQVTGKKRVVLYSPR---DAPYLYLSGDKSEVLDVDNTDLVKYPLFSHARRYECYLEAGDVLFIPALWFHNTVAVGFGVGVNVFWKHLPSQCYD 261          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: TYW5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:100493826])

HSP 1 Score: 57.7658 bits (138), Expect = 2.161e-8
Identity = 48/186 (25.81%), Postives = 80/186 (43.01%), Query Frame = 1
Query:  298 PNTVNIETKKKENRTLKNMEMNFKDFIKSYND---SDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVPEMFFE 840
            P  + ++   +E  T   +  N K +++S  +    DI  ++     L  DI  P   + D F  ++F++    SS       H D M+N+   + G K  VL  P    D   +   G  S++ DVD  D  KY    +       +EAGD L+IP LW H   +    + +N+ W  +P   ++
Sbjct:  140 PFDIFVQRAAEEKHTAFFISENEKYYLRSLGEDPRKDIADISKQFPHLATDIQIPEFFEKDQFFSSVFRI----SSPGLQLWTHYDVMDNLLIQVTGKKRVVLYSPR---DAPYLYLSGDKSEVLDVDNTDLVKYPLFSHARRYECYLEAGDVLFIPALWFHNTVAVGFGVGVNVFWKHLPSQCYD 318          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: ada.2 (adenosine deaminase, gene 2 [Source:Xenbase;Acc:XB-GENE-5929084])

HSP 1 Score: 54.6842 bits (130), Expect = 2.191e-7
Identity = 46/225 (20.44%), Postives = 91/225 (40.44%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSY----NDSDIYMVNN-----LPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F + ++   KP++++    ++P ++KW  EY   +      P  V + ++  +    + + M   +FI  Y     +   Y+  +     +P  L EDI  P         E+   +  WF    T S +H D  +N    I G K   +    +     P      +  S +DV+  D +K+ +     +    +  G  L+IP  W H +R+   + +++ W+
Sbjct:  222 FRDHYLVPQKPVVLEGVIDHWPCLKKWSVEYIQRVAGCRTVP--VELGSRYTDAEWSQRL-MTVNEFITKYILDKQNGIGYLAQHQLFEQIPE-LKEDICIPDYCCLGEASEDEITINAWFGPAGTVSPLHQDPQQNFLAQIVGRKYIRVYSVAETEKLYPFDSSILHNTSQVDVESPDQNKFPRFSQASYQECILSPGQVLFIPVKWWHYIRALDLSFSVSFWW 442          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Jmjd7 (jumonji domain containing 7 [Source:MGI Symbol;Acc:MGI:3845785])

HSP 1 Score: 75.0998 bits (183), Expect = 2.146e-14
Identity = 57/258 (22.09%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  166 PITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKK---KENRTLKNMEMNFK-----DFI--KSYNDSDIYM---VNNLPNFLNE-----DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVDRV-------------DFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            P+ F+  +V  N+P +++ A +++PA++KW   Y      S      V  +      + +R +   E         D +  ++ +   +Y+    +NLP  L +     + H PW    +   +    V  W    +  + +H D  EN+ C++ G K F+L  P      IP          + +EG +  +D + +             D ++Y        +   + AG+ LY+P LW H V+  H  IA+N W+
Sbjct:   38 PLCFYRDWVCPNRPCIIRNALQHWPALQKWSLSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPISHVLDVLEGRAQHPGVLYVQKQCSNLPTELPQLLSDIESHVPW--ASESLGKMPDAVNFWLGDASAVTSLHKDHYENLYCVVSGEKHFLL-HPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVNFWY 292          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Kdm8 (lysine (K)-specific demethylase 8 [Source:MGI Symbol;Acc:MGI:1924285])

HSP 1 Score: 71.633 bits (174), Expect = 5.670e-13
Identity = 56/228 (24.56%), Postives = 100/228 (43.86%), Query Frame = 1
Query:  166 PITFF-ESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSYNDSDIYMV-----NNLPNFLNEDIHFPWPLQCDLF--DENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            P+ +F + F+   +P++++  A ++P M+KW  +Y   +      P  V    T +  ++TL  ++   + FI S      Y+      + +P  L  DI  P    C L   +E    +  WF    T S +H D  +N    + G K   L  P++     P +    +  S +DV+  D  K+ K     F+   +  GD L+IP  + H VRS   + +++ W+
Sbjct:  189 PLQYFKQHFLVPGRPVILEGVADHWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQTLMTVDEFIQKFILSEAKDVGYLAQHQLFDQIPE-LKRDISIP--DYCCLGNGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWW 413          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Tyw5 (tRNA-yW synthesizing protein 5 [Source:MGI Symbol;Acc:MGI:1915986])

HSP 1 Score: 57.7658 bits (138), Expect = 7.112e-9
Identity = 46/174 (26.44%), Postives = 73/174 (41.95%), Query Frame = 1
Query:  310 NIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVP 825
            N   ++  N T  ++E        S+   D+  +      L  DI FP   + + F  ++F++    SS       H D M+N    + G K   L +P    D   +   G+ S++ ++D  D  KY            +EAGD L+IP LW H V S    + +NI W  +P
Sbjct:   84 NSSFQRMRNTTYGHLEKTQGSRKNSFTGKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRI----SSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPR---DAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLP 250          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Tyw5 (tRNA-yW synthesizing protein 5 [Source:MGI Symbol;Acc:MGI:1915986])

HSP 1 Score: 55.4546 bits (132), Expect = 7.553e-8
Identity = 46/184 (25.00%), Postives = 78/184 (42.39%), Query Frame = 1
Query:  430 LNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSEL 978
            L  DI FP   + + F  ++F++    SS       H D M+N    + G K   L +P    D   +   G+ S++ ++D  D  KY            +EAGD L+IP LW H V S    + +NI+++             L  +C    D   T+ N + +  +  +   +  ++ L+EL
Sbjct:  128 LGGDITFPMFFREEQFFSSVFRI----SSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPR---DAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWK------------HLPSECY---DTTDTYGNKDPVAASRAVQILDRALKTLAEL 289          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N371|KDM8_HUMAN (Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.401e-14
Identity = 59/228 (25.88%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSY---NDSDI------YMVNNLPNFLNEDIHFPWPLQCDLFD--ENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F E F+   +P+++K  A ++P M+KW  EY   +      P  V    T ++ ++TL    M   +FI  Y      D+       + + +P  L +DI  P    C L D  E    +  WF    T S +H D  +N    + G K   L  P++ G   P      +  S +DV+  D  K+ K     F+   +  G+ L+IP  + H VR+   + +++ W+
Sbjct:  195 FREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTL----MTVNEFISKYIVNEPRDVGYLAQHQLFDQIPE-LKQDISIP--DYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 415          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C870|JMJD7_HUMAN (Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 OS=Homo sapiens OX=9606 GN=JMJD7 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.332e-13
Identity = 57/269 (21.19%), Postives = 110/269 (40.89%), Query Frame = 1
Query:  133 VSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKK---KENRTLKNMEMNFK-DFI------KSYNDSDIYM---VNNLPNFLNE-----DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVDRV-------------DFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            +++ + +    P+ F+  +V  N+P +++ A +++PA++KW   YF     S      V  +      + +R +   E      F+      ++ +   +Y+    +NLP+ L +     + H PW    +   +    V  W       + +H D  EN+ C++ G K F L  P      IP          + +EG +  +D + +             D ++Y        +   + AG+ LY+P LW H V+     IA+N W+
Sbjct:   27 LAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLESHVPW--ASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHF-LFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWY 292          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C872|JMJD7_MOUSE (Bifunctional peptidase and (3S)-lysyl hydroxylase Jmjd7 OS=Mus musculus OX=10090 GN=Jmjd7 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.501e-13
Identity = 57/258 (22.09%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  166 PITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKK---KENRTLKNMEMNFK-----DFI--KSYNDSDIYM---VNNLPNFLNE-----DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVDRV-------------DFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            P+ F+  +V  N+P +++ A +++PA++KW   Y      S      V  +      + +R +   E         D +  ++ +   +Y+    +NLP  L +     + H PW    +   +    V  W    +  + +H D  EN+ C++ G K F+L  P      IP          + +EG +  +D + +             D ++Y        +   + AG+ LY+P LW H V+  H  IA+N W+
Sbjct:   38 PLCFYRDWVCPNRPCIIRNALQHWPALQKWSLSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPISHVLDVLEGRAQHPGVLYVQKQCSNLPTELPQLLSDIESHVPW--ASESLGKMPDAVNFWLGDASAVTSLHKDHYENLYCVVSGEKHFLL-HPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVNFWY 292          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CXT6|KDM8_MOUSE (Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.966e-12
Identity = 56/228 (24.56%), Postives = 100/228 (43.86%), Query Frame = 1
Query:  166 PITFF-ESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSYNDSDIYMV-----NNLPNFLNEDIHFPWPLQCDLF--DENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            P+ +F + F+   +P++++  A ++P M+KW  +Y   +      P  V    T +  ++TL  ++   + FI S      Y+      + +P  L  DI  P    C L   +E    +  WF    T S +H D  +N    + G K   L  P++     P +    +  S +DV+  D  K+ K     F+   +  GD L+IP  + H VRS   + +++ W+
Sbjct:  189 PLQYFKQHFLVPGRPVILEGVADHWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQTLMTVDEFIQKFILSEAKDVGYLAQHQLFDQIPE-LKRDISIP--DYCCLGNGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWW 413          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q497B8|KDM8_RAT (Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Rattus norvegicus OX=10116 GN=Kdm8 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.340e-11
Identity = 57/227 (25.11%), Postives = 96/227 (42.29%), Query Frame = 1
Query:  175 FFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNF--------LNEDIHFPWPLQCDLF--DENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            F + F+   +P++++  A ++P M+KW  +Y   +      P  V    T +  ++TL    M   +FI  Y  S+   V  L           L +DI  P    C L   +E    +  WF    T S +H D  +N    + G K   L  P++     P +    +  S +DV+  D  K+ K     F+   +  GD L+IP  + H VRS   + +++ W+
Sbjct:  193 FKKHFLVPGRPVILEGVADHWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQTL----MTVNEFIHKYILSEAKDVGYLAQHQLFDQIPELKQDISIP--DYCCLGNGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWW 413          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A5H2V2T7 (Jumonji C domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 GN=DjHRJDb PE=2 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 2.728e-174
Identity = 234/358 (65.36%), Postives = 302/358 (84.36%), Query Frame = 1
Query:  100 NHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAFLTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKTFHQ 1173
            NH KPFGTGPSV ID  +GFVDPI F E+F++K++P+LMKQAAK+FPA+  WDDEYFL L+LS Y  +T+NIE +KKE+R+L+ M+MNF +F+++YN SDIYMV+ +P FLN+DI +PW LQCD++ +NI+QV+MWFSSGNTSSVVHTDDMENINCLIRG KTFVLV+P+KH DKIP K+EGAYSDIDVD VDF+KYK+ME+VDFIIA+M AGDCLYIPKLWIHQVRS+HRNIAINIWFRVP       N++++  KC KYPD++K+FSNTN+LGLN  IY + DG+ +LS+ QN++V +    ILE+Y ++D +I+ KFS HI+ VIK+IIDE+D+NKNS++D+EEI+ A S+  H+
Sbjct:    1 NHGKPFGTGPSVFIDHIDGFVDPINFSENFLKKSQPILMKQAAKDFPAVRNWDDEYFLQLDLSNYQKHTINIEKRKKEDRSLQTMKMNFHEFVRTYNKSDIYMVDLIPTFLNKDIIYPWSLQCDVYRDNIYQVLMWFSSGNTSSVVHTDDMENINCLIRGEKTFVLVNPDKHKDKIPFKREGAYSDIDVDSVDFTKYKQMESVDFIIAKMVAGDCLYIPKLWIHQVRSYHRNIAINIWFRVPTDDSSEMNESQMKMKCEKYPDNQKSFSNTNFLGLNEPIYQKIDGVGLLSKFQNRTVENLLEMILELYKEVDSEIIEKFSKHIESVIKDIIDEIDKNKNSVMDKEEIETAKSENLHR 358          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A210PQY6 (tRNA wybutosine-synthesizing protein 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07601 PE=4 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 7.703e-78
Identity = 147/377 (38.99%), Postives = 220/377 (58.36%), Query Frame = 1
Query:   70 FINVNYSFHVNHNKPFGTG-PSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCD-LFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPM-KKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR---VPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLN--TGIYNRNDGIEMLSELQNKSVSSAFLTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKTFHQF 1176
             I  + +    H KPFG G P V ++ T    DP TF+++ V   KPL MK AA   PA  KW D+YFL+L++S    NTV +ET KKE+R  K ++M+F+ F++ YN+S+IYMVN++P  + +D+  P PLQC  L ++ + + +MW+SSG T+SVVHTD ++NINCL RG K F+L+DP K+GDK+ +   EG+YS +DVD VD++ Y  +  V++I   MEAGDCLYIP  WIHQVRS+  N+A+NIW+     PE+  ++         CN   D   T     + G    T +    D  E    + ++     F   L +  D+D+       D   L +++I   +D N + I+ ++E+K A  + + Q 
Sbjct:   20 IIGADLTKAPGHMKPFGYGRPMVEVEETFVTPDPETFWKNNVYALKPLKMKGAASISPAFSKWTDDYFLSLDMSN--ENTVTVETVKKESRQQKIVQMDFQRFVQEYNNSEIYMVNSVPQTICKDVVLPCPLQCQYLVEKGLVEALMWYSSGGTNSVVHTDSVDNINCLYRGKKEFILIDPSKYGDKVDLDHPEGSYSAVDVDSVDYTAYPGLAEVEYIHVSMEAGDCLYIPYRWIHQVRSYANNLAVNIWWNHHIAPEINLDL---------CNAQCDLDLTLDALEFRGFGEVTTVDGIRDHFETFLGVSSRVSFKRFQRAL-LGEDLDMLKERNAGDEHLLYLRQIFTVLDGNLDDILTKQEVKDATPENWTQI 384          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A267EUN7 (JmjC domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019308g6 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.550e-77
Identity = 137/365 (37.53%), Postives = 208/365 (56.99%), Query Frame = 1
Query:   88 SFHVNHNKPFGTG--PSVSI-DFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNT--VNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPM-KKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCN-KYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVS----SAFL-TILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIK 1146
            ++ + H +PFGT   P + + +  +GF  P  F++  V++ +PLLM+ AA+   A   WDD+YFL L L    PN+  V++ET KKE+R  +  +  F  F++SYN S  YMV ++P FL  D   PW LQC      + + I+WFSSG TSSVVHTD ++N+NC++RG KTFV+VDP  HG ++P+ + EG+YS +DVD VDF  Y  M +V F IA +  GDCLYIP  WIHQVRS+ RNIA+N+WF         +      + CN + PD        ++ G     +      ++ +E   ++      +A L  I+  + ++  +   +F D + +V K      D N +S++D  E++
Sbjct:   46 AYGIGHKRPFGTSRHPQLPVPELADGFPPPGRFYQEQVRQLRPLLMRGAARQTRAFRMWDDDYFLQLPLD---PNSSQVHVETTKKESRQQRTYDTPFHQFVRSYNTSGHYMVASMPRFLAPDFPLPWSLQCPDVAGALVEAIVWFSSGGTSSVVHTDAVDNLNCVLRGNKTFVMVDPAVHGHRVPIDRPEGSYSSMDVDSVDFRAYPGMADVQFYIAHLFPGDCLYIPFKWIHQVRSYGRNIAVNLWFD--------TALVRATDNCNEERPDPAWLIDTASFKG-----FGYRPPTDLFAETLRQAAGPLDFAALLDRIVPEHGELKTRFGDRFVDELSIVFKAF----DTNGDSLVDLAEVE 390          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A267EYK2 (JmjC domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019308g3 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 6.304e-77
Identity = 137/365 (37.53%), Postives = 208/365 (56.99%), Query Frame = 1
Query:   88 SFHVNHNKPFGTG--PSVSI-DFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNT--VNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPM-KKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCN-KYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVS----SAFL-TILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIK 1146
            ++ + H +PFGT   P + + +  +GF  P  F++  V++ +PLLM+ AA+   A   WDD+YFL L L    PN+  V++ET KKE+R  +  +  F  F++SYN S  YMV ++P FL  D   PW LQC      + + I+WFSSG TSSVVHTD ++N+NC++RG KTFV+VDP  HG ++P+ + EG+YS +DVD VDF  Y  M +V F IA +  GDCLYIP  WIHQVRS+ RNIA+N+WF         +      + CN + PD        ++ G     +      ++ +E   ++      +A L  I+  + ++  +   +F D + +V K      D N +S++D  E++
Sbjct:   52 AYGIGHKRPFGTSRHPQLPVPELADGFPPPGRFYQEQVRQLRPLLMRGAARQTRAFRMWDDDYFLQLPLD---PNSSQVHVETTKKESRQQRTYDTPFHQFVRSYNTSGHYMVASMPRFLAPDFPLPWSLQCPDVAGALVEAIVWFSSGGTSSVVHTDAVDNLNCVLRGNKTFVMVDPAVHGHRVPIDRPEGSYSSMDVDSVDFRAYPSMADVQFYIAHLFPGDCLYIPFKWIHQVRSYGRNIAVNLWFD--------TALVRATDNCNEERPDPAWLIDTASFKG-----FGYRPPTDLFAETLRQAAGPLDFAALLDRIVPEHGELRTRFGDRFVDELSVVFKAF----DTNGDSLMDLTEVE 396          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A1I8HWB2 (JmjC domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.641e-76
Identity = 134/348 (38.51%), Postives = 201/348 (57.76%), Query Frame = 1
Query:   88 SFHVNHNKPFGTG--PSVSI-DFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNT--VNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPM-KKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCN-KYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAFLTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQ 1110
            ++ + H +PFGT   P + + +  +GF  P  F++  V++ +PLLM+ AA+   A   WDD+YFL L L    PN+  V++ET KKE+R  +  +  F  F++SYN S  YMV ++P FL  D   PW LQC      + + I+WFSSG TSSVVHTD ++N+NC++RG KTFV+VDP  HG ++P+ + EG+YS +DVD VDF  Y  M +V F IA +  GDCLYIP  WIHQVRS+ RNIA+N+WF         +      + CN + PD        ++ G          G    ++L  +++  A    +E   DID +  ++F   ++ +++ +  E D+
Sbjct:   60 AYGIGHKRPFGTSRHPQLPVPELADGFPPPGRFYQEQVRQLRPLLMRGAARQTRAFRMWDDDYFLQLPLD---PNSSQVHVETTKKESRQQRTYDTPFHQFVRSYNTSGHYMVASMPRFLAPDFPLPWSLQCPDVAGALVEAIVWFSSGGTSSVVHTDAVDNLNCVLRGNKTFVMVDPAVHGHRVPIDRPEGSYSSMDVDSVDFRAYPGMADVQFYIAHLFPGDCLYIPFKWIHQVRSYGRNIAVNLWFD--------TALVRATDNCNEERPDPAWLIDTASFKGF---------GYRPPTDLFAETLRQAAGQPVERLRDID-RHFLQFDRTVREMMEILARERDE 386          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 85.5001 bits (210), Expect = 6.231e-18
Identity = 60/268 (22.39%), Postives = 106/268 (39.55%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS-----MYYPNTVNIETKKKENRTLKNMEMNFKDFI-----KSYNDSDIYMVNNLPNFLNE--------DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVD-------------RVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            S+ + +G + P+ F+  ++  NKP +++ A  ++PA+ KW+  Y  ++  S        PN              +  +M F   +     K  ++   Y+     N   E          H PW    +   +    V  W    +  + +H D  EN+ C+I G K F+L+ P      IP           K++G++  +D +               D  +Y        +   ++AG+ LY+P LW H VR  H  IA+N W+
Sbjct:   33 SVPYLDGSLSPLQFYRDWISPNKPCIIRNAFSDWPALSKWNPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFYVQKQCSNLTEELPELTGDVQTHIPW--MSEALGKLPDAVNFWLGEEHAVTSMHKDHYENLYCVISGEKRFILIPPTDR-PFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLERYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVRQSHGCIAVNFWY 297          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 85.5001 bits (210), Expect = 6.662e-18
Identity = 60/268 (22.39%), Postives = 106/268 (39.55%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS-----MYYPNTVNIETKKKENRTLKNMEMNFKDFI-----KSYNDSDIYMVNNLPNFLNE--------DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVD-------------RVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            S+ + +G + P+ F+  ++  NKP +++ A  ++PA+ KW+  Y  ++  S        PN              +  +M F   +     K  ++   Y+     N   E          H PW    +   +    V  W    +  + +H D  EN+ C+I G K F+L+ P      IP           K++G++  +D +               D  +Y        +   ++AG+ LY+P LW H VR  H  IA+N W+
Sbjct:   23 SVPYLDGSLSPLQFYRDWISPNKPCIIRNAFSDWPALSKWNPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFYVQKQCSNLTEELPELTGDVQTHIPW--MSEALGKLPDAVNFWLGEEHAVTSMHKDHYENLYCVISGEKRFILIPPTDR-PFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLERYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVRQSHGCIAVNFWY 287          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 85.5001 bits (210), Expect = 6.662e-18
Identity = 60/268 (22.39%), Postives = 106/268 (39.55%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS-----MYYPNTVNIETKKKENRTLKNMEMNFKDFI-----KSYNDSDIYMVNNLPNFLNE--------DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDIDVD-------------RVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            S+ + +G + P+ F+  ++  NKP +++ A  ++PA+ KW+  Y  ++  S        PN              +  +M F   +     K  ++   Y+     N   E          H PW    +   +    V  W    +  + +H D  EN+ C+I G K F+L+ P      IP           K++G++  +D +               D  +Y        +   ++AG+ LY+P LW H VR  H  IA+N W+
Sbjct:   23 SVPYLDGSLSPLQFYRDWISPNKPCIIRNAFSDWPALSKWNPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFYVQKQCSNLTEELPELTGDVQTHIPW--MSEALGKLPDAVNFWLGEEHAVTSMHKDHYENLYCVISGEKRFILIPPTDR-PFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLERYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVRQSHGCIAVNFWY 287          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:103030415])

HSP 1 Score: 61.6178 bits (148), Expect = 4.573e-10
Identity = 38/131 (29.01%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  430 LNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR 819
            L ED H P   Q D F  ++F++    SS       H D M+N+   + G K  VL  P+   D + +   G  S++ D+D  +  +Y            +E GD LYIP LW H   +    + +N+++R
Sbjct:  114 LAEDFHIPPFFQSDQFFSSVFRI----SSSGLQLWTHYDVMDNLLAQVSGRKRVVLYSPQ---DALHLYLSGDKSEVLDIDSPNLERYPDFVKACRYECVLEPGDLLYIPSLWFHNTLALQFGVGVNVFWR 237          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:103030415])

HSP 1 Score: 61.6178 bits (148), Expect = 4.620e-10
Identity = 38/131 (29.01%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  430 LNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR 819
            L ED H P   Q D F  ++F++    SS       H D M+N+   + G K  VL  P+   D + +   G  S++ D+D  +  +Y            +E GD LYIP LW H   +    + +N+++R
Sbjct:  105 LAEDFHIPPFFQSDQFFSSVFRI----SSSGLQLWTHYDVMDNLLAQVSGRKRVVLYSPQ---DALHLYLSGDKSEVLDIDSPNLERYPDFVKACRYECVLEPGDLLYIPSLWFHNTLALQFGVGVNVFWR 228          
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Match: jmjd7 (jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-050417-86])

HSP 1 Score: 79.7221 bits (195), Expect = 1.135e-16
Identity = 61/272 (22.43%), Postives = 108/272 (39.71%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNL----NLSMYY-PNTVNIETKKKENRTLKNMEMNFKDFI-----KSYNDSDIYMV----NNLPNFLNE---DIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDP----------------------------EKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            S+ + +G   P+ F   +V  N+P++ +   +++ A+ KW   Y  N+    ++S+   PN              +   M F  F+     K+ N   ++ +    +NL +   E   D+    P   + F +    V  W       + +H D  EN+ C+I G K F L  P                            EK+ +K+P      +  ++  + D S+Y +      I   + AG+ LY+P LW H V+  H  IA+N W+
Sbjct:   27 SVQYVDGPPSPLEFLREWVTPNRPVIYRHTIEHWAALTKWSPTYLRNVMGGKDVSVAVTPNGYADAVFGDRFVMPEERMMKFGAFLDILEKKTQNKGGVFYIQKQCSNLTSEFQELLADVAPDIPWASEAFGKKPDAVNFWIGEKEAITSLHKDHYENLYCVISGEKEFTLFPPTDRPFIPYEFYQPATYRQREDGEFEVVDEKYAEKVP------WIPVNPLQPDLSRYPEFSGACAIHVTLRAGETLYLPSLWFHHVQQSHGCIAVNFWY 292          
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:557725])

HSP 1 Score: 58.9214 bits (141), Expect = 8.863e-10
Identity = 59/247 (23.89%), Postives = 97/247 (39.27%), Query Frame = 1
Query:  181 ESFVQKNKPLLMKQAAKNF---PAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNME---MNFKDFIKS----------YNDSDIYMVNNLPNFLNEDI-----HFPWPLQCDLF------DENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPE-------KHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR 819
            E FV + +PL      +     P + +WD EY      +   P  V+     + +   KN     + F +FI+           + +++ Y +  L N   +D+      FP  L  D+       +E  F  +   SS       H D M+N+   + G K  VL  P          GDK  +        +D+D  D   + +     +    +EAGD L+IP LW H V S    +A+N+++R
Sbjct:   18 EVFVNEIRPLRRPAVLRGVDLGPCLSRWDAEYLRAAGGTR--PVRVHASPSPRMDFIHKNFAYKTLPFDEFIQRTAEEKHSKFFFCENEKYYLRALGNDPRKDVADIRKQFP-ELAKDVILPEFYEEEQFFSSVFRISSPGIQLWTHYDVMDNMLIQVVGRKRVVLFSPSDVPFLYLNAGDKSEV--------LDIDSPDLKTFPEFSKATWHECVLEAGDVLFIPALWFHNVTSLEFGVAVNVFWR 253          
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Match: kdm8 (lysine (K)-specific demethylase 8 [Source:NCBI gene;Acc:436936])

HSP 1 Score: 56.9954 bits (136), Expect = 4.963e-9
Identity = 53/239 (22.18%), Postives = 101/239 (42.26%), Query Frame = 1
Query:  172 TFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSY------NDSDIYMVNN-----LPNFLNEDIHFPWPLQCDL--------FDENIFQVIM--WFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKI---PMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            TF    +   +P+L++    ++PA+ KW   Y + +      P  V + ++  +    + + M  ++F++ Y        +  Y+  +     +P+  N+ +    P  C +         +E   +V++  WF  G T S +H D   NI   + G K   L  PE H DK+   P       S +DV R +  ++ +     F    +  GD L+IP+   H V S   + +++ W+
Sbjct:  172 TFRRLHLLPAQPVLLQDTVSHWPALTKWSLGYLVRMAGCRTVP--VELGSRYTDAHWTQTL-MTLQEFVEKYIINAESQATVGYLAQHELFDQIPDLRNDIVI---PDYCCVSEREGGEDEEEGSEEVVINAWFGPGGTESPLHHDPQHNILVQVFGQKYVRLYSPE-HTDKLYPHPSHLLNNTSQVDVLRPNTCQFPRFTEAPFQEVVLSPGDALFIPRKHWHYVNSLSHSFSVSFWW 403          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO37253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD8])

HSP 1 Score: 184.882 bits (468), Expect = 3.103e-53
Identity = 124/373 (33.24%), Postives = 183/373 (49.06%), Query Frame = 1
Query:  100 NHNKPFGTGPSVS--IDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFH-RNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLS-ELQ-NKSVSSAFLTIL---EIYNDIDLKILMKFSDHI--KLVIKEII----DEVDQNKNSIIDEEEIKLANSKTFHQF 1176
             H +P G+       +D  +    P  FF ++V   KPLL K AAK  PA + W DEY      S +    + +E  KKENR+        K+FI  Y   DIYMV +L   + ED      L C  F   +   +MWFSSG T SV+H D +ENINCL  G K FV++D +        +K+G++S++DV+RVD  KY  +  V ++ A ME GDC+YIP  W+HQV+SF  RN+A+NIW+                            F+  N    +T IY   D + + + EL+ N+ V   FL       +  +I LK L + ++ +   L   EI+     EVD +K+ ++  EE+   +S+   + 
Sbjct:   25 GHLQPLGSHRPAEGEVDAVSKPPSPHEFFNNYVIPGKPLLFKGAAKALPAYKLWTDEYLS----SKFGDLRMEVEEGKKENRSWGTFNFKLKEFINKYKKEDIYMVESLQKPMREDYMLLHSLACGGFTNVLQDAVMWFSSGGTKSVLHYDSLENINCLFSGNKNFVMIDKKYMNMTHIDRKDGSFSNVDVERVDMQKYPGLGKVPWMNASMEEGDCMYIPWRWVHQVQSFGPRNLAVNIWW--------------------------ARFTQFNQTDCDTSIYKDKDLVPLSAFELKPNEVVRQEFLEKTGRKPLTKEIWLKALREQAEEVYATLADTEILLQNFAEVDADKDGLVTPEEMMSLHSRDLERL 367          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO37504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFI3])

HSP 1 Score: 147.517 bits (371), Expect = 1.196e-38
Identity = 82/252 (32.54%), Postives = 136/252 (53.97%), Query Frame = 1
Query:  139 IDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKD----FIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKE----GAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSF-HRNIAINIWFRVPEMFFEISNKTELLE 867
            ++       P  F++++    KP++++ A KNFPA + W D Y +      Y    V +E +K++ +     +   +D    F++SY   D YMV+ LP+ L  ++     L C  F E I +  +W SSG T S++H D    INCL+ GTK ++L+ P+   + IP+ K     G ++ +DVD+V+  KY K + V +  A + AGDCLY+P  + HQVRS+  +N+A+++ F     F E   ++  LE
Sbjct:   42 VEVLQSLPSPKEFWDNYASIRKPVVLRGAGKNFPAFDLWTDPYLVE----NYGDLEVKLEARKEKEKVPVGEKGLGRDTIRSFLESYAKKDTYMVSQLPDPLAREVRVLPCLMCGTFSERILEANLWLSSGGTKSMLHKDADNAINCLLNGTKDWILIHPDNEKN-IPVAKGDKGYGGFATLDVDKVNLIKYPKFKEVHWQYANLTAGDCLYLPYSYWHQVRSYGAKNMAVSVLFSRLTQFNETGCESAKLE 288          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO30343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T124])

HSP 1 Score: 136.346 bits (342), Expect = 6.527e-37
Identity = 76/248 (30.65%), Postives = 125/248 (50.40%), Query Frame = 1
Query:   22 ICKMPQSSTIIFIILYFINVNYSFHVNHNKPFGTGP--SVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPM-KKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIP 756
            +C  P++   + + +   +   +  + H  P G+       ++  +    P  F+ ++V  +KP++ + AAK+      W D Y        Y    V ++  KKENR     +M  ++F+  YN S+ Y+V+ LP  + E+   P  L C  F   +   ++WFSSG T S +H D +ENINCL  G K +  VD + H   I M  KEG Y   +VD+VD  +Y  ++++ +  A M AGDC+Y+P
Sbjct:    1 MCVTPKAWLTLCLCMLVYSSAVADPLGHMMPLGSHQPKEGDVESRDDMPSPSEFYHNYVLASKPVIFRGAAKSSKGFNLWTDAYLRK----KYGHEIVRVDYGKKENRARSADDMPLEEFLDIYNSSERYLVDTLPERMWEEFSLPECLLCGGFSHALQDSVLWFSSGGTKSHLHNDKVENINCLFSGEKVWFFVD-QIHSQDINMDHKEGDYCSANVDKVDMYQYPFLQHIPWWQAHMRAGDCMYVP 243          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO34025 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH3])

HSP 1 Score: 135.961 bits (341), Expect = 9.414e-37
Identity = 77/248 (31.05%), Postives = 124/248 (50.00%), Query Frame = 1
Query:   22 ICKMPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDF--TNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPM-KKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIP 756
            +C  P++   + + +   +   +  + H  P G+      D    +    P  F+ ++V  +KP++ + AAK+      W D Y        Y    V ++  KKENR     +M  ++F+  YN S+ Y+V+ LP  + E+   P  L C  F   +   ++WFSSG T S +H D +ENINCL  G K +  VD + H   I M  KEG Y   +VD+VD  +Y  ++++ +  A M AGDC+Y+P
Sbjct:    1 MCVTPKAWLTLCLCMLVYSSAVADPLGHMMPLGSHQPKEGDVESRDDMPSPSEFYHNYVLASKPVIFRGAAKSSKGFNLWTDAYLRK----KYGHEIVRVDYGKKENRARSADDMPLEEFLDIYNSSERYLVDTLPERMWEEFSLPECLLCGGFTHALQDSVLWFSSGGTKSHLHNDKVENINCLFSGEKVWFFVD-QIHSQDINMDHKEGDYCSANVDKVDMYQYPFLQHIPWWQAHMHAGDCMYVP 243          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO34398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF6])

HSP 1 Score: 132.109 bits (331), Expect = 1.281e-34
Identity = 88/256 (34.38%), Postives = 140/256 (54.69%), Query Frame = 1
Query:   97 VNHNKPFGT--GPSVS-IDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNF-KDFIKSYND------SDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKI-----PMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFH-RNIAINIWF 816
            V H KP G+   PS   ID   GF  P  F+E +V+ ++ L+++ AAK+  A  KW DEY L  N   Y    V +E KK+++  + +  M   +D I ++ D      +  Y+V+++P+ + +D     PL C  F + + +V +W S G T+S++H D    INCL+ GTK + +++  K+ DKI     P +  G +S I+V  VD  KY K+  V + +  + AGDCL++PK + HQV S    N A+ + F
Sbjct:   25 VGHLKPLGSHRPPSTDLIDEIEGFPSPQDFWEKWVKPSRALVLRGAAKHSEAFTKWTDEY-LKEN---YGDLEVRLEGKKEKSGRIPSGAMGVGRDTIGNFVDNAHKPGAKSYIVSDMPSPMYKDFAVIPPLTCGTFKDYLVEVDLWLSGGGTASIMHKDAFNAINCLMNGTKVWKMIE-YKYEDKIYKAWEPPEMIGGFSKINVQNVDLLKYPKVAEVPWSLVTINAGDCLFLPKSYYHQVTSSGDTNAAVALLF 275          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:101158565])

HSP 1 Score: 76.6406 bits (187), Expect = 5.911e-15
Identity = 64/288 (22.22%), Postives = 119/288 (41.32%), Query Frame = 1
Query:  136 SIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS-----MYYPNTVNIETKKKENRTLKNMEMNFKDFI-----KSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDL------FDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP----------MKKEGAYSDID-----------VDRVD--FSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEIS-NKTELLEKCNK 879
            S+ + +G  +P+ F+  ++ +NKP +++ A +++ A+ +W  EY      S        PN              +  +M+    +     K       Y+     N L E       ++ D+         +   V  W   GN  + +H D  EN+ C++ G K FVL+ P      IP          ++ +G +  +D           +D +D    ++ +      +   ++AG+ LY+P LW H VR  H  IA+N W+   +M ++I  N  +LLE  ++
Sbjct:   23 SVPYLDGPPEPLQFYRDWIGQNKPCIIRDAFRHWAALSRWTPEYLRQKIGSKVISVAVTPNGFADAVVGDRFVMPEERQMSVASVLDIIEGKVQEPGVFYVQKQCSNLLQELPELLGDVEPDVSWMSAALGRSPDAVNFWLGDGNAVTSMHKDPYENLYCVVSGEKRFVLLPPTDR-PFIPYDMYQPAIYHLRDDGEFEIVDQGDSKKVPWIPLDPLDPDLERFPQYRWARPVCCSVKAGEMLYLPSLWFHHVRQSHGCIAVNFWY---DMDYDIKYNYFQLLEALSE 306          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:101166925])

HSP 1 Score: 63.929 bits (154), Expect = 1.026e-10
Identity = 55/248 (22.18%), Postives = 100/248 (40.32%), Query Frame = 1
Query:  160 VDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNM---EMNFKDFIKSYND---SDIYMVNNLPNFLN---------------------EDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR 819
            VD  TF +    + +P +++      P  + W  EY             +++ T  + +   KN     + F +F+K  ++   SD ++      +L                      ED   P   + D F  ++F++    SS       H D M+N+   + GTK  VL  P+   D + +   G  S++ D+DR D  ++           E++ GD L+IP LW H  R+    + +N+++R
Sbjct:   15 VDRETFLQEIYPERRPAILRGVPLG-PCQQLWTTEYLARRGGDKEV--KIHVSTVPQMDFLRKNFVYRTLPFNEFVKRASEKKHSDFFLCEEESYYLRSLGEDVRKEPADLRKQFPDLAEDFLIPPFFEPDQFFSSVFRI----SSCGLQLWTHYDVMDNLLAQVSGTKRVVLFSPQ---DALHLYLSGDKSEVLDIDRPDLQRFPDFVRASRHECELQPGDLLFIPALWFHNTRALQFGVGVNVFWR 252          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:101166925])

HSP 1 Score: 63.929 bits (154), Expect = 1.026e-10
Identity = 55/248 (22.18%), Postives = 100/248 (40.32%), Query Frame = 1
Query:  160 VDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNM---EMNFKDFIKSYND---SDIYMVNNLPNFLN---------------------EDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDI-DVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFR 819
            VD  TF +    + +P +++      P  + W  EY             +++ T  + +   KN     + F +F+K  ++   SD ++      +L                      ED   P   + D F  ++F++    SS       H D M+N+   + GTK  VL  P+   D + +   G  S++ D+DR D  ++           E++ GD L+IP LW H  R+    + +N+++R
Sbjct:   15 VDRETFLQEIYPERRPAILRGVPLG-PCQQLWTTEYLARRGGDKEV--KIHVSTVPQMDFLRKNFVYRTLPFNEFVKRASEKKHSDFFLCEEESYYLRSLGEDVRKEPADLRKQFPDLAEDFLIPPFFEPDQFFSSVFRI----SSCGLQLWTHYDVMDNLLAQVSGTKRVVLFSPQ---DALHLYLSGDKSEVLDIDRPDLQRFPDFVRASRHECELQPGDLLFIPALWFHNTRALQFGVGVNVFWR 252          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: kdm8 (lysine demethylase 8 [Source:NCBI gene;Acc:101171915])

HSP 1 Score: 54.6842 bits (130), Expect = 1.290e-7
Identity = 52/234 (22.22%), Postives = 97/234 (41.45%), Query Frame = 1
Query:  172 TFFESFVQKNKPLLMKQAAKNFPAM--EKWDDEYFLNLNLSMYYPNTVNIE-TKKKENRTLKNMEMNFKDFIKSY---------NDSDIYMV-----NNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAY--SDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWF 816
            +F  +++   KP++++    ++PA+    W  EY  ++      P  V    T +  ++TL    +   +FI  Y           S  Y+      + +P  L EDI  P        DE+   +  WF    T S +H D  +N    + G+K   L  PE      P + +  +  S ++V+  +   + +     ++   +E GD L+IP    H VRS   + +++ W+
Sbjct:  180 SFSTNYLLPLKPVILEGIIDHWPALNNHPWSIEYLRSVAGFRTVPVEVGSRYTDENWSQTL----LTVNEFIDRYILNEISQDGGKSRGYLAQHQLFDQIPE-LKEDIRIPDYCCLGEGDEDDITINAWFGPAGTVSPLHQDPQQNFLAQVVGSKYIRLFSPEDTDKLYPHQSQLLHNTSQVEVENPNAELFPEFSKAPYLECVLEPGDVLFIPVKHWHYVRSLQVSFSVSFWW 408          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: hif1an (hypoxia inducible factor 1 subunit alpha inhibitor [Source:NCBI gene;Acc:101156274])

HSP 1 Score: 50.8322 bits (120), Expect = 2.139e-6
Identity = 60/257 (23.35%), Postives = 97/257 (37.74%), Query Frame = 1
Query:  181 ESFVQKNKPLLMKQAAKNFPAMEKWDDEYFL----NLNLSMYY--------------PNTVNIETKKKENRTLKNMEMNFKDFI-------KSYNDSDIYMVNNLPNFLNEDI-----HFPW--------PLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGA---YSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRN---IAINIWFR 819
            E  +   +P+++      +PA+ KWD  Y L    N + S+Y               PN  N   K +       MEM F +F+       ++  +S +Y+   L + + + I      F W                 N+  V M    GN +   H D+ +N    I+G K  +L  P++     P          S +D D  D+ K+   +N     A +  GD LYIP  W H + S       I +N W++
Sbjct:   54 EMLINNEEPVVLTDTNLVYPAL-KWDIPYLLENIGNGDFSVYMSENHKFLYYDEKKMPNFENFVPKSQR------MEMKFSEFVDKMHQTEETGGESRVYLQQTLNDTVGKKIVVDFLGFNWNWINKQQAKRNWGQLTSNLLLVGM---EGNVTPA-HYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYEKFPNFQNTVGYEAVVGPGDVLYIPMYWWHHIESLLNGGVTITVNFWYK 299          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000008562.1 (SMESG000008562.1)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 386/388 (99.48%), Postives = 387/388 (99.74%), Query Frame = 1
Query:   31 MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAFLTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKTFHQFYEQQYY 1194
            MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS YYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAF+TILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKTFHQFYEQQYY
Sbjct:    1 MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSKYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAFVTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKTFHQFYEQQYY 388          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000008562.1 (SMESG000008562.1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 375/381 (98.43%), Postives = 377/381 (98.95%), Query Frame = 1
Query:   31 MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAFLTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKTFHQ 1173
            MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLS YYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAF+TILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSK   +
Sbjct:    1 MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSKYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEMLSELQNKSVSSAFVTILEIYNDIDLKILMKFSDHIKLVIKEIIDEVDQNKNSIIDEEEIKLANSKNLSR 381          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000028946.1 (SMESG000028946.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.140e-29
Identity = 81/288 (28.12%), Postives = 146/288 (50.69%), Query Frame = 1
Query:  124 GPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAA-KNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPE-----KHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEML 969
            GP   ++ T   + P  FF  +V KN PL++K A     P    W+DE      L   +  +     K+ E  +    ++  + F+  Y   DIY+ + +P  L  +I +P  + C   + ++ +  +W + G T S++H      ++C+  G K F+L++ +     K  +K P   EG YS++D + ++  + K++ ++ +I A +EAG+C++IP  +IHQVRS+ R+++ NI       F  + NK+  + KC+   + +K + N   L  +  IY   DGIE L
Sbjct:   71 GP---VEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDE-----RLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEG-YSELDTEMINMFEEKQIASIPWIYATIEAGECIFIPAGYIHQVRSYGRSLSYNI------QFASLHNKS--ITKCDN--NSEKDYDN---LSQHDFIYTERDGIEQL 336          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000010398.1 (SMESG000010398.1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.255e-10
Identity = 59/219 (26.94%), Postives = 103/219 (47.03%), Query Frame = 1
Query:  241 AMEKW-DDEYFLNLN----LSMYYPNTVNIETKKKENRTLKNMEMNFKDFIKSY----NDSDIYMVNNLPNFLNEDIHFP--WP-LQCDL-----FDEN-IFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVPEMFFE 840
             +EKW +++Y    N    +S++  NT  ++ K K N   KNM M+  DFI++      D+  Y+     +   E  HFP  +P L  DL     F  N  F  +   SS N     H D M+NI   +RG K+ +   P     +    ++G    +  +  D ++Y  +     ++  +  GD ++IP LW H V++   ++A+N+ W+ + E F++
Sbjct:   41 CVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNK-NFEYKNMRMD--DFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSP--FDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYD 254          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000021161.1 (SMESG000021161.1)

HSP 1 Score: 58.151 bits (139), Expect = 3.908e-10
Identity = 31/49 (63.27%), Postives = 34/49 (69.39%), Query Frame = -1
Query: 1163 SGKSYIIGES*VLSAIKDAVGVMFEEKSFKEIESIPLFNNIVARRIGEM 1309
            SGKS+ IGES  L  IKD + VMF EKS K+IESIPL  N V  RI EM
Sbjct:   83 SGKSHSIGESLALPVIKDTLEVMFGEKSLKKIESIPLSKNTVTCRIDEM 131          
The following BLAST results are available for this feature:
BLAST of JmjC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KDM81.958e-1425.88lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
KDM82.346e-1425.88lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
JMJD72.773e-1421.19jumonji domain containing 7 [Source:HGNC Symbol;Ac... [more]
JMJD71.580e-923.60jumonji domain containing 7 [Source:HGNC Symbol;Ac... [more]
TYW53.326e-830.88tRNA-yW synthesizing protein 5 [Source:HGNC Symbol... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jmjd-54.212e-2030.14JuMonJi (Transcription factor) Domain protein [So... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
JMJD54.427e-1225.55gene:FBgn0035166 transcript:FBtr0300712[more]
JMJD54.484e-1225.55gene:FBgn0035166 transcript:FBtr0331402[more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jmjd76.494e-1622.01jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-G... [more]
kdm87.509e-1125.79lysine (K)-specific demethylase 8 [Source:NCBI gen... [more]
kdm81.830e-925.11lysine (K)-specific demethylase 8 [Source:NCBI gen... [more]
kdm81.830e-925.11lysine (K)-specific demethylase 8 [Source:NCBI gen... [more]
tyw51.349e-828.24tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
jmjd71.622e-1422.59jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
TYW51.610e-825.81tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
TYW52.161e-825.81tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
ada.22.191e-720.44adenosine deaminase, gene 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Jmjd72.146e-1422.09jumonji domain containing 7 [Source:MGI Symbol;Acc... [more]
Kdm85.670e-1324.56lysine (K)-specific demethylase 8 [Source:MGI Symb... [more]
Tyw57.112e-926.44tRNA-yW synthesizing protein 5 [Source:MGI Symbol;... [more]
Tyw57.553e-825.00tRNA-yW synthesizing protein 5 [Source:MGI Symbol;... [more]
back to top
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N371|KDM8_HUMAN9.401e-1425.88Bifunctional peptidase and arginyl-hydroxylase JMJ... [more]
sp|P0C870|JMJD7_HUMAN1.332e-1321.19Bifunctional peptidase and (3S)-lysyl hydroxylase ... [more]
sp|P0C872|JMJD7_MOUSE1.501e-1322.09Bifunctional peptidase and (3S)-lysyl hydroxylase ... [more]
sp|Q9CXT6|KDM8_MOUSE3.966e-1224.56Bifunctional peptidase and arginyl-hydroxylase JMJ... [more]
sp|Q497B8|KDM8_RAT2.340e-1125.11Bifunctional peptidase and arginyl-hydroxylase JMJ... [more]
back to top
BLAST of JmjC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5H2V2T72.728e-17465.36Jumonji C domain-containing protein (Fragment) OS=... [more]
A0A210PQY67.703e-7838.99tRNA wybutosine-synthesizing protein 5 OS=Mizuhope... [more]
A0A267EUN72.550e-7737.53JmjC domain-containing protein (Fragment) OS=Macro... [more]
A0A267EYK26.304e-7737.53JmjC domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8HWB21.641e-7638.51JmjC domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jmjd76.231e-1822.39jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
jmjd76.662e-1822.39jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
jmjd76.662e-1822.39jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
tyw54.573e-1029.01tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
tyw54.620e-1029.01tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
jmjd71.135e-1622.43jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-G... [more]
tyw58.863e-1023.89tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
kdm84.963e-922.18lysine (K)-specific demethylase 8 [Source:NCBI gen... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372533.103e-5333.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375041.196e-3832.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303436.527e-3730.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340259.414e-3731.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343981.281e-3434.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jmjd75.911e-1522.22jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
tyw51.026e-1022.18tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
tyw51.026e-1022.18tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
kdm81.290e-722.22lysine demethylase 8 [Source:NCBI gene;Acc:1011719... [more]
hif1an2.139e-623.35hypoxia inducible factor 1 subunit alpha inhibitor... [more]
back to top
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008562.10.000e+099.48SMESG000008562.1[more]
SMESG000008562.10.000e+098.43SMESG000008562.1[more]
SMESG000028946.11.140e-2928.13SMESG000028946.1[more]
SMESG000010398.12.255e-1026.94SMESG000010398.1[more]
SMESG000021161.13.908e-1063.27SMESG000021161.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027717 ID=SMED30027717|Name=JmjC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1555bp
CTTACATAATCTCAAACTTAAATTTGTAAAATGCCTCAAAGTTCAACAAT
TATATTTATTATATTGTATTTCATCAATGTCAATTATTCTTTTCATGTGA
ATCATAATAAACCGTTTGGAACTGGTCCTTCTGTATCTATTGATTTTACC
AATGGCTTTGTAGACCCAATAACATTTTTCGAAAGTTTCGTTCAAAAGAA
TAAACCGTTATTGATGAAACAAGCTGCAAAAAATTTTCCCGCCATGGAAA
AGTGGGATGATGAATATTTTCTAAATTTAAATTTATCAATGTACTATCCA
AACACAGTCAATATTGAGACAAAGAAAAAGGAAAATCGAACTTTAAAAAA
TATGGAAATGAATTTCAAAGATTTCATCAAGTCATATAATGATTCTGATA
TTTATATGGTAAATAATTTACCAAATTTTCTCAATGAAGATATTCATTTT
CCTTGGCCTTTGCAATGCGATTTATTTGATGAAAATATTTTTCAAGTAAT
AATGTGGTTCAGCTCCGGTAACACGAGTTCAGTAGTACATACTGATGATA
TGGAAAATATTAATTGTTTAATAAGGGGTACAAAAACATTTGTTCTCGTT
GATCCTGAAAAACATGGCGATAAAATCCCAATGAAAAAGGAAGGAGCGTA
TTCTGACATAGATGTTGACAGAGTTGATTTTTCAAAATATAAGAAAATGG
AAAATGTGGATTTTATAATAGCTGAAATGGAAGCCGGGGATTGCTTGTAC
ATCCCTAAACTGTGGATTCACCAAGTCAGATCATTCCATCGGAACATTGC
CATAAATATATGGTTCCGAGTTCCAGAAATGTTTTTCGAAATTTCTAATA
AAACAGAGTTGTTGGAGAAATGCAACAAATATCCAGATGATAAAAAAACT
TTTTCCAACACAAATTATTTGGGATTAAATACAGGCATTTATAACAGAAA
TGATGGCATTGAAATGCTTTCTGAATTGCAAAATAAAAGTGTATCTAGCG
CATTTTTAACTATTTTAGAAATTTATAATGATATAGATCTCAAGATTCTC
ATGAAGTTTTCAGATCATATAAAATTAGTTATCAAAGAAATCATTGATGA
AGTTGATCAAAATAAAAATTCCATTATTGACGAAGAAGAAATCAAGTTGG
CAAATTCGAAAACATTTCACCAATTCTACGAGCAACAATATTATTGAAAA
GTGGAATTGATTCAATTTCTTTAAAGCTCTTCTCTTCAAACATAACTCCA
ACAGCATCTTTTATCGCTGAAAGTACTTATGACTCTCCAATGATATACGA
TTTACCAGATTATGTAATACGCAAACTAATGAGGTATGTGACGAACATGT
ATATTATGTATATTATACATAATATATTTTTGAGTAAATTTTTCTTTTAC
CGTATAATTTTCCGCTTTTAAAGTCATGTTTCCCAAAACTGGAAAATTAG
ACAAAACTTATTGTTTATACTAGTAGTGTCCAACCCGTTTGACCATTTAC
GCCATATAAAGTTTTGCTGAAAAAAATTGGGCCACATTAATGAATTCAGA
ACCGA
back to top

protein sequence of SMED30027717-orf-1

>SMED30027717-orf-1 ID=SMED30027717-orf-1|Name=SMED30027717-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
MPQSSTIIFIILYFINVNYSFHVNHNKPFGTGPSVSIDFTNGFVDPITFF
ESFVQKNKPLLMKQAAKNFPAMEKWDDEYFLNLNLSMYYPNTVNIETKKK
ENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFD
ENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIP
MKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVR
SFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLN
TGIYNRNDGIEMLSELQNKSVSSAFLTILEIYNDIDLKILMKFSDHIKLV
IKEIIDEVDQNKNSIIDEEEIKLANSKTFHQFYEQQYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR041667Cupin_8
IPR003347JmjC_dom
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003347JmjC domainSMARTSM00558cupin_9coord: 116..279
e-value: 7.7E-5
score: 25.0
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 119..279
score: 21.423
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 43..263
e-value: 2.2E-47
score: 163.7
NoneNo IPR availablePANTHERPTHR12461HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR-RELATEDcoord: 22..315
NoneNo IPR availablePANTHERPTHR12461:SF42coord: 22..315
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.557
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 45..267
IPR041667Cupin-like domain 8PFAMPF13621Cupin_8coord: 48..264
e-value: 1.3E-39
score: 136.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 346..381
score: 8.516