IAP domain containing-1

Overview
NameIAP domain containing-1
Smed IDSMED30027712
Length (bp)714
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IAP domain containing-1 (SMED30027712) t-SNE clustered cells

Violin plots show distribution of expression levels for IAP domain containing-1 (SMED30027712) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IAP domain containing-1 (SMED30027712) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IAP domain containing-1 (SMED30027712) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027712

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027712h1SMcG0001559 Contig2887GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30027712h1SMcG0001559 dd_Smed_v4_9146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027712h1SMcG0001559 dd_Smed_v4_9146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027712h1SMcG0001559 dd_Smed_v4_9146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027712h1SMcG0001559 dd_Smed_v4_9146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IAP domain containing-1 vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 47.3654 bits (111), Expect = 8.584e-6
Identity = 22/64 (34.38%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  427 ISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILI 618
            +S  EQL+   +E+          C +C    VS++++PCGHL++CT+C   N ++C IC+  I
Sbjct:  280 LSTEEQLRQLKEERM---------CKVCMDNDVSMVFVPCGHLVVCTECAP-NLRHCPICRAAI 333          
BLAST of IAP domain containing-1 vs. UniProt/SwissProt
Match: sp|Q8JHV9|BIR7A_XENLA (Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.422e-6
Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 1
Query:  397 SEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILI 618
            SE   E    +S  EQL+   +E+          C +C  + VS+L++PCGHL++CT+C   N ++C IC+  I
Sbjct:  329 SEPPKESAPPLSTEEQLRRLKEERM---------CKVCMDKDVSMLFVPCGHLVVCTECAP-NLRHCPICRAAI 392          
BLAST of IAP domain containing-1 vs. UniProt/SwissProt
Match: sp|A9ULZ2|BIR7B_XENLA (Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis OX=8355 GN=birc7-b PE=2 SV=2)

HSP 1 Score: 49.6766 bits (117), Expect = 7.942e-6
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  406 RSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILI 618
            RSE  K         L  +E+ Q +    + C +C  + VS+L++PCGHL++CT+C   N ++C IC+  I
Sbjct:  272 RSEPPK----VSGPPLSTEEQLQRLKEERM-CKVCMDKDVSMLFVPCGHLVVCTECAP-NLRHCPICRAAI 336          
BLAST of IAP domain containing-1 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 47.3654 bits (111), Expect = 5.485e-6
Identity = 23/79 (29.11%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  382 ELRLDSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILI 618
            E+R  +    ++   +S  EQL+   +E+          C +C  + VS++++PCGHL++CT C   + ++C IC+ +I
Sbjct:  349 EVRTQTSVGEKVTGNLSAEEQLRQLQEER---------TCKVCMDKLVSMVFIPCGHLVVCTDCAA-SLRHCPICRAVI 417          
BLAST of IAP domain containing-1 vs. Planmine SMEST
Match: SMESG000031949.1 (SMESG000031949.1)

HSP 1 Score: 390.578 bits (1002), Expect = 5.283e-140
Identity = 192/193 (99.48%), Postives = 192/193 (99.48%), Query Frame = 1
Query:   64 MSIKSLNFELDTKNIYVSDSDGPRAIHLNNVKERIKTNANISDSFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLDSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL 642
            MSIKSLNFELDTKNIYVSDSDGPRAIHLNNVKERIKTNANISDSFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLD EYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL
Sbjct:    1 MSIKSLNFELDTKNIYVSDSDGPRAIHLNNVKERIKTNANISDSFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLDFEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL 193          
BLAST of IAP domain containing-1 vs. Planmine SMEST
Match: SMESG000067789.1 (SMESG000067789.1)

HSP 1 Score: 129.028 bits (323), Expect = 7.752e-37
Identity = 69/184 (37.50%), Postives = 104/184 (56.52%), Query Frame = 1
Query:   91 LDTKNIYVSDSDGPRAIHLNNVKERIKTNANISDSFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLDSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL 642
            + TKN  +     P ++     K  ++   N  D+F + + I    +LK F  P I+Y  D F YDK +LKL S+++   +  ++ D++N  FW CMELRL+ EY     +WI   + ++ K  EK  ++   YL C +CK  QVS+LYLPCGH+I+C+KC  +N + CQ C   I E H IY+
Sbjct:   32 VKTKNKTIISEQKP-SMEFIEFKSTVEDFINTYDTFTDKEII---NILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV 211          
BLAST of IAP domain containing-1 vs. Planmine SMEST
Match: SMESG000031926.1 (SMESG000031926.1)

HSP 1 Score: 122.094 bits (305), Expect = 3.029e-34
Identity = 58/150 (38.67%), Postives = 90/150 (60.00%), Query Frame = 1
Query:  193 SFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLDSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL 642
            S    D IFL KL KSFN   I+     FGY+  +LKL S +++  +IK    N N +FW+CME R+  +Y+  I  +++N + L+    +K +     +L C  C+  QVS+LYLPCGH+++C+ CF+  T+ C+ C + I+E H +YL
Sbjct:   50 STNGFDLIFLNKLNKSFNHESIENLSKLFGYNHAMLKLSSCVISLNDIKPTDFNTNLVFWSCMEFRV-GQYQKLIQYFMANVDNLQQNINDKLKEATRLFLTCSCCETNQVSVLYLPCGHIVVCSSCFKSTTRRCESCAVDIDEYHFVYL 198          
BLAST of IAP domain containing-1 vs. Planmine SMEST
Match: SMESG000032006.1 (SMESG000032006.1)

HSP 1 Score: 110.538 bits (275), Expect = 5.784e-30
Identity = 51/150 (34.00%), Postives = 90/150 (60.00%), Query Frame = 1
Query:  190 DSFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLDSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIY 639
            +++E L    + +++KSF    ++  H+ FGY++ +LKL S +++  +I  + + MN +FW CM LRLD      I  W+ N +++ L  ++    ++  YL C  C++  VSILYLPCG +++C++C+  +   CQ CQ  ++E H IY
Sbjct:   34 ENYEILPLKTVQRIVKSFANEYVEILHEKFGYEQSVLKLASCVISINQIDESLERMNEIFWDCMNLRLDKSCGKIIKSWMLNIDRIVLDLKKISNKLSKEYLTCCACQLNPVSILYLPCGDIVICSECYNDSVVKCQGCQRHVDEMHKIY 183          
BLAST of IAP domain containing-1 vs. Planmine SMEST
Match: SMESG000067794.1 (SMESG000067794.1)

HSP 1 Score: 107.071 bits (266), Expect = 1.917e-28
Identity = 53/149 (35.57%), Postives = 90/149 (60.40%), Query Frame = 1
Query:  199 ENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRL-DSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL 642
            +N++   L ++ +S   P I++   TF +++ +LK+ + +L    ++++ + +N  FW    LRL D + R+ I  W+ NFE+++   +E+ +  +   L CF CK  QVSILYLPCGHL+ C  CF  + K+CQ+C+  I+  H IYL
Sbjct:   55 QNIEPFQLAQISESLRHPSIRFLRQTFDFNESILKMCTCLLQLNLMEIDNEILNDYFWKFSTLRLTDPDSRTIIQYWLENFEKIEKFIEERLKEFSKSKLTCFECKENQVSILYLPCGHLVTCGTCFVSSRKHCQVCETPIDNFHLIYL 203          
The following BLAST results are available for this feature:
BLAST of IAP domain containing-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arsa.18.584e-634.38arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of IAP domain containing-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8JHV9|BIR7A_XENLA3.422e-635.14Baculoviral IAP repeat-containing protein 7-A OS=X... [more]
sp|A9ULZ2|BIR7B_XENLA7.942e-635.21Baculoviral IAP repeat-containing protein 7-B OS=X... [more]
back to top
BLAST of IAP domain containing-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc75.485e-629.11baculoviral IAP repeat-containing protein 7 [Sourc... [more]
back to top
BLAST of IAP domain containing-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IAP domain containing-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031949.15.283e-14099.48SMESG000031949.1[more]
SMESG000067789.17.752e-3737.50SMESG000067789.1[more]
SMESG000031926.13.029e-3438.67SMESG000031926.1[more]
SMESG000032006.15.784e-3034.00SMESG000032006.1[more]
SMESG000067794.11.917e-2835.57SMESG000067794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027712 ID=SMED30027712|Name=IAP domain containing-1|organism=Schmidtea mediterranea sexual|type=transcript|length=714bp
TAGGATATATAGGATGTCATAAAAATTATTAACATTATTATTATTACTGT
ATCTAAATTGAAAATGTCAATTAAGTCGTTGAATTTTGAACTCGACACAA
AAAATATCTATGTTTCGGATTCAGATGGCCCCCGGGCGATTCACCTCAAC
AATGTCAAGGAACGAATTAAAACAAATGCAAATATTTCCGACAGTTTTGA
AAATCTGGATTTTATTTTTTTAGGTAAATTGCTCAAATCATTTAACGAGC
CGTTAATTCAATATTTTCATGACACTTTTGGATACGACAAACCCTTATTG
AAATTGGTCAGCTTCATTCTAAATTCGTATGAAATAAAAGTCAACAAAGA
CAACATGAATTTTTTATTTTGGACCTGCATGGAATTAAGGTTGGATTCTG
AATATCGCTCCGAAATTAACAAATGGATTTCAAATTTTGAACAATTAAAA
TTAAAAGCTCAAGAAAAGTTTCAAAATATTGCTAGTTTTTATTTAAAATG
TTTCCTCTGTAAAATTCAACAAGTCTCGATTTTGTATCTTCCTTGTGGAC
ATCTAATATTGTGTACAAAATGCTTTCAAAGAAACACAAAATATTGTCAA
ATTTGCCAAATACTTATTGAAGAAGCACATACAATTTATTTGTGACACCT
TACAACAGGACAACTTAAAATATACGAAATTTTATTTTAATAAAAAATCA
ATAATTAAAAAAAA
back to top

protein sequence of SMED30027712-orf-1

>SMED30027712-orf-1 ID=SMED30027712-orf-1|Name=SMED30027712-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MSIKSLNFELDTKNIYVSDSDGPRAIHLNNVKERIKTNANISDSFENLDF
IFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNF
LFWTCMELRLDSEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCK
IQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 47..90
e-value: 6.3E-9
score: 35.6
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 46..92
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 23..96
e-value: 1.0E-10
score: 42.9
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 49..85
score: 8.934