Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2

Overview
NameRetrovirus-related Pol polyprotein from type-1 retrotransposable element R2
Smed IDSMED30027708
Length (bp)1459
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30027708) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30027708) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30027708) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30027708) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027708

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30027708SMESG000061623.1 SMESG000041246.1 SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000014208.1 SMESG000010825.1 Contig46662uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027708SMESG000061623.1 SMESG000041246.1 SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000014208.1 SMESG000010825.1 Contig46662newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027708SMESG000015124.1 SMESG000015116.1 Contig41082uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027708SMESG000015124.1 SMESG000015116.1 Contig41082newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30027708SMESG000061623.1 SMESG000041246.1 SMESG000014208.1 Contig29920uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30027708SMESG000061623.1 SMESG000041246.1 SMESG000014208.1 Contig29920newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30027708SMESG000041246.1 SMESG000014208.1 SMESG000010825.1 SMESG000002682.1 Contig11632uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027708SMESG000041246.1 SMESG000014208.1 SMESG000010825.1 SMESG000002682.1 Contig11632newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027708SMESG000078596.1 SMESG000067305.1 SMESG000046455.1 SMESG000044750.1 SMESG000029087.1 SMESG000014208.1 SMESG000002398.1 Contig47584uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027708SMESG000078596.1 SMESG000067305.1 SMESG000046455.1 SMESG000044750.1 SMESG000029087.1 SMESG000014208.1 SMESG000002398.1 Contig47584newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027708 Contig13134uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027708 Contig13134newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: CABZ01033394.1 (pep chromosome:GRCz11:13:6032844:6038477:-1 gene:ENSDARG00000101795.2 transcript:ENSDART00000166130.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01033394.1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.530e-9
Identity = 71/257 (27.63%), Postives = 115/257 (44.75%), Query Frame = 2
Query:  116 KGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPV--QVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPY--AILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLR-RILNL----PHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCD 859
            +G++QGC LS +L+S+AI P+L  + RS IE FM+ +  V  Q+ AYADD+ +  N  +++  +V +  E            K   +   + N NG  ++    I K   K   +YLGV +GE   Q      I++K+    KK        W+       +IH +L+F  R   I  + ++++  +   C    S L   L+ +++N      H      LY   E GG   V L+  + T  +    RL T   D
Sbjct:  678 RGIRQGCALSGMLYSLAIEPMLRKL-RSRIEGFMLANKSVQHQLSAYADDVIVFVNGQKDVNTLVSIISEFDKLSAARVNWGKSDALINGKWN-NGTPILPGGLIWK---KGGLKYLGVYLGESTMQQKNWDGIIEKIEGKLKK--------WR-------WIHPQLSFRGRVLIINNL-IASTLWHRLFCTEPPSGLLLFLQAKLVNFFWDRMHWVPQSELYLPLEEGGQGLVSLVSRHATFRLQFVQRLLTGPVD 913          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: BX547930.4 (pep chromosome:GRCz11:20:12830448:12834749:1 gene:ENSDARG00000098779.2 transcript:ENSDART00000164754.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX547930.4)

HSP 1 Score: 59.3066 bits (142), Expect = 9.184e-9
Identity = 65/240 (27.08%), Postives = 107/240 (44.58%), Query Frame = 2
Query:  116 KGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDL--PVQVLAYADDIALVANNVENLQKIVDVAVE----AATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGED--NDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTN---PCGNNSSKLRGHLRRIL-NLPHNSETVYLYNSTENGGASCVDLL 799
            +G++QGC LS +L+SIA+ P+L  I R  +E F   +L  PV++ AYADDI ++ N   ++ K+VD+       ++  I +  +   C   Q  R     EIL     +    SK   +YLG+ +G++  N ++   I D        I D  L  W+       ++  +++F  R   I  +  S+     +   P      K++  L     N  H      LY   E GG   +DL+
Sbjct:  671 RGIRQGCALSGMLYSIALEPLLNKIRRE-LEGFKCENLFPPVKLSAYADDIMVLFNGQNDINKLVDIVTNYGKFSSARINWG-KSAACLVGQWER-----EILFLPGGMS--WSKNTLKYLGIYLGDEATNQKNWENICD--------IVDGRLERWR-------WLLPKMSFRGRALIINNLVASSLWHKLSVLEPPAGILEKIQAKLIDFFWNKLHWVPRAVLYLPKEEGGQGIIDLM 886          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: BX649434.3 (pep chromosome:GRCz11:3:18270043:18274691:-1 gene:ENSDARG00000105157.2 transcript:ENSDART00000161140.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX649434.3)

HSP 1 Score: 51.6026 bits (122), Expect = 2.079e-6
Identity = 60/238 (25.21%), Postives = 112/238 (47.06%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMI--GDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDN--DQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQ---GNTNPCGNNSSKLRGHLRRIL--NLPHNSETVYLYNSTENGGASCVDLL 799
            Q+GV+QGC +S +L+SIAI P+L  I R+ ++ F I   +  VQ+ AYADD+ +   N ++++++  +          +   EK   + +     +  +L    + K    + F +YLGV +GE +   Q+   +L+K+ S  +K        W+       ++  +L++  RT  I  +  S+        +P      K++G L      NL    ++V L+   + GG   V+L+
Sbjct:  681 QRGVRQGCAMSGMLYSIAIEPLLHRI-RAELKGFSIPHCNTQVQLSAYADDVIVFITNTDDVRRLECIINNFKKISSAKVNWEKSEALLIGDWKRDPPLLPGGLKWK----RGFLKYLGVYLGESDFVQQNWNGLLEKIQSRLQK--------WK-------WLLPQLSYRGRTLIINNLVSSSMWHKLACVDPPAGLLPKIQGELVNFFWDNLHWTPQSV-LFLPRDEGGQGLVNLV 897          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: BX470182.1 (pep chromosome:GRCz11:16:40217043:40220920:1 gene:ENSDARG00000112132.1 transcript:ENSDART00000191128.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX470182.1)

HSP 1 Score: 49.6766 bits (117), Expect = 7.203e-6
Identity = 30/93 (32.26%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  116 KGVKQGCPLSMILFSIAINPVLEAISR-SCIEPFMIGDLPVQVLAYADDIALVANNVE-NLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVN 388
            +G +QGCPLS  LF++AI P+  +I + S I P +I + P  +  YADD+ +     E ++  +++V        GF    +K   M L   N
Sbjct:  568 RGTRQGCPLSPYLFALAIEPLAASIRQNSQISPILINNRPQYISLYADDVLIYMTKPELSIPTLLNVLESFKKLSGFTINWDKSELMPLTEDN 660          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: slc7a1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:Xenbase;Acc:XB-GENE-984439])

HSP 1 Score: 57.3806 bits (137), Expect = 1.233e-8
Identity = 29/74 (39.19%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGD-LPVQVLAYADDIALVANNVENLQKIVDVAVEAATE 331
            + GV+QGCPLS +L+  AI+P L A+    +E F     LP++++AYADD+ +V ++ E +  + D A+E+ +E
Sbjct:  363 EAGVRQGCPLSPLLYVFAIDPFLRAVQALDLEGFRAPRCLPLKLVAYADDVTVVVSHPEEVNLLTD-AIESYSE 435          

HSP 2 Score: 22.3274 bits (46), Expect = 1.233e-8
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVT 98
            L+  G+ ++F+  + +LY + +SF    P+V 
Sbjct:  326 LRKYGIPDQFVEWLTVLYREGESF----PLVN 353          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: ENSXETT00000024583.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:942889:946017:1 gene:ENSXETG00000015161.1 transcript:ENSXETT00000024583.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 4.370e-7
Identity = 45/177 (25.42%), Postives = 81/177 (45.76%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMI-GDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMAL 646
            GV+QGCPLS +L+  A++P L  + R  +E   + G  P++ +AYADD++++ +    ++ + D     +   G     EK     +    + GE           ++ E  + LGV  G +         D  + + ++  D+GL   Q+ K++K      LT+  R   IKT  +
Sbjct:  410 GVRQGCPLSPLLYVFALDPFLRMLERKGLEGVCVPGGQPLRFVAYADDVSVIVSKQAEVEVVTDCIRSYSRASGSSVNREKSEAFWV----LEGEPAFQVGNFP--VAPEQVKILGVKFGRN---------DNGLLNWEEKLDAGLAKVQRWKSWK------LTYRERVNLIKTFLI 565          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: ENSXETT00000020113.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460487.1:109051:110186:-1 gene:ENSXETG00000006927.1 transcript:ENSXETT00000020113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 5.063e-6
Identity = 41/178 (23.03%), Postives = 87/178 (48.88%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISR-SCIEPFMIGDLPVQVLAYADDIALVANNVE-NLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYA-----ILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREI 631
            G +QGCP+S ++F++++ P+  AI + S I+ F +G    ++  +ADDI L  ++ + +L  ++    +  +  G++  P K     LP      E+ + +        K+   YLG+ +   + Q+ Y+     +++K+  D        L  + ++ A ++ +  R+ + FRT  I
Sbjct:   67 GTRQGCPMSPLIFALSLEPLAHAIRQNSNIKGFQVGPTEYKISLFADDILLTLSSPQTSLPNLITTLEKFQSTTGYKINPTKSH--ALPLHMSKPELKLLQLNFDYKWEKDAITYLGINL-TSSYQTLYSANYPKLIEKLKRDLITWHTYHLSWFGRIAAVRMTLLPRILYLFRTLPI 241          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: txlna (taxilin alpha [Source:Xenbase;Acc:XB-GENE-992926])

HSP 1 Score: 50.8322 bits (120), Expect = 5.117e-6
Identity = 47/164 (28.66%), Postives = 78/164 (47.56%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAI-SRSCIEPFMIGDLPVQVLAYADDIAL-VANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILI--------NEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSD-TKKIADSGLFGWQKL 571
            ++G +QGCPLS +LF++AI P+   I +   IE   IG++  ++  YADD+ L +AN+ + L  ++ V  E     G              R+N +  I+           + I +L     ++YLG+ V +D ++     L+ VV   T K+A      WQ L
Sbjct:  248 ERGTRQGCPLSPMLFALAIEPLAIRIRAHEAIEGLRIGNITEKISLYADDMLLYLANSHQALMNLLAVLSEFGRYSGL-------------RINHSKSIIFPIDPLPPGTPEYISQLQVVSSFKYLGITVHKDLNKYEQLNLNPVVQALTNKVAI-----WQDL 393          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|Q03278|PO21_NASVI (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Nasonia vitripennis OX=7425 PE=4 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 4.037e-11
Identity = 56/229 (24.45%), Postives = 99/229 (43.23%), Query Frame = 2
Query:  116 KGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLP--------RVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGG 778
            +GV+QG PLS +LF+  ++ VL  +  +    F++G   +  L +ADD+ L+A   E LQ  +        E G E  P KC  + L         +V  +    +  +EI +L   + ++YLGV     N   P  +   +  D +++  + L   Q++    +F+  R         I  + L  +       G+    +R  +R  L LPH++   Y +   + GG
Sbjct:  511 RGVRQGDPLSPLLFNCVMDAVLRRLPENT--GFLMGAEKIGALVFADDLVLLAETREGLQASLSRIEAGLQEQGLEMMPRKCHTLALVPSGKEKKIKVETHKPFTVGNQEITQLGHADQWKYLGVVY---NSYGPIQVKINIAGDLQRVTAAPLKPQQRMAILGMFLIPRF--------IHKLVLGRTSNADVRKGDKI--IRKTVRGWLRLPHDTPIGYFHAPIKEGG 724          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|Q03279|PO21_BRACO (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Bradysia coprophila OX=38358 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 7.060e-9
Identity = 61/228 (26.75%), Postives = 96/228 (42.11%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLP--------RVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGG 778
            GV QG PLS  LF++A    L A++      F I D+ V   AY+DD  L+A  V  LQ  +D   E   +IG      K   + L         ++  N  +L+   E+K L   + ++YLGV       +     +D    D  K+    L   Q++   K F+          + +  + LS +   T  C  +   +R ++RR L LP +    +LY   + GG
Sbjct:  352 GVYQGDPLSGPLFTLAYEKALRALNNE--GRFDIADVRVNASAYSDDGLLLAMTVIGLQHNLDKFGETLAKIGLRINSRKSKTVSLVPSGREKKMKIVSNRRLLLKASELKPLTISDLWKYLGVVYTTSGPEVAKVSMD---DDLSKLTKGPLKPQQRIHLLKTFVIP--------KHLNRLVLSRTTA-TGLCKMDLL-IRKYVRRWLRLPGDVPVAFLYAPVKAGG 564          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A3L8D7E4 (Reverse transcriptase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_010458 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.366e-28
Identity = 89/305 (29.18%), Postives = 143/305 (46.89%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEIL-----INEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRI----LNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGA-ETKLNHGGRKT 997
            + GV+QGCPLS I+F + I+ V+ A +      + I      +LAYADD+AL+A   E +++++      A  +G  + P KC  + +    I G +L     I  + +  L   E Y++LGVP G   DQ+P   ++ V+ D   +  S L  WQ+++    FI  RL F  R   ++   L A              +  H+RRI    LNLP  +    +Y     GG   + L D     TI H FRL T++      +   SL+ V   R+G   P+ ++   +++G+ E +L  GG  +
Sbjct:  174 RSGVRQGCPLSPIIFDLVIDSVVRAAAELTDVGYDILGQTFNILAYADDLALIARTPEGMRQLLTAVELEAGRVGLHFNPAKCASLHITTGRI-GRVLPTVFEIEGRPMPTLAEGEPYRHLGVPTGFSVDQTPLTTIEGVLKDIWAVDASLLAPWQRVEVLAAFILPRLDFLLRGAAVEKRPLRA--------------VDLHVRRIVKSWLNLPQRASAEVVYLPPSRGGCGLLPLSDLADVLTIAHAFRLLTASDAVVSGLAWGSLRGVVARRIG-HAPSDEEIASFLSGSLEGRLRGGGEAS 462          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A0C9Q0T7 (Pol_5 protein (Fragment) OS=Fopius arisanus OX=64838 GN=pol_5 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.827e-27
Identity = 72/250 (28.80%), Postives = 123/250 (49.20%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLP-----RVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFT 847
            + GVKQGCP S I+F++A+  +L  + R     + +G +  +  AYADD+ LVAN  E +++++ +A E A   G  +   KC  + +      R ++     ++   +K L   E Y YLG+P+G   +Q+P A ++ ++ D +KI  S L  WQK+ A + FI  RL +  R   +          N  P      K++  ++  L+LP  +    ++  +  GGA  +   D     TI H FR+ +
Sbjct:  121 KAGVKQGCPASPIIFNLAMERILRELDR-LTAGYRMGGVSYRSFAYADDVVLVANTPEEMREMLRIAEEEAVRAGLSFNAAKCATLHIAGKGAGRRSLPTAFNLSSGAVKALNDGEGYDYLGIPIGVGVNQTPLATIEGMMIDAEKIDGSLLAPWQKIDALRTFIMPRLDYIMRGGTV----------NRAPLSLLDKKIKKLVKGWLHLPQRASAEVVHLPSWRGGAGIIPTADLADILTISHAFRMLS 359          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A183CIN3 (Reverse transcriptase domain-containing protein OS=Globodera pallida OX=36090 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 6.010e-27
Identity = 90/287 (31.36%), Postives = 140/287 (48.78%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQL---PRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGA 964
            + GVKQGCPLS I+F++ + P++ AI    +  + +      VLAYADD+ALVA +   LQ+++DV  + AT  G  +   KC  + L    +  +N E  +       L  ++FY +LGVP G    QS   +L+++ +  +KI  S L  WQK  A   F+   + F  +   ++   L+A             K+R   ++ LNLP  +    LY S   GG     L        +VH +RL TS  D S  +++D LK V   R+  + P   Q  D++NG+
Sbjct:  683 RAGVKQGCPLSPIIFNLGLEPIIRAIRCQGVG-YKLHGSQTSVLAYADDLALVAESAAELQRMLDVTSKVATWEGLSFNARKCATLDLNGKRKDALNTEFSVQNAHPPVLTIEQFYDHLGVPTGYGVAQSANKVLERMNNHVQKINTSLLAPWQKFDAVNTFVLPCIGFHLKNGVVQKTPLNAL----------DKKIRDFGKKWLNLPQRASVEPLYTSHAMGGMGLTPLNLLADISQLVHAYRLITSR-DLS-SLSMDLLKTVVYKRIR-QAPRPDQISDYLNGS 955          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A3L8D8E5 (Reverse transcriptase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_010823 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.805e-26
Identity = 89/305 (29.18%), Postives = 143/305 (46.89%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEIL-----INEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRI----LNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGA-ETKLNHGGRKT 997
            + GV+QGCPLS I+F + I+ V+ A +      + I      +LAYADD+AL+A   E +++++      A  +G  + P KC  + +    I G +L     I  + +  L   E Y++LGVP G   DQ+P   ++ V+ D   +  S L  WQ+++    FI  RL F  R   ++   L A              +  H+RRI    LNLP  +    +Y     GG   + L D     TI H FRL T++      +   SL+ V   R+G   P+ ++   +++G+ E +L  GG  +
Sbjct:  845 RSGVRQGCPLSPIIFDLVIDSVVRAAAELADVGYDILGQTFNILAYADDLALIARTPEGMRQLLTAVELEAGRVGLHFNPAKCASLHITTGRI-GRVLPTVFEIEGRPMPTLAEGEPYRHLGVPTGFSVDQTPLTTIEGVLKDIWAVDASLLAPWQRVEVLAAFILPRLDFLLRGAAVEKRPLRA--------------VDLHVRRIVKSWLNLPQRASAEVVYLPPSRGGCGLLPLSDLADVLTIAHAFRLLTASDAVVSGLAWGSLRGVVARRIG-HAPSDEEIASFLSGSLEGRLRGGGEAS 1133          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A3L8DAI7 (Reverse transcriptase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_010948 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 4.599e-26
Identity = 89/305 (29.18%), Postives = 143/305 (46.89%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEIL-----INEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRI----LNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGA-ETKLNHGGRKT 997
            + GV+QGCPLS I+F + I+ V+ A +      + I      +LAYADD+AL+A   E +++++      A  +G  + P KC  + +    I G +L     I  + +  L   E Y++LGVP G   DQ+P   ++ V+ D   +  S L  WQ+++    FI  RL F  R   ++   L A              +  H+RRI    LNLP  +    +Y     GG   + L D     TI H FRL T++      +   SL+ V   R+G   P+ ++   +++G+ E +L  GG  +
Sbjct: 1070 RSGVRQGCPLSPIIFDLVIDSVVRAAAELTDVGYDILGQTFNILAYADDLALIARTPEGMRQLLTAVELEAGRVGLHFNPAKCASLHITTGRI-GRVLPTVFEIEGRPMPTLAEGEPYRHLGVPTGFSVDQTPLTTIEGVLKDIWAVDASLLAPWQRVEVLAAFILPRLDFLLRGAAVEKRPLRA--------------VDLHVRRIVKSWLNLPQRASAEVVYLPPSRGGCGLLPLSDLADVLTIAHAFRLLTASDAVVSGLAWGSLRGVVARRIG-HAPSDEEIASFLSGSLEGRLRGGGEAS 1358          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000034560.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000712.1:195631:202616:-1 gene:ENSAMXG00000042811.1 transcript:ENSAMXT00000034560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 4.055e-8
Identity = 59/258 (22.87%), Postives = 116/258 (44.96%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPR------------VNINGEI--LINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTS 850
            GVKQG  +S ILF++A++P+++++  +    + IG   V  LA+ADD+ L++++ + ++  + +  E     G   +  KC    + R             ++ GE   LI   E++K L  +   ++G+   + N Q     L + V+   +I  + L  +QK+     F   RL +     ++K + L+   G           +R  ++  L+LP ++    LY+  ++GG   + L     +      +RL  S
Sbjct:  627 GVKQGDSMSPILFNLAMDPLIQSLE-NLGSGYKIGGSSVTTLAFADDLVLLSSSWDGMRSNIALLDEFCERTGLRVQSRKCHGFLIRRGATSYTVNDCSPWDLGGEPIHLIEPHEVEKYLGVKVNPWVGITKPDLNSQ-----LGEWVT---RIGGAPLKPYQKVGLLNDFAIPRLIYLADHCDLKGVTLATLDGT----------IRRAVKGWLHLPLSTCGGLLYSRVQDGGLGILKLEALVPSIQARRLYRLLGS 865          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000048093.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000034.1:1232289:1236101:-1 gene:ENSAMXG00000042761.1 transcript:ENSAMXT00000048093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 8.586e-8
Identity = 50/181 (27.62%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  116 KGVKQGCPLSMILFSIAINPVLEAI-SRSCIEPFMIGDLPVQVLAYADDIAL-VANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQL-PRVNINGEILINEKEIKKLLSKEFYQYLGVPVGED----NDQSPYAILDKVVSDTK--KIADSGLFGWQKLKAYKIFIHSRLTFAFRTREI 631
            +G +QGCPLS +LF++A+ P+  AI S   I P  +G +  Q+  YADD+ L + +  +++  ++ +  +     G+     K  YM L    N+N   ++  K   K+      +YLG+ V  D     D +   I D + S+T+  ++    L G  ++ A K+ I  R  + F+   I
Sbjct:  656 RGTRQGCPLSPLLFALAMEPLALAIKSHPLITPVRLGGIEHQISLYADDVLLYLCDPEQSIPPLLKLIKDFGHLSGYTVNWAKSQYMPLYDSANLNFLNVLPFKVTDKI------KYLGITVPRDFKMIYDLNYKIIFDNLKSNTETWRVLPLSLMG--RINAIKMVILPRFLYLFQNLPI 828          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000033794.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001711.1:17851:20325:-1 gene:ENSAMXG00000033587.1 transcript:ENSAMXT00000033794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 2.469e-7
Identity = 62/251 (24.70%), Postives = 107/251 (42.63%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRS-CIEPFMIGDLPVQVLAYADDIALVANNVE-NLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDND----QSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREI----KTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFF 835
            ++G +QGCPLS  LF++ I P+ + I     I   +I +   ++  YADDI L     + +L KI+       T  G++    K    Q+   N N ++ +N+K+  K  +    +YLGV + +D      Q+   I  ++ SD  + +   +    ++   K+ I  RL F F++  +    K         +T   G    ++R    R L LP            +N G   V  L++Y+    V F 
Sbjct:  220 ERGCRQGCPLSPTLFTLFIEPLAQTIREDKNITGVIIKNTEYKICLYADDILLTLTKPQVSLPKILSQLKTFGTYSGYKLNLHKT---QILTFNYNPQVGVNKKQRFKWENSSI-KYLGVHIPKDLSAIYMQNYIPITAEIKSDLNRWSSLPMNMSNRIDVIKMNILPRLLFLFQSLPVEIPHKQFCEWKRMISTFIWGKQKPRIR---LRTLQLP------------KNQGGMAVPCLEDYYKAAQVRFL 451          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000050058.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:31150525:31154298:-1 gene:ENSAMXG00000036146.1 transcript:ENSAMXT00000050058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 7.772e-7
Identity = 46/179 (25.70%), Postives = 85/179 (47.49%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLS-------KEFYQYLGVPVGEDNDQSP----YAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAF 616
            ++G +QGCPLS  LF +++ P+ +AI +S I P  I      +  YADDI L  +N       +D +++   +I F+      GY    ++N +  +L+   ++ + +S       KE + YLG+ +  D  +S       +L K+  D ++     +    ++   K+ +  RL F F
Sbjct:  652 ERGTRQGCPLSPHLFCLSLEPLAQAIRQSSIYPINIHGHSNFISLYADDIVLYLDN-------LDTSIQLVMKI-FDTFNGMSGY----KINWSKSVLMPLNKLCQNVSIPSIIPVKESFAYLGIDIYPDIHKSARENYIGMLGKIKRDLERWNGLKVSLQGRIATIKMNVLPRLNFLF 818          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000033573.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:31407009:31410218:-1 gene:ENSAMXG00000030324.1 transcript:ENSAMXT00000033573.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 8.129e-7
Identity = 75/316 (23.73%), Postives = 125/316 (39.56%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEP-FMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLP--------RVNINGEIL--INEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYF 1033
            G+  GC +S+ILF +A+N ++++    C  P  M G     V A+ DD+ +   +V   + I+    E        ++PEK   + L         R +I G  +  ++EK +K  L KEF   L       +  S      ++ S  + +  SGL G  K KA+ I+ H  L        +  + +S  +G          K+   LRR L LP +  ++ LY            L +E+   T      ++  + D   KV    ++  TG +    E  LQ        AE+++ H        R R  +  F
Sbjct:  461 GIITGCTISVILFVLAMNMLVKSAETQCRGPKTMTGVRQPPVRAFMDDLTITTESVPGSRWILQGLEELCGWARMRFKPEKSRSLVLKRGKVVDKFRFSIGGASIPTVSEKPVKS-LGKEFNSSL------KDSVSVQGTCQELESWLRAVDRSGLPG--KFKAW-IYQHGILPRVLWPLLVYEVPISIVEGLER-------KVSSFLRRWLGLPRSLSSIALYGRNTKLQLPLRSLEEEFKV-TRAREVMMYRDSSDP--KVAQAGVRVKTGRKWVADEAVLQ--------AESRIRHRALVGAVTRGRAGLGTF 748          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000040101.1 (pep primary_assembly:ASM223467v1:2:25074395:25077787:1 gene:ENSORLG00000028428.1 transcript:ENSORLT00000040101.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 5.076e-9
Identity = 57/240 (23.75%), Postives = 99/240 (41.25%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNI--NGEILINEKEIKKLLSKEFYQYLGVPVGEDN--DQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFA----------FRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDL 796
            G+ QG  LS +LF I +NP+ + I+++     +     +  L Y DDI L A +  ++  ++      +T+IG  +  EKC  M   R  +   G + + E  I  +  ++ Y+YLG+P    N    +  A   K +   +++  S L G  K +A   +    + +            +TR++KT  L    G  +P                     S T+ LY S + GG   V +
Sbjct:  559 GIYQGDALSPLLFCIGLNPLSQIITKTGYGYRLRNGANISHLLYMDDIKLYAKSERDIDSLIHTTRIYSTDIGMSFGLEKCSRMVTKRGKVVHTGGVSLPEGTIADI--EDSYKYLGIPQANGNLEQATRKAATAKYLQRVRQVLRSQLNGKNKTRATNSYALPVIRYPAGLIRWPKEEIQTRDVKTRKLLTMHGGFHP--------------------KSSTLRLYASRKEGGRGLVSV 776          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000046414.1 (pep primary_assembly:ASM223467v1:2:12342601:12345296:-1 gene:ENSORLG00000027125.1 transcript:ENSORLT00000046414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 3.188e-8
Identity = 62/262 (23.66%), Postives = 106/262 (40.46%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNI--NGEILINEKEIKKLLSKEFYQYLGVPVGEDN--DQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFA---------FRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVD----LLDEYHTQTIVHFFRLFTSN 853
            G+ QG  LS +LF I +NP+ + I+++     +     +  L Y DDI L A +  ++  ++      +T+IG  +  EKC  M   R  +   G + + E  I  +  ++ Y+YLG+P    N    +  A   K +   +++  S L G  K +A   +    + +           +T ++KT  L    G  +P                     S T+ LY S + GG   V     + DE  T  I  + +L   N
Sbjct:  355 GIYQGDALSPLLFCIGLNPLSQIINKTGYGYRLRNGANISHLLYMDDIKLYAKSERDIDSLIHTTRIYSTDIGMSFGLEKCSRMVTKRGKVVHTGGVSLPEGTIADI--EDSYKYLGIPQANGNLEQATRKAATAKYLQRVRQVLRSQLNGKNKTRAINSYALPVIRYPAGIRWPKEEIQTTDVKTRKLLTMHGGFHP--------------------KSSTLRLYASRKEGGRGLVSVEATIQDE--TSKIHEYIKLKAPN 592          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000046874.1 (pep primary_assembly:ASM223467v1:7:16581403:16583898:1 gene:ENSORLG00000023007.1 transcript:ENSORLT00000046874.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 3.403e-8
Identity = 51/208 (24.52%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNI--NGEILINEKEIKKLLSKEFYQYLGVPVGEDN--DQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTF----------AFRTREIKTMALSASQGNTNPCGNNSSKLR 700
            G+ QG  LS +LF I +NP+   I+++     +     +  L Y DDI L A +  +++ ++      +T+IG  +  EKC  M   R  +    + ++ E  I  +  ++ Y+YLG+P    N    +  A   K +   +++  S L G  K +A   +    + +            +T ++KT  L    G  +P    SS LR
Sbjct:  284 GIHQGDALSPLLFCIGLNPLSRIITKTGYGYRLRNGANISHLLYMDDIKLYAKSERDIESLIHTTRIYSTDIGMSFGLEKCSRMVTKRGKVVHTEQAIVPEGTIADI--EDSYKYLGIPQANGNLEQATRKAATAKYLQRVRQVLRSQLNGKNKTRAINSYALPVIRYPAGIIRWPKEEIQTTDVKTRKLLTMHGGFHP---KSSTLR 486          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000029120.1 (pep primary_assembly:ASM223467v1:24:4506664:4509888:-1 gene:ENSORLG00000025841.1 transcript:ENSORLT00000029120.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 6.925e-8
Identity = 56/240 (23.33%), Postives = 98/240 (40.83%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNI--NGEILINEKEIKKLLSKEFYQYLGVPVGEDN--DQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFA----------FRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDL 796
            G+ QG  LS +LF I +NP+ + I+++     +     +  L Y DDI L A +  ++  ++      +T+IG  +  EKC  M   R  +   G + + E  I  +  ++ Y+YLG+P    N    +  A   K +   +++  S L G  K +A   +    + +            +T ++KT  L    G  +P                     S T+ LY S + GG   V +
Sbjct:  557 GIYQGDALSPLLFCIGLNPLSQIINKTGYGYRLRNGANISHLLYMDDIKLYAKSERDIDSLIHTTRIYSTDIGMSFGLEKCSRMVTKRGKVVHTGGVSLPEGTITDI--EDSYKYLGIPQANGNLEQATRKAATAKYLQRVRQVLRSQLNGKNKTRAINSYALPVIRYPAGIIRWPKEEIQTTDVKTRKLLTMHGGFHP--------------------KSSTLRLYASRKEGGRGLVSV 774          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000032933.1 (pep primary_assembly:ASM223467v1:21:15280052:15283490:1 gene:ENSORLG00000023528.1 transcript:ENSORLT00000032933.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 7.131e-8
Identity = 55/240 (22.92%), Postives = 97/240 (40.42%), Query Frame = 2
Query:  119 GVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNI--NGEILINEKEIKKLLSKEFYQYLGVPVGEDN--DQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFA----------FRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDL 796
            G+ QG  LS +LF I +NP+ + I+++     +     +  L Y DDI L A +  ++  ++      +T+IG  +  EKC  M   R  +   G + + E     +  ++ Y+YLG+P    N    +  A   K +   +++  S L G  K +A   +    + +            +T ++KT  L    G  +P                     S T+ LY S + GG   V +
Sbjct:  303 GIYQGDALSPLLFCIGLNPLSQIITKTGYGYRLRNGANISHLLYMDDIKLYAKSERDIDSLIHTTRIYSTDIGMSFGLEKCSRMVTKRGKVVHTGGVSLPEGTTADI--EDSYKYLGIPQANGNLEQATRKAATAKYLQRVRQVLKSQLNGKNKTRAINSYALPVIRYPAGIIRWPKEEIQTTDVKTRKLLTMHGGFHP--------------------KSSTLRLYASRKEGGQGLVSV 520          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 494.582 bits (1272), Expect = 0.000e+0
Identity = 231/323 (71.52%), Postives = 275/323 (85.14%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKEQ 1081
            ++GVKQGCP+SMILF++AINPVLEA+SRS  EPFMIG+ PV++LAYADDIAL+A +VE+LQKI ++AV  A EIGFEYRPEKCGY+QLP+V+I+ EILIN  +IKKLLSKEFYQYLGVPVGE+ DQSPY ILDK VSDT+K+A+S L GWQKLKAYKIF+HSRL F FRTREIKT ALS S GN N   N SS+LRG  R++L LP+ SE  Y YN+TE GGA+CVDLLDEYHTQTI HFFRL TS CDY+R++NIDSLKFVTGPRLGIK P+LQ+S DW NG E+K +H GRKTRFQRAR ++ +F++ H+ISVSF IVK+ 
Sbjct: 3259 KQGVKQGCPISMILFALAINPVLEAVSRSDCEPFMIGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLGIKTPSLQESLDWFNGKESKPHHSGRKTRFQRARIAVAFFEKTHNISVSF-IVKDH 3580          

HSP 2 Score: 494.582 bits (1272), Expect = 0.000e+0
Identity = 231/323 (71.52%), Postives = 275/323 (85.14%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKEQ 1081
            ++GVKQGCP+SMILF++AINPVLEA+SRS  EPFMIG+ PV++LAYADDIAL+A +VE+LQKI ++AV  A EIGFEYRPEKCGY+QLP+V+I+ EILIN  +IKKLLSKEFYQYLGVPVGE+ DQSPY ILDK VSDT+K+A+S L GWQKLKAYKIF+HSRL F FRTREIKT ALS S GN N   N SS+LRG  R++L LP+ SE  Y YN+TE GGA+CVDLLDEYHTQTI HFFRL TS CDY+R++NIDSLKFVTGPRLGIK P+LQ+S DW NG E+K +H GRKTRFQRAR ++ +F++ H+ISVSF IVK+ 
Sbjct: 5615 KQGVKQGCPISMILFALAINPVLEAVSRSDCEPFMIGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLGIKTPSLQESLDWFNGKESKPHHSGRKTRFQRARIAVAFFEKTHNISVSF-IVKDH 5936          

HSP 3 Score: 167.933 bits (424), Expect = 0.000e+0
Identity = 81/124 (65.32%), Postives = 95/124 (76.61%), Query Frame = 1
Query: 1087 LYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            LY+ T   GT ILT+  RK  SK+ H AL DSY+ KW+ S  S+ IA+A+KLSP+INKAIF+S+L EFAWNFIHRARTNTL+I AK + KGD RLCR C  EDETMSHA+QSCKVH  L  ERH
Sbjct: 3584 LYITTAMRGTIILTSDLRKTTSKVLHMALCDSYLSKWEKSCVSNFIASAVKLSPKINKAIFRSELSEFAWNFIHRARTNTLSIFAKHHNKGDKRLCRLCHAEDETMSHAIQSCKVHLTLGAERH 3707          

HSP 4 Score: 167.933 bits (424), Expect = 0.000e+0
Identity = 81/124 (65.32%), Postives = 95/124 (76.61%), Query Frame = 1
Query: 1087 LYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            LY+ T   GT ILT+  RK  SK+ H AL DSY+ KW+ S  S+ IA+A+KLSP+INKAIF+S+L EFAWNFIHRARTNTL+I AK + KGD RLCR C  EDETMSHA+QSCKVH  L  ERH
Sbjct: 5940 LYITTAMRGTIILTSDLRKTTSKVLHMALCDSYLSKWEKSCVSNFIASAVKLSPKINKAIFRSELSEFAWNFIHRARTNTLSIFAKHHNKGDKRLCRLCHAEDETMSHAIQSCKVHLTLGAERH 6063          

HSP 5 Score: 58.5362 bits (140), Expect = 0.000e+0
Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            L+ IGV E+F +I++LLY+DT +FYSCGPI+TPN+ IK+
Sbjct: 3222 LRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQ 3260          

HSP 6 Score: 58.5362 bits (140), Expect = 0.000e+0
Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            L+ IGV E+F +I++LLY+DT +FYSCGPI+TPN+ IK+
Sbjct: 5578 LRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQ 5616          

HSP 7 Score: 454.907 bits (1169), Expect = 3.077e-174
Identity = 217/322 (67.39%), Postives = 252/322 (78.26%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKE 1078
            +KGVKQGCP+SMILF+IAINPVLEAIS S   PFMIG   VQVLAYADDIAL+A N  +LQ + D+AV  A  IGFEYRPEKC Y+Q P+V    EI++N   IKKL S EFYQYLGVP+G++NDQSPY I+ KV+ DTKKIA S L+GWQKLKAYKIF+HSRL F FRTREIKT +L+    N+    NN+S+LRGHLR+ILNLP++SE  Y YNSTENGGA C+DLLDEYH QTIV+FFRL TS C YS+ +N  SL  VT PRLGIK PTL QSF+WING E+KLNH GRKTRF R RTSI YF R H+I + F I K+
Sbjct:  940 KKGVKQGCPISMILFAIAINPVLEAISLSNTTPFMIGTSSVQVLAYADDIALIATNSSDLQTLFDLAVNTANMIGFEYRPEKCAYIQYPKVETVSEIIVNNVLIKKLASNEFYQYLGVPIGDNNDQSPYEIVSKVIEDTKKIAHSNLYGWQKLKAYKIFLHSRLIFPFRTREIKTSSLADPSRNSRINVNNTSQLRGHLRKILNLPNHSEISYFYNSTENGGAGCIDLLDEYHAQTIVYFFRLLTSTCGYSKTINTFSLLSVTSPRLGIKNPTLSQSFEWINGKESKLNHSGRKTRFHRLRTSIEYFSRVHNIKLLFEIFKQ 1261          

HSP 8 Score: 148.673 bits (374), Expect = 3.077e-174
Identity = 67/122 (54.92%), Postives = 90/122 (73.77%), Query Frame = 1
Query: 1093 LITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            + T   GT I+  K RK +SKI HSAL DSY+ KW++SN S+++ +AIKL P +NK IF+S L +F W FIHRARTNTL+  AKP++ G+ RLCRRC+ EDET+ H LQ+CK+++ L   RH
Sbjct: 1267 ITTSLTGTRIILPKLRKTLSKILHSALQDSYLSKWEMSNHSNLLVSAIKLCPLVNKLIFRSDLTDFEWKFIHRARTNTLSTFAKPHKAGEDRLCRRCKSEDETILHVLQTCKINQSLATNRH 1388          

HSP 9 Score: 50.8322 bits (120), Expect = 3.077e-174
Identity = 22/39 (56.41%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            LK + VS EF+ I++LLYTDT SFY C  + TP++ IKK
Sbjct:  903 LKHMNVSAEFVNILQLLYTDTSSFYQCNQMQTPDIPIKK 941          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 494.197 bits (1271), Expect = 0.000e+0
Identity = 231/323 (71.52%), Postives = 275/323 (85.14%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKEQ 1081
            ++GVKQGCP+SMILF++AINPVLEA+SRS  EPFMIG+ PV++LAYADDIAL+A +VE+LQKI ++AV  A EIGFEYRPEKCGY+QLP+V+I+ EILIN  +IKKLLSKEFYQYLGVPVGE+ DQSPY ILDK VSDT+K+A+S L GWQKLKAYKIF+HSRL F FRTREIKT ALS S GN N   N SS+LRG  R++L LP+ SE  Y YN+TE GGA+CVDLLDEYHTQTI HFFRL TS CDY+R++NIDSLKFVTGPRLGIK P+LQ+S DW NG E+K +H GRKTRFQRAR ++ +F++ H+ISVSF IVK+ 
Sbjct: 3230 KQGVKQGCPISMILFALAINPVLEAVSRSDCEPFMIGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLGIKTPSLQESLDWFNGKESKPHHSGRKTRFQRARIAVAFFEKTHNISVSF-IVKDH 3551          

HSP 2 Score: 494.197 bits (1271), Expect = 0.000e+0
Identity = 231/323 (71.52%), Postives = 275/323 (85.14%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKEQ 1081
            ++GVKQGCP+SMILF++AINPVLEA+SRS  EPFMIG+ PV++LAYADDIAL+A +VE+LQKI ++AV  A EIGFEYRPEKCGY+QLP+V+I+ EILIN  +IKKLLSKEFYQYLGVPVGE+ DQSPY ILDK VSDT+K+A+S L GWQKLKAYKIF+HSRL F FRTREIKT ALS S GN N   N SS+LRG  R++L LP+ SE  Y YN+TE GGA+CVDLLDEYHTQTI HFFRL TS CDY+R++NIDSLKFVTGPRLGIK P+LQ+S DW NG E+K +H GRKTRFQRAR ++ +F++ H+ISVSF IVK+ 
Sbjct: 5557 KQGVKQGCPISMILFALAINPVLEAVSRSDCEPFMIGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLGIKTPSLQESLDWFNGKESKPHHSGRKTRFQRARIAVAFFEKTHNISVSF-IVKDH 5878          

HSP 3 Score: 167.933 bits (424), Expect = 0.000e+0
Identity = 81/124 (65.32%), Postives = 95/124 (76.61%), Query Frame = 1
Query: 1087 LYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            LY+ T   GT ILT+  RK  SK+ H AL DSY+ KW+ S  S+ IA+A+KLSP+INKAIF+S+L EFAWNFIHRARTNTL+I AK + KGD RLCR C  EDETMSHA+QSCKVH  L  ERH
Sbjct: 3555 LYITTAMRGTIILTSDLRKTTSKVLHMALCDSYLSKWEKSCVSNFIASAVKLSPKINKAIFRSELSEFAWNFIHRARTNTLSIFAKHHNKGDKRLCRLCHAEDETMSHAIQSCKVHLTLGAERH 3678          

HSP 4 Score: 167.933 bits (424), Expect = 0.000e+0
Identity = 81/124 (65.32%), Postives = 95/124 (76.61%), Query Frame = 1
Query: 1087 LYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            LY+ T   GT ILT+  RK  SK+ H AL DSY+ KW+ S  S+ IA+A+KLSP+INKAIF+S+L EFAWNFIHRARTNTL+I AK + KGD RLCR C  EDETMSHA+QSCKVH  L  ERH
Sbjct: 5882 LYITTAMRGTIILTSDLRKTTSKVLHMALCDSYLSKWEKSCVSNFIASAVKLSPKINKAIFRSELSEFAWNFIHRARTNTLSIFAKHHNKGDKRLCRLCHAEDETMSHAIQSCKVHLTLGAERH 6005          

HSP 5 Score: 58.151 bits (139), Expect = 0.000e+0
Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            L+ IGV E+F +I++LLY+DT +FYSCGPI+TPN+ IK+
Sbjct: 3193 LRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQ 3231          

HSP 6 Score: 58.151 bits (139), Expect = 0.000e+0
Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            L+ IGV E+F +I++LLY+DT +FYSCGPI+TPN+ IK+
Sbjct: 5520 LRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQ 5558          

HSP 7 Score: 454.521 bits (1168), Expect = 4.623e-174
Identity = 217/322 (67.39%), Postives = 252/322 (78.26%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKE 1078
            +KGVKQGCP+SMILF+IAINPVLEAIS S   PFMIG   VQVLAYADDIAL+A N  +LQ + D+AV  A  IGFEYRPEKC Y+Q P+V    EI++N   IKKL S EFYQYLGVP+G++NDQSPY I+ KV+ DTKKIA S L+GWQKLKAYKIF+HSRL F FRTREIKT +L+    N+    NN+S+LRGHLR+ILNLP++SE  Y YNSTENGGA C+DLLDEYH QTIV+FFRL TS C YS+ +N  SL  VT PRLGIK PTL QSF+WING E+KLNH GRKTRF R RTSI YF R H+I + F I K+
Sbjct:  940 KKGVKQGCPISMILFAIAINPVLEAISLSNTTPFMIGTSSVQVLAYADDIALIATNSSDLQTLFDLAVNTANMIGFEYRPEKCAYIQYPKVETVSEIIVNNVLIKKLASNEFYQYLGVPIGDNNDQSPYEIVSKVIEDTKKIAHSNLYGWQKLKAYKIFLHSRLIFPFRTREIKTSSLADPSRNSRINVNNTSQLRGHLRKILNLPNHSEISYFYNSTENGGAGCIDLLDEYHAQTIVYFFRLLTSTCGYSKTINTFSLLSVTSPRLGIKNPTLSQSFEWINGKESKLNHSGRKTRFHRLRTSIEYFSRVHNIKLLFEIFKQ 1261          

HSP 8 Score: 148.673 bits (374), Expect = 4.623e-174
Identity = 67/122 (54.92%), Postives = 90/122 (73.77%), Query Frame = 1
Query: 1093 LITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            + T   GT I+  K RK +SKI HSAL DSY+ KW++SN S+++ +AIKL P +NK IF+S L +F W FIHRARTNTL+  AKP++ G+ RLCRRC+ EDET+ H LQ+CK+++ L   RH
Sbjct: 1267 ITTSLTGTRIILPKLRKTLSKILHSALQDSYLSKWEMSNHSNLLVSAIKLCPLVNKLIFRSDLTDFEWKFIHRARTNTLSTFAKPHKAGEDRLCRRCKSEDETILHVLQTCKINQSLATNRH 1388          

HSP 9 Score: 50.8322 bits (120), Expect = 4.623e-174
Identity = 22/39 (56.41%), Postives = 29/39 (74.36%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            LK + VS EF+ I++LLYTDT SFY C  + TP++ IKK
Sbjct:  903 LKHMNVSAEFVNILQLLYTDTSSFYQCNQMQTPDIPIKK 941          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000046455.1 (SMESG000046455.1)

HSP 1 Score: 464.151 bits (1193), Expect = 0.000e+0
Identity = 214/317 (67.51%), Postives = 263/317 (82.97%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSF 1063
            ++GVKQGCP+SMILF++AINPVLEA+SRS  EPFMIG+  V+VLAYADDIALV+ +  +LQ++ ++AV  A+EIGFEYRPEKCGY++LP +    +ILIN+ +IK+L S EFYQYLGVPVGE+ DQSPY IL KVVSDT+KIADS L GWQKLKAYKIF+HSRL F FRTREIKT AL+ S  N N   N +S+LR   R++++LP++SE  Y YNSTENGGA+CVDLLDEYHTQTI +FFRLFTSNC+++RKVN+DSL FV GPRLGI  PTLQ++FDWING E K  H G+KTRFQRAR +I +FK+EH I++ F
Sbjct: 1747 RQGVKQGCPISMILFALAINPVLEAVSRSKCEPFMIGESAVKVLAYADDIALVSKSAYDLQRVTNIAVVIASEIGFEYRPEKCGYIELPLIETESQILINDIKIKRLASSEFYQYLGVPVGEETDQSPYDILKKVVSDTRKIADSDLLGWQKLKAYKIFLHSRLVFPFRTREIKTSALAKSNANNNLTVNITSQLRNCFRKMMSLPNHSEVCYFYNSTENGGANCVDLLDEYHTQTITYFFRLFTSNCEFARKVNLDSLNFVAGPRLGIINPTLQETFDWINGKEPKPRHSGKKTRFQRARIAIAFFKKEHDINIMF 2063          

HSP 2 Score: 163.696 bits (413), Expect = 0.000e+0
Identity = 75/124 (60.48%), Postives = 94/124 (75.81%), Query Frame = 1
Query: 1087 LYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            L++ ++  GTFILT   RK  SK+ H AL DSY+ KW+    S+ IA+AIKLSP+INKAI++  + EFAW+FIHRARTNTL+INAKP+ KG+ RLCR C  EDETMSH +QSCK+H  L  ERH
Sbjct: 2072 LFITSEKGGTFILTPDLRKTTSKVLHMALCDSYLSKWEKGCTSNFIASAIKLSPKINKAIYRGDISEFAWHFIHRARTNTLSINAKPHNKGNKRLCRLCHTEDETMSHIIQSCKIHLTLGSERH 2195          

HSP 3 Score: 59.3066 bits (142), Expect = 0.000e+0
Identity = 22/39 (56.41%), Postives = 35/39 (89.74%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            L+ +GV EEF+TI++ +Y+DT +FYSCGPI+TPN++I++
Sbjct: 1710 LRFVGVDEEFVTILERMYSDTSTFYSCGPILTPNIAIRQ 1748          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000046455.1 (SMESG000046455.1)

HSP 1 Score: 464.151 bits (1193), Expect = 0.000e+0
Identity = 214/317 (67.51%), Postives = 263/317 (82.97%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSF 1063
            ++GVKQGCP+SMILF++AINPVLEA+SRS  EPFMIG+  V+VLAYADDIALV+ +  +LQ++ ++AV  A+EIGFEYRPEKCGY++LP +    +ILIN+ +IK+L S EFYQYLGVPVGE+ DQSPY IL KVVSDT+KIADS L GWQKLKAYKIF+HSRL F FRTREIKT AL+ S  N N   N +S+LR   R++++LP++SE  Y YNSTENGGA+CVDLLDEYHTQTI +FFRLFTSNC+++RKVN+DSL FV GPRLGI  PTLQ++FDWING E K  H G+KTRFQRAR +I +FK+EH I++ F
Sbjct: 1690 RQGVKQGCPISMILFALAINPVLEAVSRSKCEPFMIGESAVKVLAYADDIALVSKSAYDLQRVTNIAVVIASEIGFEYRPEKCGYIELPLIETESQILINDIKIKRLASSEFYQYLGVPVGEETDQSPYDILKKVVSDTRKIADSDLLGWQKLKAYKIFLHSRLVFPFRTREIKTSALAKSNANNNLTVNITSQLRNCFRKMMSLPNHSEVCYFYNSTENGGANCVDLLDEYHTQTITYFFRLFTSNCEFARKVNLDSLNFVAGPRLGIINPTLQETFDWINGKEPKPRHSGKKTRFQRARIAIAFFKKEHDINIMF 2006          

HSP 2 Score: 163.696 bits (413), Expect = 0.000e+0
Identity = 75/124 (60.48%), Postives = 94/124 (75.81%), Query Frame = 1
Query: 1087 LYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            L++ ++  GTFILT   RK  SK+ H AL DSY+ KW+    S+ IA+AIKLSP+INKAI++  + EFAW+FIHRARTNTL+INAKP+ KG+ RLCR C  EDETMSH +QSCK+H  L  ERH
Sbjct: 2015 LFITSEKGGTFILTPDLRKTTSKVLHMALCDSYLSKWEKGCTSNFIASAIKLSPKINKAIYRGDISEFAWHFIHRARTNTLSINAKPHNKGNKRLCRLCHTEDETMSHIIQSCKIHLTLGSERH 2138          

HSP 3 Score: 59.3066 bits (142), Expect = 0.000e+0
Identity = 22/39 (56.41%), Postives = 35/39 (89.74%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            L+ +GV EEF+TI++ +Y+DT +FYSCGPI+TPN++I++
Sbjct: 1653 LRFVGVDEEFVTILERMYSDTSTFYSCGPILTPNIAIRQ 1691          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000010825.1 (SMESG000010825.1)

HSP 1 Score: 489.574 bits (1259), Expect = 1.134e-161
Identity = 249/323 (77.09%), Postives = 256/323 (79.26%), Query Frame = 2
Query:  113 QKGVKQGCPLSMILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQKIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKEFYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREHSISVSFHIVKEQ 1081
            +KGVK  CPLSMILFSIAINPVLEAISRSCIEPFMIGD PVQVLAYAD                D+A+ A                             N   ++K L            GEDNDQSPYAILDKVVSDT KIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTN CGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIK+PTLQQSFDWINGAETKLNHGG+KTRFQRARTSIIYFKREHSISVSFHIVKEQ
Sbjct:  611 KKGVKLRCPLSMILFSIAINPVLEAISRSCIEPFMIGDSPVQVLAYAD----------------DIALVAN----------------------------NVDNLQKKL------------GEDNDQSPYAILDKVVSDTNKIADSGLFGWQKLKAYKIFIHSRLTFAFRTREIKTMALSASQGNTNSCGNNSSKLRGHLRRILNLPHNSETVYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKFVTGPRLGIKDPTLQQSFDWINGAETKLNHGGKKTRFQRARTSIIYFKREHSISVSFHIVKEQ 877          

HSP 2 Score: 128.257 bits (321), Expect = 3.423e-31
Identity = 70/139 (50.36%), Postives = 87/139 (62.59%), Query Frame = 1
Query: 1042 TLNFRIFSYC*RASFLYLITKSHGTFILTTKFRKAISKIFHSALYDSYMQKWQLSNKSDMIAAAIKLSPQINKAIFKSKLGEFAWNFIHRARTNTLNINAKPNRKGDSRLCRRCEKEDETMSHALQSCKVHKILTLERH 1458
            T++F +         L L T   GT ILT    + +SK+ H ALYDSY  KW+ SN S+  ++   LSP IN+AIFK +L E  W FIHRARTNTL   AKP  KG++RLCRRC  + ET+ H LQ+CKVH  L L RH
Sbjct:  975 TISFEVLD---DKPILRLTTVLKGTIILTEFDCRLVSKVLHLALYDSYFTKWKNSNISN--SSTFYLSPNINRAIFKGELREDHWKFIHRARTNTLVNFAKPYIKGENRLCRRCHIQGETLPHVLQNCKVHLTLALNRH 1108          

HSP 3 Score: 76.2554 bits (186), Expect = 2.612e-14
Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 3
Query:    3 LKTIGVSEEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 119
            LK IGVS EFITIVKLLYTDTQSFYSCGPIVTPNLSIKK
Sbjct:  574 LKNIGVSGEFITIVKLLYTDTQSFYSCGPIVTPNLSIKK 612          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CABZ01033394.13.530e-927.63pep chromosome:GRCz11:13:6032844:6038477:-1 gene:E... [more]
BX547930.49.184e-927.08pep chromosome:GRCz11:20:12830448:12834749:1 gene:... [more]
BX649434.32.079e-625.21pep chromosome:GRCz11:3:18270043:18274691:-1 gene:... [more]
BX470182.17.203e-632.26pep chromosome:GRCz11:16:40217043:40220920:1 gene:... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc7a11.233e-839.19solute carrier family 7 (cationic amino acid trans... [more]
ENSXETT00000024583.14.370e-725.42pep primary_assembly:Xenopus_tropicalis_v9.1:2:942... [more]
ENSXETT00000020113.15.063e-623.03pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
txlna5.117e-628.66taxilin alpha [Source:Xenbase;Acc:XB-GENE-992926][more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q03278|PO21_NASVI4.037e-1124.45Retrovirus-related Pol polyprotein from type-1 ret... [more]
sp|Q03279|PO21_BRACO7.060e-926.75Retrovirus-related Pol polyprotein from type-1 ret... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L8D7E44.366e-2829.18Reverse transcriptase domain-containing protein OS... [more]
A0A0C9Q0T73.827e-2728.80Pol_5 protein (Fragment) OS=Fopius arisanus OX=648... [more]
A0A183CIN36.010e-2731.36Reverse transcriptase domain-containing protein OS... [more]
A0A3L8D8E53.805e-2629.18Reverse transcriptase domain-containing protein OS... [more]
A0A3L8DAI74.599e-2629.18Reverse transcriptase domain-containing protein OS... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034560.14.055e-822.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048093.18.586e-827.62pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033794.12.469e-724.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050058.17.772e-725.70pep primary_assembly:Astyanax_mexicanus-2.0:15:311... [more]
ENSAMXT00000033573.18.129e-723.73pep primary_assembly:Astyanax_mexicanus-2.0:3:3140... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040101.15.076e-923.75pep primary_assembly:ASM223467v1:2:25074395:250777... [more]
ENSORLT00000046414.13.188e-823.66pep primary_assembly:ASM223467v1:2:12342601:123452... [more]
ENSORLT00000046874.13.403e-824.52pep primary_assembly:ASM223467v1:7:16581403:165838... [more]
ENSORLT00000029120.16.925e-823.33pep primary_assembly:ASM223467v1:24:4506664:450988... [more]
ENSORLT00000032933.17.131e-822.92pep primary_assembly:ASM223467v1:21:15280052:15283... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021486.13.077e-17471.52SMESG000021486.1[more]
SMESG000021486.14.623e-17471.52SMESG000021486.1[more]
SMESG000046455.10.000e+067.51SMESG000046455.1[more]
SMESG000046455.10.000e+067.51SMESG000046455.1[more]
SMESG000010825.11.134e-16177.09SMESG000010825.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027708 ID=SMED30027708|Name=Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2|organism=Schmidtea mediterranea sexual|type=transcript|length=1459bp
TTCTGAAAACTATTGGCGTTAGCGAAGAATTTATTACTATTGTCAAATTA
CTTTACACCGACACTCAATCTTTCTACAGCTGTGGCCCAATTGTAACACC
TAATCTTTCAATCAAAAAGGAGTTAAACAAGGATGTCCTCTTTCAATGAT
TCTTTTCTCGATTGCCATTAATCCTGTTCTTGAAGCAATAAGTAGATCAT
GTATTGAACCATTTATGATTGGTGATTTGCCCGTTCAAGTTCTAGCTTAT
GCAGATGACATTGCACTTGTTGCAAACAATGTCGAGAACCTTCAAAAAAT
TGTTGATGTTGCTGTTGAAGCTGCTACAGAAATAGGATTTGAATACCGAC
CGGAGAAGTGTGGCTACATGCAGCTTCCCAGAGTTAACATCAATGGTGAG
ATCTTGATAAATGAAAAGGAGATCAAAAAATTGTTGTCAAAAGAATTTTA
TCAATATCTTGGTGTTCCAGTAGGTGAGGACAATGATCAAAGTCCCTATG
CAATTCTTGATAAAGTTGTTAGTGACACAAAAAAAATTGCAGATTCCGGT
TTATTTGGTTGGCAAAAACTCAAGGCCTACAAGATTTTTATTCATTCTCG
ACTAACATTTGCATTCCGAACACGTGAAATTAAAACTATGGCTTTATCAG
CTTCTCAAGGAAATACTAATCCCTGTGGCAATAACTCAAGTAAATTGCGT
GGCCATCTGAGAAGAATTTTGAACTTGCCGCACAATTCTGAGACAGTTTA
TTTATACAACTCAACTGAAAATGGTGGAGCTTCGTGTGTCGATTTGCTTG
ATGAATATCATACTCAAACAATTGTGCACTTTTTCCGACTCTTTACTTCC
AATTGCGATTACTCGAGAAAAGTTAATATTGACTCTCTAAAGTTTGTAAC
GGGTCCTCGTCTTGGAATCAAAGAGCCTACATTACAACAAAGTTTTGATT
GGATTAATGGTGCTGAAACTAAATTGAATCATGGTGGAAGGAAAACGAGA
TTTCAACGTGCACGTACTTCAATAATTTACTTTAAAAGAGAACACTCAAT
TTCCGTATCTTTTCATATTGTTAAAGAGCAAGTTTTTTATATCTGATAAC
AAAGAGTCATGGAACTTTCATACTTACGACTAAGTTTCGAAAAGCAATTT
CTAAGATATTTCACTCTGCATTGTACGACTCATATATGCAAAAGTGGCAA
CTGAGTAATAAAAGCGACATGATTGCAGCGGCTATAAAATTATCTCCTCA
AATAAATAAAGCAATTTTTAAAAGTAAACTTGGCGAATTTGCATGGAACT
TTATACATCGAGCGCGAACTAATACACTTAACATCAATGCAAAGCCTAAT
AGAAAAGGGGATTCTAGACTTTGTAGACGTTGTGAGAAAGAGGATGAAAC
TATGTCTCATGCCTTACAGTCATGTAAGGTTCACAAAATACTGACATTAG
AGAGACACA
back to top

protein sequence of SMED30027708-orf-1

>SMED30027708-orf-1 ID=SMED30027708-orf-1|Name=SMED30027708-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
MILFSIAINPVLEAISRSCIEPFMIGDLPVQVLAYADDIALVANNVENLQ
KIVDVAVEAATEIGFEYRPEKCGYMQLPRVNINGEILINEKEIKKLLSKE
FYQYLGVPVGEDNDQSPYAILDKVVSDTKKIADSGLFGWQKLKAYKIFIH
SRLTFAFRTREIKTMALSASQGNTNPCGNNSSKLRGHLRRILNLPHNSET
VYLYNSTENGGASCVDLLDEYHTQTIVHFFRLFTSNCDYSRKVNIDSLKF
VTGPRLGIKEPTLQQSFDWINGAETKLNHGGRKTRFQRARTSIIYFKREH
SISVSFHIVKEQVFYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008234cysteine-type peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis