G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30027715
Length (bp)1093
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30027715) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30027715) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027715

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027715SMESG000062905.1 SmedASXL_000038SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30027715SMESG000062905.1 dd_Smed_v6_28970_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: trhr-1 (Thyrotropin-Releasing Hormone Receptor [Source:UniProtKB/TrEMBL;Acc:Q95YD7])

HSP 1 Score: 53.5286 bits (127), Expect = 9.841e-8
Identity = 75/332 (22.59%), Postives = 145/332 (43.67%), Query Frame = 1
Query:  109 GVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQ-----IRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWI--STYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKK 1083
            GV  N+L + V+++ R    P+   L++L+ +D L  F  M    +  +   +   +    C +L+YL     + SS  +    +ER++ I   Y      T++     I G++I  FS L+ +  +   T++K++   S  F     N +    V ++D +L    P+   +     I + L +  ++++++ +P K+     +++ +  S +M   S +     S++  K+  +  R          QV  ML  V  VF  C  P+  + +  ++V   + P   W   W    +  LV+ N  IN  +Y +  + FR    SLLS +K
Sbjct:   46 GVLGNLLVITVVLKVRGMKTPTNCYLVSLAASDTLFFFASMPHEMMYLLGPNDHYLFGSLGCVLLTYLPYLAMNTSSLSILAFTIERYYGICNPYKARTMCTVKRATCIICGIWI--FSMLYHSYWLFLATLIKDDIGTSCSFRLER-NSHAYKIVFLLDFVLWYVLPIMCDIIIYAKIGITLSQCGDKIKKSVKP-KIPNEVIVEKSKTSSTSMGHYSGRD----SHISGKRNSAKGRN---------QVVKMLAIVVAVFAVCWLPYRGMVVYNSFV---SDPKYSWSPDWYINLSKTLVFINCAINPILYNLMSARFRAAFRSLLSKRK 357          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2H1CRL0 (7 transmembrane receptor OS=Fasciola hepatica OX=6192 GN=D915_03041 PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.036e-57
Identity = 134/353 (37.96%), Postives = 197/353 (55.81%), Query Frame = 1
Query:   76 WLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSK----TIQIRGLYIVYFSSLFVNL----HVIFNTILKENETNST-----DFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTR-PNKV---SMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKK 1083
            W+  + IFI  G++EN LSV VL R RF+ +PSR TL+ L+I D +VL  G+ RYWL   F+  P+ +S   CK++S  V+  SH+SS LVAL+ VERFFA+      LP K    +I   G  I++   L V+     +++  + L + ET         + CTS +   A   DI D +LL   P  +I+  N   IV LR+ SNQ+ + T+  +KV          ++R +S+ + +  S  T    N +   Y+           R+ ++T  LL V+FVFL CNFPF +VH+LRT  N E   T  W++AW+ TY LVY NNC+NFPIY++S + FR  + +LL C++
Sbjct:   43 WMYVAPIFIIIGLAENCLSVAVLSRERFTHVPSRVTLVVLAIVDCVVLLIGLGRYWLSVTFQVYPVEWSNAWCKIISTFVLFSSHLSSCLVALLSVERFFAVK-----LPHKQFRPSIDKLGTVILFLFCLAVDTVHLKYIVLQSGLNKTETLENVEILHVYVCTSESEWVAFWQDIADILLLFGMPFLLIIICNTYTIVSLRRRSNQLDRMTKCRDKVRSLGEHGVKARRRWISLLVTEKLS--TREKYNTIKPNYKD----------RNARITFTLLCVTFVFLLCNFPFALVHILRT-ANSERR-TEGWNIAWLFTYFLVYLNNCLNFPIYVVSHAQFRGELKTLLRCQR 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5J4NX88 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002405 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.773e-50
Identity = 122/354 (34.46%), Postives = 185/354 (52.26%), Query Frame = 1
Query:   76 WLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIV--YYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNV------VSKKYQSYHRK------RWKPWKRD--------TQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLL 1071
            W     I IP G++EN L++ VL R RF  +PSR TLI+++I D +VL  G+ R+WL   F     + S   CK LS  VI LSH+SS LVAL+ VERFFA+         P   + I  L ++   + F+  H      +     +     CT+++  TA  +DI+DS++L   P  +IL  NG II ++++ S ++    R       SP  + +       + +S  T  C+NV        +  Q  H+       + KP K++        T++T  LL+V+F FL C  PF +++LLRT  +   +    W+ +W+ +Y+LVY NNC+NFPIYIIS  +FR+ V  LL
Sbjct:   24 WHYIPPILIPIGLTENSLALFVLSRRRFVRLPSRATLISIAIVDSVVLVLGLIRFWLNVTFNVYLPSLSEMCCKTLSATVIILSHLSSFLVALLSVERFFAVFMPQRQFKPPIDMMGIPVLGVLCAGTFFIYFHYTVLIDVPNASDHQHQKVCTNMDDTTAFWLDILDSLMLSVIPFIIILLCNGYIIWRMKRNSRRLGNFAR------GSPSPETKFQLTQTIEGASLPTNTCTNVKRISVEFGQADQCRHQSIITFGTKQKPKKKEHPISSTRRTRITNTLLWVTFTFLVCTLPFAIINLLRTADSERRSIA--WNTSWLVSYVLVYTNNCLNFPIYIISNPLFRSEVKDLL 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183A5J7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2232 PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 4.008e-48
Identity = 123/351 (35.04%), Postives = 187/351 (53.28%), Query Frame = 1
Query:   46 SEIDPYFMRT--WLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKKINK 1092
            SE D Y   +  W+  + I I  GV+EN LS+LVL R RF  +PSR TL+AL+I D +VLF G+ RYWL   F+ +P+ ++       S   +  SH+SS LVAL+ VERF A+      LP      R ++      L   L ++  T   + + +   + C+S +   A+  DI D +LL   P  VI   N  II+ +R+ S ++ ++ +          ++  L +I+     S+ T           +S +R R     R+ ++T  LL V+F FL CN PF VVH++RT  +     TR W++AW+ TY+LVY NNC+NFPIY++SQ  FRN + +L   K+  +
Sbjct:   26 SEADLYTHNSPIWMYVAPILIIVGVTENCLSILVLTRDRFIHVPSRVTLVALAIVDCVVLFIGLIRYWLNVTFDMHPVEWN-------SAWFLFSSHLSSCLVALLSVERFLAVC-----LP------RKIFRPSIDKLGTVLLIVVLTDSNDKDEHK-KYVCSSESDWVALWQDIADVLLLFVLPCIVITTCNIYIILAIRRNSKRVGRSGK----------RRDTLPTISSKPVESEQTAF-------GRKSPNRIRGGEKHRNVRITTTLLCVTFAFLLCNLPFAVVHIMRTADSSRR--TREWNIAWLVTYILVYVNNCLNFPIYVVSQEQFRNELKNLCCTKRFGR 338          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183A5J8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2233 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 9.514e-48
Identity = 127/360 (35.28%), Postives = 185/360 (51.39%), Query Frame = 1
Query:   64 FMRTWLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVY-------YYILLPSKTIQIRGLYIVYFSSLFVNLHVIFN-TILKENE-----TNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSN---QMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWK------------RDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHV 1059
            ++  WLI        GV+EN L+++VL +  F  +PSR TLI L++ D LVL FG+  +W+  VFE +P  +S   CK+L +L +TLSH+SS LVAL+ VERF A+          + L+ +  I I    +      F+NL +  N T+  EN      T    + CT      A+ +DIID +LL   P  VILF N  II  +R  ++   ++QQ         +  + ++R+LS T            S    ++Y   H    KP              R  + TIMLL+++FVFL  N PF VVHLLR+    +   TR   +AW+ TY+LVY +NC+NFPIY+ + S FR  +
Sbjct:   24 YLAPWLIL------IGVTENSLALIVLSKKPFVRLPSRITLITLAVVDCLVLLFGLTTFWINTVFETSPAEWSKNWCKILGFLTMTLSHMSSCLVALLSVERFIAVYQPNRRFRPSFDLVGTLVILILCTGVDLAQVPFINLKLNLNSTVNGENIQPGVFTQRHTYICTYTYEEEALFIDIIDMLLLFGLPFTVILFCNSYIIYVIRNFTHSIKKLQQAIPLQTTGGNKQMDERRMLSPT----------DPSGATHERYGLVHEANTKPSTSSLIGDTAGKHVRHMKTTIMLLWITFVFLVFNLPFAVVHLLRSIPQVQ--VTREMMLAWLGTYILVYIHNCLNFPIYVFTHSGFRTEL 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: G7Y6K2 (G-protein coupled receptor OS=Clonorchis sinensis OX=79923 GN=CLF_101785 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.295e-47
Identity = 133/359 (37.05%), Postives = 188/359 (52.37%), Query Frame = 1
Query:   31 IVMNASEIDPYF--MRTWLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERF---------FAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKEN-ETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLL 1071
            I  N ++ D Y      WL    I IP G  ENIL+VLVL RPRFS +P R TLIA++I D +VLFFG+ R+W   +F+ N    S   CK+LS LVI+ SH+SS LVAL+ VERF         F     Y  +P  T    G++ VY+            TIL         D  C S +   A+ +D++D+ LLC  PL +I  SN  II +L +  N  + +   N V  +S    + +   +   +  Q +C    +  K   ++   +   + R  ++TI LL ++  F+   FPF VVHL RT  N     T PW+M+W+ TY+LVY NNC+NFPIYIISQ  F   + +++
Sbjct:    6 ISENFTDADTYVWDASVWLYIPPILIPVGFCENILAVLVLARPRFSQLPCRITLIAIAIVDMIVLFFGLTRFWTNVMFDTNLQTLSEAVCKMLSPLVISCSHLSSLLVALLSVERFCSVYRPHNRFHTPVDYFGVPVLTFFCLGIFFVYYHY----------TILTPGIPGTKHDKVCVSTSQTVAIILDLLDTALLCLIPLVIISVSNTFIIYRLYQ--NTKKLDNYHNSVQSTS----RHMTGDSEISSVDQRSCLPQLIRKKPRVTHPSPKLVGFNRQKRITITLLLITSSFVLFTFPFTVVHLSRTVDNERR--TSPWNMSWLITYILVYVNNCLNFPIYIISQPYFYGELKAMM 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:103035443])

HSP 1 Score: 61.2326 bits (147), Expect = 5.438e-10
Identity = 86/350 (24.57%), Postives = 145/350 (41.43%), Query Frame = 1
Query:   55 DPYFMRTWLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVY-----YYILLPSKTIQIRGLYIVYFSSLFVN--LHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNG-ENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCK 1080
             P+F+   L    IFI  GV  N+L+ +V+I+ R    P+   L +L+++D LVL FGM    +  +++  P  +    C    +L  T+   S   V ++ VER+ A+V+     Y +        I G++IV       N  LH I    L E    S   +     W   + +  + ++L  F P+ VI    G  +V   K+  + +Q  R                         ++  +CS  VS++ Q    +R        QVT ML  V  VF  C  PF    LL +++    +     ++   I + +L Y ++ +N  IY +  S FR   + L+  +
Sbjct:   53 SPFFLPVTLTYILIFIT-GVLGNLLTCIVIIKHRKMRTPTNLYLFSLAVSDLLVLLFGM-PLEIYELWQNYPFPFGESVCCFKVFLFETVCFASVLNVTVLSVERYVAVVHPLKTRYALTNKHAQKMIGGVWIVSLVCAVPNTSLHGIHYYYLPEKVLESATCNLLKPQWIYNLVIQ-VTTVLFYFVPMMVIC---GLYLVIGMKLGREQKQQGR-------------------------KLGRNCSADVSRRVQVESGRR-------RQVTKMLAVVVLVFAICWAPFHTDRLLWSFITQWTDRMYSVFEYVHILSGVLFYLSSAVNPIIYNLLSSRFRERFLELMCAR 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO37207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH3])

HSP 1 Score: 48.9062 bits (115), Expect = 1.396e-6
Identity = 79/327 (24.16%), Postives = 141/327 (43.12%), Query Frame = 1
Query:  121 NILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGL-VALVCVERFFAIV--YYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFP--FGVVHLLRTYVNGENTPTRPW-DMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKK 1083
            NIL +L + R R     +   +  L++ D L+   GM  + + +   Y+ +    W CK L+ +  ++  I+S L +A V ++R+FAI+    Y +L +  +    +  V+  SL      IF        TN +   CT+  W +++   +       F PL V+ +S   I++  R+ + QM          +++PLK    +++   DN+++          +K +    K    +K DT+    LL V   FLFC  P   G+  LL         P+  W D  + +T  L   N+  N  +Y +    FR   I ++ C +
Sbjct:    5 NILILLAIKRTRSLQSITSVFIANLAVADFLLAVIGM-PFTMTSSITYDWIFGPFW-CK-LNGMANSVFCIASMLSLAAVSIDRYFAIITPLKYPMLMTPRMAFMLVAWVWLQSLLCGFLPIFGWCRYTYITNESI--CTA-EWGSSIPYTMFIFGACFFAPLLVMFYSYYHILLAARRHARQMALKVG----DIATPLKTAVAITLPSADNNAK----------RKREEREAK----FKSDTKAAKTLLIVMGTFLFCWSPHFIGMTCLL--------FPSCQWPDWFFATTTWLAMMNSGCNPILYGVLNRRFRRSFIEIICCGR 299          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-231m23.4 (si:ch211-231m23.4 [Source:ZFIN;Acc:ZDB-GENE-131127-603])

HSP 1 Score: 49.6766 bits (117), Expect = 1.992e-6
Identity = 39/128 (30.47%), Postives = 62/128 (48.44%), Query Frame = 1
Query:  667 QNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFR 1050
            +N  PN++ +  P++ +    + +      I C+ S +V+     Y R R  PWK+  +   M L    VFL C  P+   HL+  Y  GE+   R +      T LL+ FN+CI+  I+  S S+FR
Sbjct:  162 ENFNPNQLKVLLPVRLEFFFVLCLLPLLVCIYCYLSMIVTL----YSRPRI-PWKKKKKAIGMALGTLAVFLICVVPYNSSHLV-GYFLGESPKWRHY------TLLLLAFNSCIDPFIFYFSSSIFR 277          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000062905.1 (SMESG000062905.1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 352/352 (100.00%), Postives = 352/352 (100.00%), Query Frame = 1
Query:   37 MNASEIDPYFMRTWLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKKINK 1092
            MNASEIDPYFMRTWLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKKINK
Sbjct:    1 MNASEIDPYFMRTWLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKKINK 352          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000075377.1 (SMESG000075377.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.239e-64
Identity = 130/303 (42.90%), Postives = 185/303 (61.06%), Query Frame = 1
Query:   76 WLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILK-ENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWIST 981
            WLI SS+ IP GV EN +SV+VL+R +F  MPSR +LI LSIND ++L  G+ RYWL AV      N   W C++LSYLVI +SHISS +VAL+C+ER  A+V+ +    +  +Q+ GLY+ +F    +N+H++F+T L+ + +TNST   CT+ +W  A+ VD +D+I LCF PL +I+  N CII+KL+ VS+++      +  + SS ++ K         N +Q      N VSK   +         KRD +VT  LLFV+  F   N PFGVV+ LRTY + +NTP+  W  AW  T
Sbjct:    6 WLICSSVLIPLGVIENAISVVVLVRQKFQAMPSRLSLICLSINDLILLIVGLGRYWLKAVTGRYAANDIYWLCRLLSYLVIAMSHISSTIVALICIERLAAVVFSHRFPSTYRLQVIGLYLTFFICCSLNIHLLFDTELEFDMKTNST--GCTNSSWKVAIIVDSLDAIFLCFLPLIIIISCNSCIIIKLKIVSHKITSRLPDSHTTPSSSVRLK---------NEAQT--FGKNNVSKSRIT---------KRDNKVTKTLLFVTMAFFIFNVPFGVVNFLRTYASEDNTPSNSWTQAWTVT 286          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000075377.1 (SMESG000075377.1)

HSP 1 Score: 209.149 bits (531), Expect = 1.581e-64
Identity = 130/303 (42.90%), Postives = 185/303 (61.06%), Query Frame = 1
Query:   76 WLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTILK-ENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWIST 981
            WLI SS+ IP GV EN +SV+VL+R +F  MPSR +LI LSIND ++L  G+ RYWL AV      N   W C++LSYLVI +SHISS +VAL+C+ER  A+V+ +    +  +Q+ GLY+ +F    +N+H++F+T L+ + +TNST   CT+ +W  A+ VD +D+I LCF PL +I+  N CII+KL+ VS+++      +  + SS ++ K         N +Q      N VSK   +         KRD +VT  LLFV+  F   N PFGVV+ LRTY + +NTP+  W  AW  T
Sbjct:    6 WLICSSVLIPLGVIENAISVVVLVRQKFQAMPSRLSLICLSINDLILLIVGLGRYWLKAVTGRYAANDIYWLCRLLSYLVIAMSHISSTIVALICIERLAAVVFSHRFPSTYRLQVIGLYLTFFICCSLNIHLLFDTELEFDMKTNST--GCTNSSWKVAIIVDSLDAIFLCFLPLIIIISCNSCIIIKLKIVSHKITSRLPDSHTTPSSSVRLK---------NEAQ--TFGKNNVSKSRIT---------KRDNKVTKTLLFVTMAFFIFNVPFGVVNFLRTYASEDNTPSNSWTQAWTVT 286          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042142.1 (SMESG000042142.1)

HSP 1 Score: 78.5666 bits (192), Expect = 8.940e-16
Identity = 99/363 (27.27%), Postives = 160/363 (44.08%), Query Frame = 1
Query:   76 WLIASSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAI-----VYYYILLPSKTIQIRGLYIVYFSS--------LFVNL-HVIFNTILKENETNSTDFSCTSLNWNTAM--AVDIIDSILLCFCPLFVILFSNGCI---IVKLRKVSNQM-QQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDT-QVTIMLLFVSFVFLFCNFPFGVVHL---LRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSCKKINK 1092
            W++     +  G   N LS +VL R   S + S   L  L+I D L+L  G+FR W+  V +++  N+S+  CK+   + ++ S IS  L+  + VER   I        Y         I  L I+ F++           NL H   NT    ++ +++   C      T    A   ID     + PLF+++ +N  I   I K R + N M   N   NK   +S ++ +  L   M ++SS+                         R+T Q+T+MLL VSF FL    PF ++ L   L+ Y NG+    +   +  I   +L+Y N+ INF +Y  + + FR  +I +L C++ +K
Sbjct:   71 WMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEASKYAKASRAKYIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWIPLFLLIINNLIILSEIYKARNIHNSMINTNHDENKTLGTSIVRTQ--LPRRMKESSSR------------------------NRETKQLTVMLLIVSFSFLITTSPFVILKLLIKLKGYPNGDRKLAQLVLLDGIFE-MLMYVNHAINFYLYCATGNKFRQQLIKILFCRRSSK 406          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042465.1 (SMESG000042465.1)

HSP 1 Score: 73.559 bits (179), Expect = 3.046e-14
Identity = 82/344 (23.84%), Postives = 144/344 (41.86%), Query Frame = 1
Query:   88 SSIFIPFGVSENILSVLVLIRPRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKVLSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFSSLFVNLHVIFNTI----------LKENETNSTDFSCT-SLNWNTAMAVDIIDSILLCFCPLFVILFSNGCIIVKLRK---VSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNSSQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPFGVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFRNHVISLLSC 1077
            +++ I  G+  N +S+ VL R + +   +R+ +I LSI D  VL   + RYW+ A F Y+   Y+ + CK   +LV   S  + G +  + VERF  + Y     P K+  +  ++ V    +  +  VI   I          +     N T  +C   LN   +     +D +     P  ++ F N  I +KLRK   + N+  QN           L+Q  L++    +  + I      V+ KK            +R   +  +L  +S +    + P  +   L+  +  E+ P+    +   S  LL++ NN IN   Y+ S   FR + + ++ C
Sbjct:   31 AALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSY-----PQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNI--------PKLQQMNLIT----NEETPIP-----VIPKK------------RRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQE-SLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 339          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trhr-19.841e-822.59Thyrotropin-Releasing Hormone Receptor [Source:Un... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CRL03.036e-5737.967 transmembrane receptor OS=Fasciola hepatica OX=6... [more]
A0A5J4NX882.773e-5034.46G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183A5J74.008e-4835.04G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183A5J89.514e-4835.28G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
G7Y6K21.295e-4737.05G-protein coupled receptor OS=Clonorchis sinensis ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nmur35.438e-1024.57neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372071.396e-624.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-231m23.41.992e-630.47si:ch211-231m23.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062905.10.000e+0100.00SMESG000062905.1[more]
SMESG000075377.11.239e-6442.90SMESG000075377.1[more]
SMESG000075377.11.581e-6442.90SMESG000075377.1[more]
SMESG000042142.18.940e-1627.27SMESG000042142.1[more]
SMESG000042465.13.046e-1423.84SMESG000042465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027715 ID=SMED30027715|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1093bp
ATTATTGACAGTTTCAAATGTAGATGCTTTATTGTGATGAATGCATCAGA
AATAGATCCGTATTTTATGAGAACTTGGTTGATTGCGTCTTCGATATTTA
TTCCTTTCGGAGTCAGTGAGAACATTCTTTCTGTGTTAGTGCTAATCAGA
CCGAGATTCTCCGATATGCCGTCGAGATATACACTGATTGCACTCTCAAT
CAATGACGGATTGGTGTTATTTTTCGGAATGTTTCGCTATTGGTTGGTTG
CGGTGTTCGAATATAATCCCATGAATTACAGTTTATGGAGCTGTAAAGTG
CTCTCGTATTTAGTGATTACACTGAGCCATATCAGTTCTGGTTTGGTGGC
ATTGGTTTGTGTTGAAAGGTTTTTTGCAATTGTCTATTACTACATTCTTT
TACCATCGAAAACAATACAAATCAGAGGATTGTATATTGTTTATTTTTCA
AGTCTTTTTGTTAATTTACACGTGATTTTCAATACGATTCTCAAAGAAAA
CGAGACTAATTCCACAGATTTCTCCTGCACGAGTTTAAACTGGAACACAG
CAATGGCAGTTGATATCATTGATAGTATTCTGTTGTGTTTTTGCCCATTG
TTTGTTATCCTATTTAGCAATGGCTGTATCATTGTAAAATTGAGAAAGGT
TTCAAATCAAATGCAACAGAACACGAGACCAAATAAAGTGTCCATGTCGT
CTCCATTAAAACAAAAGAGACTATTATCAATAACAATGAATGACAATTCC
TCACAGATAACATGCCATTGTTCGAATGTAGTTTCTAAGAAGTACCAATC
TTATCATAGAAAACGATGGAAACCATGGAAAAGGGATACCCAAGTTACAA
TTATGTTGTTATTTGTTTCGTTTGTTTTTCTATTTTGTAACTTTCCATTT
GGAGTCGTTCATTTACTGAGGACGTATGTCAACGGTGAGAACACTCCAAC
GAGACCTTGGGATATGGCTTGGATATCTACATATCTACTGGTCTATTTCA
ATAATTGCATTAATTTCCCCATTTATATTATTTCCCAATCGGTTTTCAGG
AATCATGTTATTTCTCTTTTGTCTTGTAAAAAAATTAATAAAC
back to top

protein sequence of SMED30027715-orf-1

>SMED30027715-orf-1 ID=SMED30027715-orf-1|Name=SMED30027715-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
IIDSFKCRCFIVMNASEIDPYFMRTWLIASSIFIPFGVSENILSVLVLIR
PRFSDMPSRYTLIALSINDGLVLFFGMFRYWLVAVFEYNPMNYSLWSCKV
LSYLVITLSHISSGLVALVCVERFFAIVYYYILLPSKTIQIRGLYIVYFS
SLFVNLHVIFNTILKENETNSTDFSCTSLNWNTAMAVDIIDSILLCFCPL
FVILFSNGCIIVKLRKVSNQMQQNTRPNKVSMSSPLKQKRLLSITMNDNS
SQITCHCSNVVSKKYQSYHRKRWKPWKRDTQVTIMLLFVSFVFLFCNFPF
GVVHLLRTYVNGENTPTRPWDMAWISTYLLVYFNNCINFPIYIISQSVFR
NHVISLLSCKKINK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 282..306
score: 26.73
coord: 58..79
score: 22.52
coord: 105..127
score: 18.66
coord: 25..49
score: 19.75
coord: 188..211
score: 20.41
coord: 324..350
score: 25.87
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 40..340
e-value: 1.6E-19
score: 70.3
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 111..127
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 21..361
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 26..351
e-value: 1.11165E-18
score: 83.066
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 17..362
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 145..164
NoneNo IPR availableTMHMMTMhelixcoord: 323..345
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 26..48
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 40..342
score: 23.561