Protocadherin gamma-A1

Overview
NameProtocadherin gamma-A1
Smed IDSMED30027704
Length (bp)2330
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin gamma-A1 (SMED30027704) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin gamma-A1 (SMED30027704) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin gamma-A1 (SMED30027704) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin gamma-A1 (SMED30027704) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027704

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027704SMESG000030992.1 SmedASXL_012684SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027704SMESG000030992.1 dd_Smed_v6_19826_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin gamma-A1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 166.007 bits (419), Expect = 1.133e-41
Identity = 173/717 (24.13%), Postives = 303/717 (42.26%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI---------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVI-KFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF------SSHILL 2029
            V + + E  PP+  +G L        Y      HL ++E  +  P   +D  +G + +T   IDRE +                            P++    +   D+NDN P F      + IPEN  I     +  A+D D+   G+ +Y+L    +      L         QP+L ++  LD E+ + Y+L ++V D GS    S   L + ++D ND APKF + +Y   ++E   +G  +++V A D+++G   +I Y    + E   R +R+D  TG I +  P+    L  +  ++ A+D G+ PK A  ++++ + D+NDN P I+               I E+      +A+V+V D+D G N  V+C +    P + ++        + K++ +  T + Y+K  D  +    +   D+G+P               N+  P F          E  K   VI +   +DAD+ S  E     +      G F    I  + G++ +   +DRE+  R    + ++     + +   +++VL+ V+D NDN P+ ++   NF V+EN    S +G + + D D+  NAQ  +S  +             DF + N  G I S++  D E+                           Y  Q+ A D G+P ++ Y  +TIN+ +  +DN+ +      +SH LL
Sbjct:   60 VVYKVPEEQPPNTLIGSLAA-----DYGFPDVGHLYKLEVGA--PYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIE---IVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLF---TISPETGEIQVKTSLDREQ--RESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNG----------DFVIQNGTGTILSSLSFDREQQS------------------------TYTFQLKAVDGGVPPRSAYVGVTINV-LDENDNAPYITAPSNTSHKLL 726          

HSP 2 Score: 92.0485 bits (227), Expect = 2.291e-18
Identity = 107/467 (22.91%), Postives = 190/467 (40.69%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDRE-------AICPKISGTN---------LPCIDVNDNQPKFQ--------HNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-------LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEY-------------PPYFDSQFYSA---TTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDR 1480
            L  +D+ +G+I+    +DRE       ++  K  GTN         +   D+NDN P  +        H   +  I E+      + L + +D D  +        + + D+PF L  +         KY       LD+EKV+ Y + +   D+G+  L S   L ++++D+ND AP F Q    V   E  K G +I ++ A D + G   +++Y L +          I  +TGEI +   L     E   + + A D GS        +L++++D NDN P+         + EN P    + +V V D D+G N +V   +       + + ++    G      +++++S+D+E  +   ++ L   D G P  + Y              PY  +   ++    T +    E V + A  D D+    E   +   G  + +  I   +G + L   I+R
Sbjct:  329 LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA--VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSL-EPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQ----DNGDFVIQNGTG-----TILSSLSFDREQQS-TYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIER 782          
BLAST of Protocadherin gamma-A1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 164.851 bits (416), Expect = 2.936e-41
Identity = 173/717 (24.13%), Postives = 303/717 (42.26%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI---------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVI-KFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF------SSHILL 2029
            V + + E  PP+  +G L        Y      HL ++E  +  P   +D  +G + +T   IDRE +                            P++    +   D+NDN P F      + IPEN  I     +  A+D D+   G+ +Y+L    +      L         QP+L ++  LD E+ + Y+L ++V D GS    S   L + ++D ND APKF + +Y   ++E   +G  +++V A D+++G   +I Y    + E   R +R+D  TG I +  P+    L  +  ++ A+D G+ PK A  ++++ + D+NDN P I+               I E+      +A+V+V D+D G N  V+C +    P + ++        + K++ +  T + Y+K  D  +    +   D+G+P               N+  P F          E  K   VI +   +DAD+ S  E     +      G F    I  + G++ +   +DRE+  R    + ++     + +   +++VL+ V+D NDN P+ ++   NF V+EN    S +G + + D D+  NAQ  +S  +             DF + N  G I S++  D E+                           Y  Q+ A D G+P ++ Y  +TIN+ +  +DN+ +      +SH LL
Sbjct:   60 VVYKVPEEQPPNTLIGSLAA-----DYGFPDVGHLYKLEVGA--PYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIE---IVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLF---TISPETGEIQVKTSLDREQ--RESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNG----------DFVIQNGTGTILSSLSFDREQQS------------------------TYTFQLKAVDGGVPPRSAYVGVTINV-LDENDNAPYITAPSNTSHKLL 726          

HSP 2 Score: 91.2781 bits (225), Expect = 3.895e-18
Identity = 107/467 (22.91%), Postives = 190/467 (40.69%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDRE-------AICPKISGTN---------LPCIDVNDNQPKFQ--------HNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-------LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEY-------------PPYFDSQFYSA---TTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDR 1480
            L  +D+ +G+I+    +DRE       ++  K  GTN         +   D+NDN P  +        H   +  I E+      + L + +D D  +        + + D+PF L  +         KY       LD+EKV+ Y + +   D+G+  L S   L ++++D+ND AP F Q    V   E  K G +I ++ A D + G   +++Y L +          I  +TGEI +   L     E   + + A D GS        +L++++D NDN P+         + EN P    + +V V D D+G N +V   +       + + ++    G      +++++S+D+E  +   ++ L   D G P  + Y              PY  +   ++    T +    E V + A  D D+    E   +   G  + +  I   +G + L   I+R
Sbjct:  329 LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA--VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSL-EPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQ----DNGDFVIQNGTG-----TILSSLSFDREQQS-TYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIER 782          
BLAST of Protocadherin gamma-A1 vs. Ensembl Human
Match: PCDHGA11 (protocadherin gamma subfamily A, 11 [Source:HGNC Symbol;Acc:HGNC:8698])

HSP 1 Score: 161.384 bits (407), Expect = 2.233e-40
Identity = 183/710 (25.77%), Postives = 296/710 (41.69%), Query Frame = 2
Query:  227 QIEYQSEKPLFVIDQYSGVISTSAEIDREAICP-----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTL---ISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEII--DINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADAD----ATSTNEFQINGTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-------GRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQ---VSAQDQGLPSKTNYSNLTINI---------------HMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR 2119
            +I  + +  LF ++  SG + T+  IDRE +C                  KI G  +  ID+NDN P FQ ++  I++ E+        L  A D D     + +Y+L  +      L         P+L L   LD EK   + L+L   D G    K  + I ++  D+ND  P F Q  Y V V E +  G+ +L V+A D ++G  G+++Y   +     S   ++DS+TGE+  ++  L  EK     + I+ QD G +  F  T +LI ++DVNDN PEI        I EN P   ++A++ V+D+D G NG+VSC + +  P K ++   N       +YKL+T+   D+E    V SY   L  TD GSP               N+ PP F    YSA   E   +  ++      D D    A  T     +   G     ++ I+   G L  +   D E+    DL + +I     +   +S+ S+ + V+D NDN PE++       G    E+   S     L  ++   D D  +NA  S   +K+                                   + GLF +   TG++ +   L   + + Q   V+ QD G P  +    LT+ +                +  S+ S  S ++++ +  +    LV +I  V+  + + +W K R
Sbjct:   66 RIVSRGKTQLFAVNPRSGSLITAGRIDREELCETVSSCFLNMELLVEDTLKIYGVEVEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSLQLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIPMFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMESKASEIFQLDSQTGEVQ-VRGSLDFEKYRFYEMEIQGQDGGGL--FTTTTMLITVVDVNDNAPEITITSSINSILENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGN-------YYKLITSRVLDRE---LVQSYNITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQ--FRDLELRVIARDSGDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKA----------------------------------SEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSETSDLSLYLVVAVAAVSCIFLVFVI--VLLALRLWRWHKSR 724          
BLAST of Protocadherin gamma-A1 vs. Ensembl Human
Match: PCDHGA11 (protocadherin gamma subfamily A, 11 [Source:HGNC Symbol;Acc:HGNC:8698])

HSP 1 Score: 160.999 bits (406), Expect = 3.568e-40
Identity = 182/701 (25.96%), Postives = 292/701 (41.65%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAICP-----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTL---ISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEII--DINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADAD----ATSTNEFQINGTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-------GRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQ---VSAQDQGLPSKTNYSNLTINI---------------HMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR 2119
            LF ++  SG + T+  IDRE +C                  KI G  +  ID+NDN P FQ ++  I++ E+        L  A D D     + +Y+L  +      L         P+L L   LD EK   + L+L   D G    K  + I ++  D+ND  P F Q  Y V V E +  G+ +L V+A D ++G  G+++Y   +     S   ++DS+TGE+  ++  L  EK     + I+ QD G +  F  T +LI ++DVNDN PEI        I EN P   ++A++ V+D+D G NG+VSC + +  P K ++   N       +YKL+T+   D+E    V SY   L  TD GSP               N+ PP F    YSA   E   +  ++      D D    A  T     +   G     ++ I+   G L  +   D E+    DL + +I     +   +S+ S+ + V+D NDN PE++       G    E+   S     L  ++   D D  +NA  S   +K+                                   + GLF +   TG++ +   L   + + Q   V+ QD G P  +    LT+ +                +  S+ S  S ++++ +  +    LV +I  V+  + + +W K R
Sbjct:   75 LFAVNPRSGSLITAGRIDREELCETVSSCFLNMELLVEDTLKIYGVEVEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSLQLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIPMFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMESKASEIFQLDSQTGEVQ-VRGSLDFEKYRFYEMEIQGQDGGGL--FTTTTMLITVVDVNDNAPEITITSSINSILENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGN-------YYKLITSRVLDRE---LVQSYNITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQ--FRDLELRVIARDSGDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKA----------------------------------SEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSETSDLSLYLVVAVAAVSCIFLVFVI--VLLALRLWRWHKSR 724          
BLAST of Protocadherin gamma-A1 vs. Ensembl Human
Match: PCDHGA8 (protocadherin gamma subfamily A, 8 [Source:HGNC Symbol;Acc:HGNC:8706])

HSP 1 Score: 158.688 bits (400), Expect = 1.498e-39
Identity = 179/710 (25.21%), Postives = 293/710 (41.27%), Query Frame = 2
Query:  218 HLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICP-----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPF---TLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGT----HGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-------GRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQ---VSAQDQGLPSKTNYSNLTINIH-------------MPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR 2119
            H  +I  +    LF ++  SG + T+  IDRE +C                  K+ G  +  ID+NDN PKFQ     ++I E         L +A D D     + +Y+L  +        T  +  + P+L L + LD E+   ++LVL   D G     S  ++ + ++D ND AP F    Y V V E +  G+ +L V A D ++G  GK+ Y+    NE  +   +++  TGEI + K L   E     + I+A+D G++     TKLLI + DVNDNRPE+        + EN     ++A + V D+D G NG+V C      P K ++ + N       +Y+LVT    D+EN   VS Y +    +D G+P               N+ PP F    YSA   E  L+  ++      D D+    +   + T     G     +I I+   G L  +   D E+    DL +++      +   +S+ S+ + V+D NDN PE++       G    E+   S     L  ++   D D  +NA  S   +K+                                   + GLF +   TG++ +   L   + + Q   V+ QD G P  +    LT+ +               P+ D +  S  + L++ +     + +   AV+  + + +W K R
Sbjct:   62 HGVRIVSRGRTQLFALNPRSGSLITAGRIDREELCAQSPRCLININTLVEDKGKLFGVEIEIIDINDNNPKFQVEDLEVKINEIAVPGARYPLPEAVDPDVGVNSLQSYQLSPNHHFSLDVQTGDNGAINPELVLERALDREEEAAHHLVLTASDGGKPPRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKFRKINEKQTPLFQLNENTGEISIAKSLDYEECSFYEMEIQAEDVGAL--LGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGN-------YYRLVTRKYLDREN---VSIYNITVMASDLGTPPLSTETQIALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQSFDYEQI--RDLQLLVTASDSGDPPLSSNMSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKA----------------------------------SEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLTELGSLKPSVDPNDSSLTLYLVVAVAAISCVFLAFVAVLLGLRLRRWHKSR 723          
BLAST of Protocadherin gamma-A1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 128.257 bits (321), Expect = 6.670e-30
Identity = 158/640 (24.69%), Postives = 276/640 (43.12%), Query Frame = 2
Query:   95 VSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEID------------REAICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIID----VNDNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATS---TNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDK---IAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTS 1882
            V A+ S +VT  I EN+     +  +    E F     VH+ +      S      ID  +G ++    ID            ++   P +S T    +  ID+ND+ P     +++I + EN  I   +    A D DS   GI  Y +  SED     I       +K  K LD E    Y+L +   D G  SL +   + + + DIND AP F +K Y+V ++E +  GS I+ + A DN++    KI YR+ +++      + I  + G I  +   L  +  K+ V I A D G +       + I  ++     ND+   + I E+ P+   +  ++ ED DRG N ++   + S++  +     ++P  G      +  +   D+E D    S  +  +D+ SP               N+  P F S  Y+AT +E++    + ++ +  DAD       + F    +     ++  +D+ +G L +   +DRE+     +++ I        + +++S + +T+ D+NDN P     + +  + ENS + S++G I  RD D+  NA  S        F  +D K   I  D + N +  I +    DYE   ++   F+L   +G L+S
Sbjct:   15 VFASDSYNVT--ILENITIPAVIATVKATDEDFGTNGKVHYSMAS---SSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQ-GAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR-----IDPSSG-----DISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQ--FAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFR-----IFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKF-FFELQASSGQLSS 623          

HSP 2 Score: 75.485 bits (184), Expect = 1.295e-13
Identity = 79/301 (26.25%), Postives = 132/301 (43.85%), Query Frame = 2
Query:  656 IEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK-ILVTIEAQDCGSVPKFAWT-KLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDRE 1483
            I ++D+ND AP F   +Y+V + E + + ++I  V A D + G  GK+ Y +  S+  G   + ID  TGE+ L + +      I   I A+D G+ P  + T  L I++ID+ND+ P        I + EN  +   +  V   D+D G NG +   +       S++ +++   G  K  KL+     D+E     + Y L  T  D G+P               N+  P FD + Y+ T +EE+ +   +I     D D      ++I       F I  I  +   L +   + R+
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRERIDAKNSPITAVIRAKD-GAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-----SEDFIIDEDSGLIKTTKLL-----DRET---TARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ 288          

HSP 3 Score: 74.7146 bits (182), Expect = 2.349e-13
Identity = 131/546 (23.99%), Postives = 227/546 (41.58%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYN----LVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE---KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGS--PHC--NEY------PPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVV-ENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAID-FQVNKI-GEIRSTVVLDYEKFQH-QLGLFDLDRFTGDLTSISQL 1894
            +DVNDN P F  +   + I EN  I   +   KATD D    G  +Y + +S  +   T+  S  +  L+       E+++  N     V+   D    +L S   L I +IDIND AP  I     + + E + +G  + +V+A D + G  G I Y +  S +    FI ID  +G I   K LL  E   +  + + A+D G+      T + + + D+NDN P  D       I E  P    +  ++  D D   + K++ ++        +E+      G       + +VS + +  +H     ++ TD G     C  N +       PYF+   +S    E       VI     D D         +     +F+   ID  +G + +   +DRE   R    +I+      +    +S+ + + + DINDN P+    +    + E+  + +S  ++   D D   N       +  +  N+S    +I  F++++  G +R +  LD E+F    L +F  DR T  L++ S++
Sbjct:    7 VDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR-------ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FI-IDEDSGLIKTTK-LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEA----DREVFSILDIGDQ---GAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR---IDPSSGDISVSSDLDRED--RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNG------IVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEI 519          

HSP 4 Score: 72.7886 bits (177), Expect = 9.549e-13
Identity = 84/317 (26.50%), Postives = 133/317 (41.96%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDRE--------------AICPKISGTNLPCI--DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP----FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKF------------AWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGA 1081
             F ID  SG IS S+++DRE              A  P  + T +  I  D+NDN P+F  +     I E+  +  +     A D D    GI +Y L  S   P    F L  +     L++   LD E+  +  L +   D G  SL +  ++ + + D+ND AP F Q +Y + + E   VGS +  + A D ++GD   I +R+         F   D+K  +I       G+ +IL   E        KF            +   + IH+ DVNDN+P +       + F+N  ++  +  +   D D+ A
Sbjct:  367 FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRT--SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI---------FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNA 672          
BLAST of Protocadherin gamma-A1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 127.872 bits (320), Expect = 8.333e-30
Identity = 158/640 (24.69%), Postives = 276/640 (43.12%), Query Frame = 2
Query:   95 VSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEID------------REAICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIID----VNDNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATS---TNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDK---IAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTS 1882
            V A+ S +VT  I EN+     +  +    E F     VH+ +      S      ID  +G ++    ID            ++   P +S T    +  ID+ND+ P     +++I + EN  I   +    A D DS   GI  Y +  SED     I       +K  K LD E    Y+L +   D G  SL +   + + + DIND AP F +K Y+V ++E +  GS I+ + A DN++    KI YR+ +++      + I  + G I  +   L  +  K+ V I A D G +       + I  ++     ND+   + I E+ P+   +  ++ ED DRG N ++   + S++  +     ++P  G      +  +   D+E D    S  +  +D+ SP               N+  P F S  Y+AT +E++    + ++ +  DAD       + F    +     ++  +D+ +G L +   +DRE+     +++ I        + +++S + +T+ D+NDN P     + +  + ENS + S++G I  RD D+  NA  S        F  +D K   I  D + N +  I +    DYE   ++   F+L   +G L+S
Sbjct:  374 VFASDSYNVT--ILENITIPAVIATVKATDEDFGTNGKVHYSMAS---SSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQ-GAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR-----IDPSSG-----DISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQ--FAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFR-----IFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKF-FFELQASSGQLSS 982          

HSP 2 Score: 100.138 bits (248), Expect = 3.811e-21
Identity = 140/562 (24.91%), Postives = 237/562 (42.17%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREA-------------ICPKISGTN---LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEI--IDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK-ILVTIEAQDCGSVPKFAWT-KLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSFCFNKSDDKIAIDFQVNKIGEIRST 1804
            LF +D  SG I  +  +DRE              + P IS +    +  +DV DN P F+ +    +I E+  I  T+    A DLDS + G   Y L          I++     ++    LD E + L  L +   D G+   +   ++EI  +D+ND AP F   +Y+V + E + + ++I  V A D + G  GK+ Y +  S+  G   + ID  TGE+ L + +      I   I A+D G+ P  + T  L I++ID+ND+ P        I + EN  +   +  V   D+D G NG +   +       S++ +++   G  K  KL+     D+E     + Y L  T  D G+P               N+  P FD + Y+ T +EE+ +   +I     D D      ++I       F I  I  +   L +   + R+        + +     D         V + + D+N  P       + ++ E+S I   +  +K  D D+  NA+  +SI S + F  + S   I++   +++  E R+T
Sbjct:  212 LFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINA-KSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRERIDAKNSPITAVIRAKD-GAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-----SEDFIIDEDSGLIKTTKLL-----DRET---TARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-----HKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDR--EDRAT 749          

HSP 3 Score: 86.6557 bits (213), Expect = 4.976e-17
Identity = 147/608 (24.18%), Postives = 251/608 (41.28%), Query Frame = 2
Query:  227 QIEYQ----SEKPLFVIDQYSGVISTSAEIDREAI-------------CPKISGTNL---PCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDL-PFTLISSPMQPKLKLIKYLDFEKVELYN----LVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE---KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGS--PHC--NEY------PPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVV-ENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAID-FQVNKI-GEIRSTVVLDYEKFQH-QLGLFDLDRFTGDLTSISQL 1894
            +IEY     + K L  I+  SGVI T+A +DRE +              PK   T +     +DVNDN P F  +   + I EN  I   +   KATD D    G  +Y + +S  +   T+  S  +  L+       E+++  N     V+   D    +L S   L I +IDIND AP  I     + + E + +G  + +V+A D + G  G I Y +  S ++      ID  +G I   K LL  E   +  + + A+D G+      T + + + D+NDN P  D       I E  P    +  ++  D D   + K++ ++        +E+      G       + +VS + +  +H     ++ TD G     C  N +       PYF+   +S    E       VI     D D         +     +F+   ID  +G + +   +DRE   R    +I+      +    +S+ + + + DINDN P+    +    + E+  + +S  ++   D D   N       +  +  N+S    +I  F++++  G +R +  LD E+F    L +F  DR T  L++ S++
Sbjct:  304 EIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR-------ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF-----IIDEDSGLIKTTK-LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEA----DREVFSILDIGDQ---GAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR---IDPSSGDISVSSDLDRED--RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNG------IVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEI 878          

HSP 4 Score: 72.4034 bits (176), Expect = 1.117e-12
Identity = 80/289 (27.68%), Postives = 122/289 (42.21%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDRE--------------AICPKISGTNLPCI--DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP----FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKF------------AWTKLLIHIIDVNDNRPEIDIF 1018
             F ID  SG IS S+++DRE              A  P  + T +  I  D+NDN P+F  +     I E+  +  +     A D D    GI +Y L  S   P    F L  +     L++   LD E+  +  L +   D G  SL +  ++ + + D+ND AP F Q +Y + + E   VGS +  + A D ++GD   I +R+         F   D+K  +I       G+ +IL   E        KF            +   + IH+ DVNDN+P +  F
Sbjct:  726 FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRT--SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI---------FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDF 1003          
BLAST of Protocadherin gamma-A1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 95.1301 bits (235), Expect = 1.154e-19
Identity = 77/266 (28.95%), Postives = 129/266 (48.50%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLIS-SPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE------IDIFENQPLSIILAIVRVEDKDRGANGKV--SCQLHST 1114
            D NDN P+F  +   I I E+ +++    + +A+D D  + G   Y +++S   P + I       +L     LD+E    Y L ++  D G     S   L I ++D+ND AP+F +  Y++ V E     +++ KV A D +  + G+I+YR+ +    GS +  ID K G +Y  + +    +  + ++I A+D G  P+ +     I ++DVNDN P       I +    PLS  +  +   D D+G NG V    QL S+
Sbjct:  829 DHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSH--PGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN----GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSS 1088          

HSP 2 Score: 92.0485 bits (227), Expect = 1.154e-18
Identity = 126/475 (26.53%), Postives = 206/475 (43.37%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQK--LIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRL--GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEI-----------LLNPIKGRHKFYKL---VTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVI-KFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNA 1702
            DVNDN P F  N+  + + E  +    L +  A+D+DS  FG  +Y +L SE   F++  +P+  ++   K L   +   ++LV+   D G   S+    + I +ID +   P+F +  Y +   E +  G  I  V       G   K+ Y +  GD +   S    ID  TG+IY+ + L       V +  Q      +   T+++I I D NDN P       EI I E+  L     +V+  DKD+  NG+V   + S+ P  S EI           LL+    R+  YKL    T++     + N   + F++  D      N+  P F+  +Y+    E    + ++ K    D D+    +     T+G  +    ID+K G +     IDRE      + I I+         +S++S  I+V+D+NDNPP  +      V   S + +++G I   D D+  N 
Sbjct:  633 DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHIL-SESSSFSI--NPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHNFS----IDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRN--YKLRVKATDLGIPPRSSNM--TLFIHVLD-----VNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY--FGIDEKLGNVYTKRSIDRE--VISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNG 1077          

HSP 3 Score: 78.1814 bits (191), Expect = 2.223e-14
Identity = 84/341 (24.63%), Postives = 143/341 (41.94%), Query Frame = 2
Query:  143 LPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDRE--------AICPKISGTNLPCI----DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSE-----DLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDI-----------FENQPLSIILAIVRVEDKDR 1075
            +P S ++G     I   R ++    +      +       +D+ SG IST A +D E        A+  + SG  +  +    D NDN P F      ++I E  ++  +  L   TD D  +F +  + +L         L    ++  +Q  L +   LD E  + Y L++E  D G  +   + +  IEIID ND AP F +  Y+  V+  + +GS ++ V A D + G+  +I Y +  ++   +    I S++G I     LL      V + A D GS    +   + I ++    + P +DI            EN  L  I+A V +  + R
Sbjct:   31 VPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAI-SQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYR 370          

HSP 4 Score: 73.1738 bits (178), Expect = 7.180e-13
Identity = 127/569 (22.32%), Postives = 226/569 (39.72%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYR-LGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-----------DIFENQPLSIILAIVRVE----DKDRGANGKV---SCQLHSTKPLKS---KEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNE--FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPEL-VGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            +D     P+F+     ++IPE+  I   L    A +          Y L   ++    L    M   + + K  DFEK + Y   +   +  S  S   + I + D+ND  P F    Y + V E  K    +L V A D + G FG++ Y  L +S+ +      I+  TGE++  KP L   +  + + A+D G         + I +ID +   P+            DI     +  + A+ +V+      D+  N  +   + +++ T+ L +     +LLN          +   +   + N   V  +  +  DN        PP F S     +  E+LK  E       +D D     E  + I  +H G   I  ID+  G+L     +D E T    L +   ++G+  +  +S+ ++ I V+D+NDN PE        EV+ENS  ++ +G++  RD D   N Q        +      +   ID    K+G + +   +D E   H      +D                  + + A+D+G+P +++ ++  I++
Sbjct:  531 LDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE---HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFS-----INPVTGEVFAQKP-LARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLN----------IQATLPSGESNQTQVVIFIEDHNDN--------PPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPG-SSIE-IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR--SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI------VYRITNGSEYFGID---EKLGNVYTKRSIDREVISH------VD------------------ISIVAEDKGVPPRSSTASARISV 1035          

HSP 5 Score: 65.855 bits (159), Expect = 1.093e-10
Identity = 74/250 (29.60%), Postives = 116/250 (46.40%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI---CPKISGT----------NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT--SEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVN-ETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYL-IKPLLGLEKILVTIEAQDCGSVPKFA 955
            F +D   GVI T+ E+DRE +     K+ GT          ++   ++NDN P F  +K   ++PEN  +   +    A D+D+L      Y L++  S   P           + L   LDFE +  + L ++  D GS  +   L I + DIND AP F +  Y   V+  T   G    K+ A+D +    G + Y LG  +   S   R+  ++G +++ + P  G E+ LVT+ A D G VP F+
Sbjct: 1874 FSVDS-EGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNL--APLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD-GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGS---SSIFRVAPESGALFMKVLPPAG-ERYLVTVTATDNG-VPSFS 2111          

HSP 6 Score: 60.4622 bits (145), Expect = 5.139e-9
Identity = 103/413 (24.94%), Postives = 168/413 (40.68%), Query Frame = 2
Query:  554 LKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLG-DSNEYGSRFIRIDSKTGEIYLIKPL---------LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSIILAIVRVEDKDRGA-------NGKVSCQLHSTKP---LKSKEILLNPIKGRHKFYKLVTNVSYDKENDN-----HVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR--NNFEVVENSLIESSLGRIKIRDIDQNRNAQFS 1711
            + LI  L +     YNL++E   +G   +   + + + D+ND  P FI    +V++  + + G ++ +V A D +K    +I Y L    +E    F +ID K+GEI++++            GL + L TI A D   + KF   K+L+     N +R     F+ Q   + +    +    +G+          V  QL  + P   LKS +I+           +       D E D      HV   F              PP   S      T EE       K  LA    T  + F+  G    +     I+   G + ++ P+DRE +    L+II+ + G        S +V +TV D NDN P+L     +  E+ E+S +   L R +  D+D  +N +FS
Sbjct: 1385 ITLIDTLHWHVTPTYNLIVEAFTSGP-GTTLLVTVNVDDVNDHTP-FIVSQPTVLLPSSYRKGGMVHRVVAIDLDKDP--EIRYSLKYAGSEVAKEFFKIDEKSGEIFVVESSSALSTSFGGAGLPETL-TIRATDLQDLTKFDEQKVLLKA--SNASRSTWHFFDEQHKDVTI----LSTSPQGSQILQLKFQEGVDLQLIPSSPHFELKSSKIVQKSASVATGTQRFTIVAQKDDELDYSTLKIHVEPVFTE------------PPKISSTSCGVVTIEENVGIEDFKRILATG-MTEESRFRFQGNAPKFS----INSTTGSISVL-PLDREASQEHLLIIILTDGGSR----NDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFS 1764          
BLAST of Protocadherin gamma-A1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 94.3597 bits (233), Expect = 2.060e-19
Identity = 145/600 (24.17%), Postives = 249/600 (41.50%), Query Frame = 2
Query:  209 VHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAI----------------CPKISGTNLPCI-------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED--LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYS-VVVNETLKVGSLILKVHAYDNEKGD-FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIK-----PLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID------IFEN-QPL---SIILAIVRVEDKD--RGANGKVSCQLHSTKPLKSKEIL-LNPIKGR-HKFYKLVTNVSYDKE-------NDNHVSSY--FLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNE---FQINGTHGGWFKIHIIDKKN---GKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYE 1822
            VH+ +       E   F ID+ +G I  + + DRE I                 P  +G N   +       DVNDN P F+  K I ++ E+E   + +   KA DLD  +     Y L+ +    +PF + +      +K  + LDFE  + Y+LVL   D G   +   + I I D+ND AP+F Q+ Y+  V+ E + +  ++  VHA D ++ +   +I+YRL    +      RI   +G I L+K     P  G+      ++A D        +  + +++ D+NDN P         I EN +P+    +    V+  D D     N  +   +   K +  + +  ++   G+      L   +S ++E       ND  V S   F N T   +   N+  P+F+   Y  +  E       V+ F+  DAD  + +    +Q++     ++     D K    G L +  P+D E           + I + +    + ++V + ++D ND+ P + G     V E+    +S+GR    D D    A+F I+        +SD K    F +++ G +R    LD E
Sbjct: 1255 VHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVK--EPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRL--EGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVT-DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDV--TQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRIN-------RQSDPKRQ--FTIDQDGTLRVAHTLDRE 1835          

HSP 2 Score: 80.4925 bits (197), Expect = 4.298e-15
Identity = 139/535 (25.98%), Postives = 231/535 (43.18%), Query Frame = 2
Query:  560 LIKYLDFEKVELYNLVLEVCD-TGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKV--------GSLILKVHAYDNEK-GDFGKILYRL-GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQD-------CGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHS-TKPLKSKEILLNPIKGRHKF-YKLVTNVSYDKENDNHVSS--YFL---------NCTDNGSPH---CNEYPPYFDSQFYSATTTEELKSENVIKFAL----ADADATSTN-EFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREK-TXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLG----RIKIRDID----QNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF 2011
            +++ LD+E+V  Y L L   D T  + S +  ++E+ D+ND+ P+F    ++  ++E +          G  I+ V A D +  G   ++ YR+ G++N   ++  RID  TGEI+  +     EKI   ++T+EA D         + P     K+ I I DVNDN P    FE Q       I RV++ +   +  ++ + H   K    +  L+    GR  F  +  +   + KE  +  +S  Y L         N T N   H    N+  P F+ Q Y+ T  EE      + F +    AD D  S+   +++ G   G  ++  I K +G + L+  +DR+          ++  I  D       + V + V DINDN P    R    + EN     S G     ++ RD D    +N N ++ I  V++   N  +    ID    KI  +RS                 LDR       IS  +   ++++V A D+G+PS+  ++N+TI +    +DN+ F
Sbjct: 1166 IMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKF-DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS---FEEQKY-----IGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQ--GADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI--VRNKLIN-GESVFRIDQNTGKIFAMRS-----------------LDR------EISSER--EFIIEVRANDRGVPSREGFANVTIKV-TDMNDNAPF 1660          

HSP 3 Score: 65.0846 bits (157), Expect = 2.298e-10
Identity = 119/520 (22.88%), Postives = 213/520 (40.96%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLE-----KATDLDSLQFGIDNYKLL--TSEDLPFTLI---SSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSR-------FIRIDSKTGEIYLIKPL-LGLEKILVTIEAQDCGSVPKF--AWTKLLIHIIDVN----------DNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST----KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGS------------PHCNEYPPYFDSQFYSATTTEEL---------KSENVIKFALADADATS-TNE--FQINGTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSS-----VLITVIDINDNPPELVGRNNFEVVENSLIES-SLGRIKIRDIDQNRNAQFSI 1714
            DVN+N+P+F    +   I +  E  Y  D       +ATD DS   G   Y L    SE     +I   +  + P   ++   D E     ++ ++  D G   L    +  +E++DIND +P+F + +Y   V+    VG+ ++ V A+DN+     +I Y L      G         F  ++ ++GEI LIKP+ +  +K +  + A D G +P+   +  ++ ++++D            D +P I + EN  L+ ++   R        N  V  +L ++       +SK    N  +  +++ ++V     D E  N+  +  L  TD  S               N+  P F    ++ T  EE+           + ++     D D+    NE  ++I G   G    H  ID+  G++      DREK D   L +   +  +      +  +     V I + D+NDN P    +     V+ S  E   +  IK  D+D++ N ++ +
Sbjct:  857 DVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV--FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNY-TLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHL 1372          

HSP 4 Score: 61.2326 bits (147), Expect = 3.078e-9
Identity = 113/505 (22.38%), Postives = 198/505 (39.21%), Query Frame = 2
Query:  185 EKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEID-REAICPKISGTNLPCI---------------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDS-----LQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG---SLCSKQKLIIEIIDINDMAPKFI-QKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSR---FIRIDSKTGEIYLIKPLLGLE------KILVTIEAQDCGSVPKF------AWTKLLIHIIDVNDNRPEI-DIFENQPLSIIL---------AIVRVE--DKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGS----PHC---------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNE----FQINGTHGGWFK-----IHIIDKKNGKLMLMHPI 1474
            E  R K  + + L+    + E   F ID  +G+I  +  +D  +   PK+    +                  DVNDN P F       Q+ E+  +N T+    A D D+     + + +DN+    + +         +  K++L      E+  +Y   +   D G   SL S   + I   + ND +  F+    Y+  V E  + G+ ++++ A D    D  ++ Y   D N   ++      ID  TG + L   +   +       I +T+  QD GS   +      ++  LLI I DVN+N+PE  D  +   ++ I+          IV+VE  D D  ANG +   L+ T+    K  +++   G         +V +D+E         +  TD G       C         N+  P F+   Y  + +  E    +VI     D DA    E     +I+ T G   +       ++++++G++ L+ PI
Sbjct:  561 EDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSN-------GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTG---VLTPSPHVVFDRETRPR-EDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI 1051          
BLAST of Protocadherin gamma-A1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 94.3597 bits (233), Expect = 2.060e-19
Identity = 145/600 (24.17%), Postives = 249/600 (41.50%), Query Frame = 2
Query:  209 VHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAI----------------CPKISGTNLPCI-------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED--LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYS-VVVNETLKVGSLILKVHAYDNEKGD-FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIK-----PLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID------IFEN-QPL---SIILAIVRVEDKD--RGANGKVSCQLHSTKPLKSKEIL-LNPIKGR-HKFYKLVTNVSYDKE-------NDNHVSSY--FLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNE---FQINGTHGGWFKIHIIDKKN---GKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYE 1822
            VH+ +       E   F ID+ +G I  + + DRE I                 P  +G N   +       DVNDN P F+  K I ++ E+E   + +   KA DLD  +     Y L+ +    +PF + +      +K  + LDFE  + Y+LVL   D G   +   + I I D+ND AP+F Q+ Y+  V+ E + +  ++  VHA D ++ +   +I+YRL    +      RI   +G I L+K     P  G+      ++A D        +  + +++ D+NDN P         I EN +P+    +    V+  D D     N  +   +   K +  + +  ++   G+      L   +S ++E       ND  V S   F N T   +   N+  P+F+   Y  +  E       V+ F+  DAD  + +    +Q++     ++     D K    G L +  P+D E           + I + +    + ++V + ++D ND+ P + G     V E+    +S+GR    D D    A+F I+        +SD K    F +++ G +R    LD E
Sbjct: 1255 VHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVK--EPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRL--EGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVT-DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDV--TQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRIN-------RQSDPKRQ--FTIDQDGTLRVAHTLDRE 1835          

HSP 2 Score: 80.4925 bits (197), Expect = 4.298e-15
Identity = 139/535 (25.98%), Postives = 231/535 (43.18%), Query Frame = 2
Query:  560 LIKYLDFEKVELYNLVLEVCD-TGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKV--------GSLILKVHAYDNEK-GDFGKILYRL-GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQD-------CGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHS-TKPLKSKEILLNPIKGRHKF-YKLVTNVSYDKENDNHVSS--YFL---------NCTDNGSPH---CNEYPPYFDSQFYSATTTEELKSENVIKFAL----ADADATSTN-EFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREK-TXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLG----RIKIRDID----QNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF 2011
            +++ LD+E+V  Y L L   D T  + S +  ++E+ D+ND+ P+F    ++  ++E +          G  I+ V A D +  G   ++ YR+ G++N   ++  RID  TGEI+  +     EKI   ++T+EA D         + P     K+ I I DVNDN P    FE Q       I RV++ +   +  ++ + H   K    +  L+    GR  F  +  +   + KE  +  +S  Y L         N T N   H    N+  P F+ Q Y+ T  EE      + F +    AD D  S+   +++ G   G  ++  I K +G + L+  +DR+          ++  I  D       + V + V DINDN P    R    + EN     S G     ++ RD D    +N N ++ I  V++   N  +    ID    KI  +RS                 LDR       IS  +   ++++V A D+G+PS+  ++N+TI +    +DN+ F
Sbjct: 1166 IMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKF-DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS---FEEQKY-----IGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQ--GADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI--VRNKLIN-GESVFRIDQNTGKIFAMRS-----------------LDR------EISSER--EFIIEVRANDRGVPSREGFANVTIKV-TDMNDNAPF 1660          

HSP 3 Score: 65.0846 bits (157), Expect = 2.298e-10
Identity = 119/520 (22.88%), Postives = 213/520 (40.96%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLE-----KATDLDSLQFGIDNYKLL--TSEDLPFTLI---SSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSR-------FIRIDSKTGEIYLIKPL-LGLEKILVTIEAQDCGSVPKF--AWTKLLIHIIDVN----------DNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST----KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGS------------PHCNEYPPYFDSQFYSATTTEEL---------KSENVIKFALADADATS-TNE--FQINGTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSS-----VLITVIDINDNPPELVGRNNFEVVENSLIES-SLGRIKIRDIDQNRNAQFSI 1714
            DVN+N+P+F    +   I +  E  Y  D       +ATD DS   G   Y L    SE     +I   +  + P   ++   D E     ++ ++  D G   L    +  +E++DIND +P+F + +Y   V+    VG+ ++ V A+DN+     +I Y L      G         F  ++ ++GEI LIKP+ +  +K +  + A D G +P+   +  ++ ++++D            D +P I + EN  L+ ++   R        N  V  +L ++       +SK    N  +  +++ ++V     D E  N+  +  L  TD  S               N+  P F    ++ T  EE+           + ++     D D+    NE  ++I G   G    H  ID+  G++      DREK D   L +   +  +      +  +     V I + D+NDN P    +     V+ S  E   +  IK  D+D++ N ++ +
Sbjct:  857 DVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV--FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNY-TLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHL 1372          

HSP 4 Score: 61.2326 bits (147), Expect = 3.078e-9
Identity = 113/505 (22.38%), Postives = 198/505 (39.21%), Query Frame = 2
Query:  185 EKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEID-REAICPKISGTNLPCI---------------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDS-----LQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG---SLCSKQKLIIEIIDINDMAPKFI-QKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSR---FIRIDSKTGEIYLIKPLLGLE------KILVTIEAQDCGSVPKF------AWTKLLIHIIDVNDNRPEI-DIFENQPLSIIL---------AIVRVE--DKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGS----PHC---------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNE----FQINGTHGGWFK-----IHIIDKKNGKLMLMHPI 1474
            E  R K  + + L+    + E   F ID  +G+I  +  +D  +   PK+    +                  DVNDN P F       Q+ E+  +N T+    A D D+     + + +DN+    + +         +  K++L      E+  +Y   +   D G   SL S   + I   + ND +  F+    Y+  V E  + G+ ++++ A D    D  ++ Y   D N   ++      ID  TG + L   +   +       I +T+  QD GS   +      ++  LLI I DVN+N+PE  D  +   ++ I+          IV+VE  D D  ANG +   L+ T+    K  +++   G         +V +D+E         +  TD G       C         N+  P F+   Y  + +  E    +VI     D DA    E     +I+ T G   +       ++++++G++ L+ PI
Sbjct:  561 EDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSN-------GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTG---VLTPSPHVVFDRETRPR-EDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI 1051          
BLAST of Protocadherin gamma-A1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 145.976 bits (367), Expect = 2.329e-35
Identity = 147/541 (27.17%), Postives = 245/541 (45.29%), Query Frame = 2
Query:  245 EKPLFVIDQYSGVISTSAEIDRE----------------AICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENE----EINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGA-----------NGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADAT-------STNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQ 1705
            E P+F ID  SGVIST + +DRE                A   + + T    +  +D NDN P+F      +Q+PE++    E N T+   +ATD D        Y ++         I S M   + L+K LD+E V  Y LV+   D GS    +  +L++ +ID ND AP+F    +   V E + VG  I++V AYD+++G   +I Y + + ++  +  + +D +TG +  IKPL   E  +    + A+D G  PK A + ++I + DVNDN P       E ++ E+QP    +  V   D D  +            G+ +    + + L +    L+  K   +F  L+T  + D    +  ++  +N TD      N + P F++  YSA+  E+      V+  +  D+D         S NE  ING   G      I+ + G ++   P+DRE T     L+ +      N + + ++ V I V D+NDN P          ++E++L+ +S+ ++   D D   N +
Sbjct:  517 EMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDS-MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD--NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD-YKQEKRF--LLTVAATDSGGRSDTATVHINITD-----ANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL--GSPDPFSINPQTGAIVTNAPLDRETT--SGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGR 1041          

HSP 2 Score: 117.857 bits (294), Expect = 1.421e-26
Identity = 153/640 (23.91%), Postives = 272/640 (42.50%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAI-------------CPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLD-----SLQFGI----DNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLI-----IEIIDINDMAPKFIQKNYSVVVNETLKVGS---LILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQL------------------HSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQI-NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS-SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            LF +D  +GV++TSA +DRE +              P  SGT    +  +D ND+ P F+  +    I E   +  T+   +ATD D      +++GI    D   L   +++P   I S     +     LD E  + Y+L++   D  S  S+++       ++++D ND  P+F ++ Y+V V E    G+    +  + A D ++G+   I Y +   N   S+F  IDS +G++ L+KPL    +    + I AQD GS  +   T+LL+++ID NDN P          + EN P+   +  V+  D D GAN +++  +                   + KPL  +E      +GR  F  +  +     ++ +  SS  +   D      N+  P F+ ++Y A   E+      +    A D D  S   ++I  G   G F    I  +NG+ ++   I +    + +   ++     D+   + +++V I + D N+  P       +  V E++ + +++  +   D D   NAQ + S + +S     S D  +I+ Q    G I +   LD E                            Y+L V+A+D G PS ++ +++ I +
Sbjct:  406 LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDS-RSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-SQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREE------QGRFAFQVVAKDGGVPPKSAS--SSVVITVQD-----VNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA---ITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT---GAIVTNAPLDRETTS------------------------GYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 106.686 bits (265), Expect = 4.243e-23
Identity = 150/585 (25.64%), Postives = 234/585 (40.00%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI-------------CPKISGTN---LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLH--STKPLKSKEIL-LNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPH-------------CNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG-RNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV----LDYEKFQHQLGL 1846
            F ID  SG +S    +D E++              P  S T    +  ID NDN P+F  ++    + EN  + Y +   +A D D        Y + +  D  F L   P    ++ IK LD E+   +   +   D G     +   ++I + D+ND  P F  K Y   V E    G+ +  V A D ++    ++ Y +   N  G   I   +  G I + + L     ++ L+T+ A D G     A   + I+I D N+  P          +FE+ P+   + +V   D D G N +++  L+  S   L S +   +NP  G      +VTN   D+E     S Y L  T  D G+P               N+  P F S  Y A+  E+ L   +VI+ A +D D       +          G F   +ID  +G +     +DRE      L  I ++ G      +S+  V I + D+ND+PP     +    V ENS + S +G I   D D+  NA      V  +     DD  A    V + G  R+ ++    LDYE  + +  L
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRET---TSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF---VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA------VVHYSIIGGDDSNAFSL-VTRPGSERAQLLTMTELDYESTRKRFEL 1191          

HSP 4 Score: 88.9669 bits (219), Expect = 1.286e-17
Identity = 130/541 (24.03%), Postives = 216/541 (39.93%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDRE--------------AICPKISGTN--LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS--NEYGS-RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNC--TDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQ----INGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIE----SSLGRIKIRDIDQNRNAQFSISS 1720
              +D  +G + T   +DRE               + PK + ++  +   DVNDN P F        + E++     +    ATD D  +    +Y++ T      F + S   +  + + + LD+++ + + L +   D+G       + I I D N+ AP F    YS  V E   VG+ +L V A D++ G   +I Y L +   N  GS     I+ +TG I    PL        L+T+ A+D G+      T + I + DVNDN P       +  I E+  +   +  V   D D G NG++   L S + ++    +++P  G      + TN   D+E+   V+ + L     D GSP               N+ PP F S   +    E     +V+    A       N       I G     F  +     +  +L+ M  +D E T +   L++            + + + I V D+NDN P L    +F+V+ N+  +      +GRI   D D +    + I S
Sbjct:  737 LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIK-YLLSDRDIEDGSFVIDPTSG-----TIRTNKGLDRES---VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILS 1259          
BLAST of Protocadherin gamma-A1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 145.976 bits (367), Expect = 2.329e-35
Identity = 147/541 (27.17%), Postives = 245/541 (45.29%), Query Frame = 2
Query:  245 EKPLFVIDQYSGVISTSAEIDRE----------------AICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENE----EINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGA-----------NGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADAT-------STNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQ 1705
            E P+F ID  SGVIST + +DRE                A   + + T    +  +D NDN P+F      +Q+PE++    E N T+   +ATD D        Y ++         I S M   + L+K LD+E V  Y LV+   D GS    +  +L++ +ID ND AP+F    +   V E + VG  I++V AYD+++G   +I Y + + ++  +  + +D +TG +  IKPL   E  +    + A+D G  PK A + ++I + DVNDN P       E ++ E+QP    +  V   D D  +            G+ +    + + L +    L+  K   +F  L+T  + D    +  ++  +N TD      N + P F++  YSA+  E+      V+  +  D+D         S NE  ING   G      I+ + G ++   P+DRE T     L+ +      N + + ++ V I V D+NDN P          ++E++L+ +S+ ++   D D   N +
Sbjct:  517 EMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDS-MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD--NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD-YKQEKRF--LLTVAATDSGGRSDTATVHINITD-----ANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL--GSPDPFSINPQTGAIVTNAPLDRETT--SGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGR 1041          

HSP 2 Score: 117.857 bits (294), Expect = 1.421e-26
Identity = 153/640 (23.91%), Postives = 272/640 (42.50%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAI-------------CPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLD-----SLQFGI----DNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLI-----IEIIDINDMAPKFIQKNYSVVVNETLKVGS---LILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQL------------------HSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQI-NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS-SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            LF +D  +GV++TSA +DRE +              P  SGT    +  +D ND+ P F+  +    I E   +  T+   +ATD D      +++GI    D   L   +++P   I S     +     LD E  + Y+L++   D  S  S+++       ++++D ND  P+F ++ Y+V V E    G+    +  + A D ++G+   I Y +   N   S+F  IDS +G++ L+KPL    +    + I AQD GS  +   T+LL+++ID NDN P          + EN P+   +  V+  D D GAN +++  +                   + KPL  +E      +GR  F  +  +     ++ +  SS  +   D      N+  P F+ ++Y A   E+      +    A D D  S   ++I  G   G F    I  +NG+ ++   I +    + +   ++     D+   + +++V I + D N+  P       +  V E++ + +++  +   D D   NAQ + S + +S     S D  +I+ Q    G I +   LD E                            Y+L V+A+D G PS ++ +++ I +
Sbjct:  406 LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDS-RSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-SQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREE------QGRFAFQVVAKDGGVPPKSAS--SSVVITVQD-----VNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA---ITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT---GAIVTNAPLDRETTS------------------------GYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 106.686 bits (265), Expect = 4.243e-23
Identity = 150/585 (25.64%), Postives = 234/585 (40.00%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI-------------CPKISGTN---LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLH--STKPLKSKEIL-LNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPH-------------CNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG-RNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV----LDYEKFQHQLGL 1846
            F ID  SG +S    +D E++              P  S T    +  ID NDN P+F  ++    + EN  + Y +   +A D D        Y + +  D  F L   P    ++ IK LD E+   +   +   D G     +   ++I + D+ND  P F  K Y   V E    G+ +  V A D ++    ++ Y +   N  G   I   +  G I + + L     ++ L+T+ A D G     A   + I+I D N+  P          +FE+ P+   + +V   D D G N +++  L+  S   L S +   +NP  G      +VTN   D+E     S Y L  T  D G+P               N+  P F S  Y A+  E+ L   +VI+ A +D D       +          G F   +ID  +G +     +DRE      L  I ++ G      +S+  V I + D+ND+PP     +    V ENS + S +G I   D D+  NA      V  +     DD  A    V + G  R+ ++    LDYE  + +  L
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRET---TSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF---VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA------VVHYSIIGGDDSNAFSL-VTRPGSERAQLLTMTELDYESTRKRFEL 1191          

HSP 4 Score: 88.9669 bits (219), Expect = 1.286e-17
Identity = 130/541 (24.03%), Postives = 216/541 (39.93%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDRE--------------AICPKISGTN--LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS--NEYGS-RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNC--TDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQ----INGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIE----SSLGRIKIRDIDQNRNAQFSISS 1720
              +D  +G + T   +DRE               + PK + ++  +   DVNDN P F        + E++     +    ATD D  +    +Y++ T      F + S   +  + + + LD+++ + + L +   D+G       + I I D N+ AP F    YS  V E   VG+ +L V A D++ G   +I Y L +   N  GS     I+ +TG I    PL        L+T+ A+D G+      T + I + DVNDN P       +  I E+  +   +  V   D D G NG++   L S + ++    +++P  G      + TN   D+E+   V+ + L     D GSP               N+ PP F S   +    E     +V+    A       N       I G     F  +     +  +L+ M  +D E T +   L++            + + + I V D+NDN P L    +F+V+ N+  +      +GRI   D D +    + I S
Sbjct:  737 LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIK-YLLSDRDIEDGSFVIDPTSG-----TIRTNKGLDRES---VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILS 1259          
BLAST of Protocadherin gamma-A1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 145.976 bits (367), Expect = 2.412e-35
Identity = 147/541 (27.17%), Postives = 245/541 (45.29%), Query Frame = 2
Query:  245 EKPLFVIDQYSGVISTSAEIDRE----------------AICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENE----EINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGA-----------NGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADAT-------STNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQ 1705
            E P+F ID  SGVIST + +DRE                A   + + T    +  +D NDN P+F      +Q+PE++    E N T+   +ATD D        Y ++         I S M   + L+K LD+E V  Y LV+   D GS    +  +L++ +ID ND AP+F    +   V E + VG  I++V AYD+++G   +I Y + + ++  +  + +D +TG +  IKPL   E  +    + A+D G  PK A + ++I + DVNDN P       E ++ E+QP    +  V   D D  +            G+ +    + + L +    L+  K   +F  L+T  + D    +  ++  +N TD      N + P F++  YSA+  E+      V+  +  D+D         S NE  ING   G      I+ + G ++   P+DRE T     L+ +      N + + ++ V I V D+NDN P          ++E++L+ +S+ ++   D D   N +
Sbjct:  517 EMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDS-MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD--NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD-YKQEKRF--LLTVAATDSGGRSDTATVHINITD-----ANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL--GSPDPFSINPQTGAIVTNAPLDRETT--SGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGR 1041          

HSP 2 Score: 117.857 bits (294), Expect = 1.496e-26
Identity = 153/640 (23.91%), Postives = 272/640 (42.50%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAI-------------CPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLD-----SLQFGI----DNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLI-----IEIIDINDMAPKFIQKNYSVVVNETLKVGS---LILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQL------------------HSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQI-NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS-SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            LF +D  +GV++TSA +DRE +              P  SGT    +  +D ND+ P F+  +    I E   +  T+   +ATD D      +++GI    D   L   +++P   I S     +     LD E  + Y+L++   D  S  S+++       ++++D ND  P+F ++ Y+V V E    G+    +  + A D ++G+   I Y +   N   S+F  IDS +G++ L+KPL    +    + I AQD GS  +   T+LL+++ID NDN P          + EN P+   +  V+  D D GAN +++  +                   + KPL  +E      +GR  F  +  +     ++ +  SS  +   D      N+  P F+ ++Y A   E+      +    A D D  S   ++I  G   G F    I  +NG+ ++   I +    + +   ++     D+   + +++V I + D N+  P       +  V E++ + +++  +   D D   NAQ + S + +S     S D  +I+ Q    G I +   LD E                            Y+L V+A+D G PS ++ +++ I +
Sbjct:  406 LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDS-RSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-SQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREE------QGRFAFQVVAKDGGVPPKSAS--SSVVITVQD-----VNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA---ITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT---GAIVTNAPLDRETTS------------------------GYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 106.686 bits (265), Expect = 3.997e-23
Identity = 150/585 (25.64%), Postives = 234/585 (40.00%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI-------------CPKISGTN---LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLH--STKPLKSKEIL-LNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPH-------------CNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG-RNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV----LDYEKFQHQLGL 1846
            F ID  SG +S    +D E++              P  S T    +  ID NDN P+F  ++    + EN  + Y +   +A D D        Y + +  D  F L   P    ++ IK LD E+   +   +   D G     +   ++I + D+ND  P F  K Y   V E    G+ +  V A D ++    ++ Y +   N  G   I   +  G I + + L     ++ L+T+ A D G     A   + I+I D N+  P          +FE+ P+   + +V   D D G N +++  L+  S   L S +   +NP  G      +VTN   D+E     S Y L  T  D G+P               N+  P F S  Y A+  E+ L   +VI+ A +D D       +          G F   +ID  +G +     +DRE      L  I ++ G      +S+  V I + D+ND+PP     +    V ENS + S +G I   D D+  NA      V  +     DD  A    V + G  R+ ++    LDYE  + +  L
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRET---TSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF---VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA------VVHYSIIGGDDSNAFSL-VTRPGSERAQLLTMTELDYESTRKRFEL 1191          

HSP 4 Score: 88.9669 bits (219), Expect = 1.232e-17
Identity = 130/541 (24.03%), Postives = 216/541 (39.93%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDRE--------------AICPKISGTN--LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS--NEYGS-RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNC--TDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQ----INGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIE----SSLGRIKIRDIDQNRNAQFSISS 1720
              +D  +G + T   +DRE               + PK + ++  +   DVNDN P F        + E++     +    ATD D  +    +Y++ T      F + S   +  + + + LD+++ + + L +   D+G       + I I D N+ AP F    YS  V E   VG+ +L V A D++ G   +I Y L +   N  GS     I+ +TG I    PL        L+T+ A+D G+      T + I + DVNDN P       +  I E+  +   +  V   D D G NG++   L S + ++    +++P  G      + TN   D+E+   V+ + L     D GSP               N+ PP F S   +    E     +V+    A       N       I G     F  +     +  +L+ M  +D E T +   L++            + + + I V D+NDN P L    +F+V+ N+  +      +GRI   D D +    + I S
Sbjct:  737 LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIK-YLLSDRDIEDGSFVIDPTSG-----TIRTNKGLDRES---VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILS 1259          
BLAST of Protocadherin gamma-A1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 145.976 bits (367), Expect = 2.587e-35
Identity = 147/541 (27.17%), Postives = 245/541 (45.29%), Query Frame = 2
Query:  245 EKPLFVIDQYSGVISTSAEIDRE----------------AICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENE----EINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGA-----------NGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADAT-------STNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQ 1705
            E P+F ID  SGVIST + +DRE                A   + + T    +  +D NDN P+F      +Q+PE++    E N T+   +ATD D        Y ++         I S M   + L+K LD+E V  Y LV+   D GS    +  +L++ +ID ND AP+F    +   V E + VG  I++V AYD+++G   +I Y + + ++  +  + +D +TG +  IKPL   E  +    + A+D G  PK A + ++I + DVNDN P       E ++ E+QP    +  V   D D  +            G+ +    + + L +    L+  K   +F  L+T  + D    +  ++  +N TD      N + P F++  YSA+  E+      V+  +  D+D         S NE  ING   G      I+ + G ++   P+DRE T     L+ +      N + + ++ V I V D+NDN P          ++E++L+ +S+ ++   D D   N +
Sbjct:  517 EMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDS-MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD--NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD-YKQEKRF--LLTVAATDSGGRSDTATVHINITD-----ANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL--GSPDPFSINPQTGAIVTNAPLDRETT--SGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGR 1041          

HSP 2 Score: 117.857 bits (294), Expect = 1.631e-26
Identity = 153/640 (23.91%), Postives = 272/640 (42.50%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAI-------------CPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLD-----SLQFGI----DNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLI-----IEIIDINDMAPKFIQKNYSVVVNETLKVGS---LILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQL------------------HSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQI-NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS-SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            LF +D  +GV++TSA +DRE +              P  SGT    +  +D ND+ P F+  +    I E   +  T+   +ATD D      +++GI    D   L   +++P   I S     +     LD E  + Y+L++   D  S  S+++       ++++D ND  P+F ++ Y+V V E    G+    +  + A D ++G+   I Y +   N   S+F  IDS +G++ L+KPL    +    + I AQD GS  +   T+LL+++ID NDN P          + EN P+   +  V+  D D GAN +++  +                   + KPL  +E      +GR  F  +  +     ++ +  SS  +   D      N+  P F+ ++Y A   E+      +    A D D  S   ++I  G   G F    I  +NG+ ++   I +    + +   ++     D+   + +++V I + D N+  P       +  V E++ + +++  +   D D   NAQ + S + +S     S D  +I+ Q    G I +   LD E                            Y+L V+A+D G PS ++ +++ I +
Sbjct:  406 LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDS-RSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-SQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREE------QGRFAFQVVAKDGGVPPKSAS--SSVVITVQD-----VNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA---ITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT---GAIVTNAPLDRETTS------------------------GYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 106.686 bits (265), Expect = 4.867e-23
Identity = 150/585 (25.64%), Postives = 234/585 (40.00%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI-------------CPKISGTN---LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLH--STKPLKSKEIL-LNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPH-------------CNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG-RNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV----LDYEKFQHQLGL 1846
            F ID  SG +S    +D E++              P  S T    +  ID NDN P+F  ++    + EN  + Y +   +A D D        Y + +  D  F L   P    ++ IK LD E+   +   +   D G     +   ++I + D+ND  P F  K Y   V E    G+ +  V A D ++    ++ Y +   N  G   I   +  G I + + L     ++ L+T+ A D G     A   + I+I D N+  P          +FE+ P+   + +V   D D G N +++  L+  S   L S +   +NP  G      +VTN   D+E     S Y L  T  D G+P               N+  P F S  Y A+  E+ L   +VI+ A +D D       +          G F   +ID  +G +     +DRE      L  I ++ G      +S+  V I + D+ND+PP     +    V ENS + S +G I   D D+  NA      V  +     DD  A    V + G  R+ ++    LDYE  + +  L
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRET---TSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF---VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA------VVHYSIIGGDDSNAFSL-VTRPGSERAQLLTMTELDYESTRKRFEL 1191          

HSP 4 Score: 88.9669 bits (219), Expect = 1.400e-17
Identity = 130/541 (24.03%), Postives = 216/541 (39.93%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDRE--------------AICPKISGTN--LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS--NEYGS-RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNC--TDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQ----INGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIE----SSLGRIKIRDIDQNRNAQFSISS 1720
              +D  +G + T   +DRE               + PK + ++  +   DVNDN P F        + E++     +    ATD D  +    +Y++ T      F + S   +  + + + LD+++ + + L +   D+G       + I I D N+ AP F    YS  V E   VG+ +L V A D++ G   +I Y L +   N  GS     I+ +TG I    PL        L+T+ A+D G+      T + I + DVNDN P       +  I E+  +   +  V   D D G NG++   L S + ++    +++P  G      + TN   D+E+   V+ + L     D GSP               N+ PP F S   +    E     +V+    A       N       I G     F  +     +  +L+ M  +D E T +   L++            + + + I V D+NDN P L    +F+V+ N+  +      +GRI   D D +    + I S
Sbjct:  737 LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIK-YLLSDRDIEDGSFVIDPTSG-----TIRTNKGLDRES---VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILS 1259          
BLAST of Protocadherin gamma-A1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 145.976 bits (367), Expect = 2.587e-35
Identity = 147/541 (27.17%), Postives = 245/541 (45.29%), Query Frame = 2
Query:  245 EKPLFVIDQYSGVISTSAEIDRE----------------AICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENE----EINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGA-----------NGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADAT-------STNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQ 1705
            E P+F ID  SGVIST + +DRE                A   + + T    +  +D NDN P+F      +Q+PE++    E N T+   +ATD D        Y ++         I S M   + L+K LD+E V  Y LV+   D GS    +  +L++ +ID ND AP+F    +   V E + VG  I++V AYD+++G   +I Y + + ++  +  + +D +TG +  IKPL   E  +    + A+D G  PK A + ++I + DVNDN P       E ++ E+QP    +  V   D D  +            G+ +    + + L +    L+  K   +F  L+T  + D    +  ++  +N TD      N + P F++  YSA+  E+      V+  +  D+D         S NE  ING   G      I+ + G ++   P+DRE T     L+ +      N + + ++ V I V D+NDN P          ++E++L+ +S+ ++   D D   N +
Sbjct:  517 EMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDN-TVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDS-MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDD--NFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLD-YKQEKRF--LLTVAATDSGGRSDTATVHINITD-----ANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL--GSPDPFSINPQTGAIVTNAPLDRETT--SGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGR 1041          

HSP 2 Score: 117.857 bits (294), Expect = 1.631e-26
Identity = 153/640 (23.91%), Postives = 272/640 (42.50%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAI-------------CPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLD-----SLQFGI----DNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLI-----IEIIDINDMAPKFIQKNYSVVVNETLKVGS---LILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQL------------------HSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQI-NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS-SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            LF +D  +GV++TSA +DRE +              P  SGT    +  +D ND+ P F+  +    I E   +  T+   +ATD D      +++GI    D   L   +++P   I S     +     LD E  + Y+L++   D  S  S+++       ++++D ND  P+F ++ Y+V V E    G+    +  + A D ++G+   I Y +   N   S+F  IDS +G++ L+KPL    +    + I AQD GS  +   T+LL+++ID NDN P          + EN P+   +  V+  D D GAN +++  +                   + KPL  +E      +GR  F  +  +     ++ +  SS  +   D      N+  P F+ ++Y A   E+      +    A D D  S   ++I  G   G F    I  +NG+ ++   I +    + +   ++     D+   + +++V I + D N+  P       +  V E++ + +++  +   D D   NAQ + S + +S     S D  +I+ Q    G I +   LD E                            Y+L V+A+D G PS ++ +++ I +
Sbjct:  406 LFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDS-RSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-SQF-SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREE------QGRFAFQVVAKDGGVPPKSAS--SSVVITVQD-----VNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA---ITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT---GAIVTNAPLDRETTS------------------------GYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 3 Score: 106.686 bits (265), Expect = 4.867e-23
Identity = 150/585 (25.64%), Postives = 234/585 (40.00%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI-------------CPKISGTN---LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLH--STKPLKSKEIL-LNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSPH-------------CNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG-RNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV----LDYEKFQHQLGL 1846
            F ID  SG +S    +D E++              P  S T    +  ID NDN P+F  ++    + EN  + Y +   +A D D        Y + +  D  F L   P    ++ IK LD E+   +   +   D G     +   ++I + D+ND  P F  K Y   V E    G+ +  V A D ++    ++ Y +   N  G   I   +  G I + + L     ++ L+T+ A D G     A   + I+I D N+  P          +FE+ P+   + +V   D D G N +++  L+  S   L S +   +NP  G      +VTN   D+E     S Y L  T  D G+P               N+  P F S  Y A+  E+ L   +VI+ A +D D       +          G F   +ID  +G +     +DRE      L  I ++ G      +S+  V I + D+ND+PP     +    V ENS + S +G I   D D+  NA      V  +     DD  A    V + G  R+ ++    LDYE  + +  L
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRET---TSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF---VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP--LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA------VVHYSIIGGDDSNAFSL-VTRPGSERAQLLTMTELDYESTRKRFEL 1191          

HSP 4 Score: 88.9669 bits (219), Expect = 1.400e-17
Identity = 130/541 (24.03%), Postives = 216/541 (39.93%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDRE--------------AICPKISGTN--LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS--NEYGS-RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNC--TDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQ----INGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIE----SSLGRIKIRDIDQNRNAQFSISS 1720
              +D  +G + T   +DRE               + PK + ++  +   DVNDN P F        + E++     +    ATD D  +    +Y++ T      F + S   +  + + + LD+++ + + L +   D+G       + I I D N+ AP F    YS  V E   VG+ +L V A D++ G   +I Y L +   N  GS     I+ +TG I    PL        L+T+ A+D G+      T + I + DVNDN P       +  I E+  +   +  V   D D G NG++   L S + ++    +++P  G      + TN   D+E+   V+ + L     D GSP               N+ PP F S   +    E     +V+    A       N       I G     F  +     +  +L+ M  +D E T +   L++            + + + I V D+NDN P L    +F+V+ N+  +      +GRI   D D +    + I S
Sbjct:  737 LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIK-YLLSDRDIEDGSFVIDPTSG-----TIRTNKGLDRES---VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILS 1259          
BLAST of Protocadherin gamma-A1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 170.244 bits (430), Expect = 2.716e-43
Identity = 173/695 (24.89%), Postives = 299/695 (43.02%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI-------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQ----INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS---SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            + + + E  PPS  +G L    ++     G   HL ++E  +  P   +D  +G + +T   IDRE +                          P++    +   D+NDN P+F      + +PEN  +     +  ATD D+ + G+ +Y L    +      L          P+L ++  LD E  + Y+L ++  D G+    S   L + I D ND APKF + +Y   V E   +G  +L+V A D++ G  G+I Y L  + +   + +RID  +G IY+  PL   E   +   + A+D G  PK + T + I + D NDN P ++               I E+ P+   +A+V+V DKD G N  V+C +    P + +    + +  + K++ +  T + Y++  D  V    +   D+G+P               N+  P F    +     EE +  E V++   +DAD+ +  E       + +  G F+   ID  +G++    P+DRE  DR +  +   + G+ +   T  ++V+I V+D NDN P+ ++   +F V+EN    S +G + ++D+D+  NAQ  +S    V  F               N  G I S++  D EK                          +Y  ++ A D G P +++Y  +TIN+
Sbjct:   25 ILYRVHEEQPPSTLIGSL--AADQGLPDTG---HLYKLEVGA--PYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVE---IVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFE---IDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQ------------NGTGTILSSISFDREKES------------------------SYTFRLKAVDGGDPPRSSYVGVTINV 668          

HSP 2 Score: 55.8398 bits (133), Expect = 1.981e-7
Identity = 128/555 (23.06%), Postives = 222/555 (40.00%), Query Frame = 2
Query:  215 FHLQQIEYQSEK--PLFVIDQYSGVISTSAEIDREAI----CPKISGTNLPCI--DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQL---HSTKPL-----KSKEILL-NPIKGRHKFYKLVTNVSYDKENDNH--VSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLI---ESSLGRIKIRDIDQNRNAQFSIS 1717
            F LQ  E + EK   L V+      +  S ++  +A+     P+ S   L  +  D NDN PKF+ +    ++ EN  I +++   KA D D    G   Y L  + D    L+       +  +K  LD E++      +   D G     SK  + I++ D ND AP    +   +V        ++E + VG+ +  V   D ++G+         G + ++L  +++       +D+K          L  E++    V I A D G+    +   L + + D NDN P       E++  E NQP   ++ +V   D D G N ++   +    ST+ L      S E+   +P+   HK        + DK   +H   ++  +   D      N+  P F    YS +  E +   + +    + D D     + Q++     G F   +I    G ++     DREK       +  ++ G   +  +S   V I V+D NDN P +   +N   +  S +   +S +  ++  DID   NA+   S
Sbjct:  180 FGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSS-----VDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVV-ASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDR-----NDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKF---VIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPR--SSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYS 718          
BLAST of Protocadherin gamma-A1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 170.629 bits (431), Expect = 2.855e-43
Identity = 173/695 (24.89%), Postives = 299/695 (43.02%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI-------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQ----INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS---SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            + + + E  PPS  +G L    ++     G   HL ++E  +  P   +D  +G + +T   IDRE +                          P++    +   D+NDN P+F      + +PEN  +     +  ATD D+ + G+ +Y L    +      L          P+L ++  LD E  + Y+L ++  D G+    S   L + I D ND APKF + +Y   V E   +G  +L+V A D++ G  G+I Y L  + +   + +RID  +G IY+  PL   E   +   + A+D G  PK + T + I + D NDN P ++               I E+ P+   +A+V+V DKD G N  V+C +    P + +    + +  + K++ +  T + Y++  D  V    +   D+G+P               N+  P F    +     EE +  E V++   +DAD+ +  E       + +  G F+   ID  +G++    P+DRE  DR +  +   + G+ +   T  ++V+I V+D NDN P+ ++   +F V+EN    S +G + ++D+D+  NAQ  +S    V  F               N  G I S++  D EK                          +Y  ++ A D G P +++Y  +TIN+
Sbjct:   25 ILYRVHEEQPPSTLIGSL--AADQGLPDTG---HLYKLEVGA--PYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVE---IVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFE---IDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQ------------NGTGTILSSISFDREKES------------------------SYTFRLKAVDGGDPPRSSYVGVTINV 668          

HSP 2 Score: 55.4546 bits (132), Expect = 2.547e-7
Identity = 114/497 (22.94%), Postives = 199/497 (40.04%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQL---HSTKPL-----KSKEILL-NPIKGRHKFYKLVTNVSYDKENDNH--VSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLI---ESSLGRIKIRDIDQNRNAQF 1708
            D NDN PKF+ +    ++ EN  I +++   KA D D    G   Y L  + D    L+       +  +K  LD E++      +   D G     SK  + I++ D ND AP    +   +V        ++E + VG+ +  V   D ++G+         G + ++L  +++       +D+K          L  E++    V I A D G+    +   L + + D NDN P       E++  E NQP   ++ +V   D D G N ++   +    ST+ L      S E+   +P+   HK        + DK   +H   ++  +   D      N+  P F    YS +  E +   + +    + D D     + Q++     G F   +I    G ++     DREK       +  ++ G   +  +S   V I V+D NDN P +   +N   +  S +   +S +  ++  DID   NA+ 
Sbjct:  235 DANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSS-----VDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVV-ASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDR-----NDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKF---VIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPR--SSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAEL 715          
BLAST of Protocadherin gamma-A1 vs. Ensembl Zebrafish
Match: pcdh19 (protocadherin 19 [Source:ZFIN;Acc:ZDB-GENE-030131-4218])

HSP 1 Score: 158.303 bits (399), Expect = 2.509e-39
Identity = 161/637 (25.27%), Postives = 279/637 (43.80%), Query Frame = 2
Query:   89 CIVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAIC---PK-------------ISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLI---KYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD-SNEYGSRFIRIDSKTGEIYLIKPLLGLEKILV---TIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI----------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGT----------HGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDN------PPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRST 1804
            C        ++ +++ E L    ++  +T   +   +  G      ++   SE P +V    +G++ T  +IDR+A+C   PK             I    +  IDVNDN P+F  N   I+I EN        LE A+D DS   GI  Y +  ++     + +     K+  +   K LD E    Y   L   D G        +L I++ID ND  P F +  Y+V V E   + +L++ ++A D ++G  G+++Y   +  +    +  +ID KTG +  +  +L  E++ +    ++A+D G     A  K+++++ID+NDN PEI          ++ EN PL  ++A+VRV D D GANGKV C+L    P +  E           F  L+ +   D+E  +  +   L   D+G P               N+ PPYF    Y A     +  EN +  A   A +    +  +NGT           G   + ++    NG++  +   + E T        +      +   TS+++V I V+D+NDN      PP + G     + +N+ +   + +IK  D D+  N + +        ++ S+  +A  F++++I GE+R+T
Sbjct:   18 CWTGVDAVFNLKYTVEEELRAGTKIANVTADAKVAGFALGNRQPYLRVISNSE-PRWVNLSPAGLLITKQKIDRDAVCRQTPKCFISLEVMSNSMEICVIKIEIIDVNDNAPRFPTNHIDIEISENAAPGTRFPLEGASDPDSGSNGIQTYTITPNDIFGLEIKTRGDGSKIAELVVEKTLDRETQSRYTFELTAEDGGDPPKSGTVQLNIKVIDSNDNNPVFDEPVYTVNVLENSPINTLVIDLNATDPDEGTNGEVVYSFINFVSNLTKQMFKIDPKTG-VITVNGVLDHEELHIHEIDVQAKDLGPNSIPAHCKVIVNVIDINDNAPEIKLLSENSEMVEVSENAPLGYVIALVRVSDNDSGANGKVQCRLQGNVPFRLNEF--------ESFSTLLVDGRLDREQRDMYNLTIL-AEDSGYPPLRSSKSFAVKVTDENDNPPYFTKPHYQA-----MVLENNVPGAFLLAVSARDPDLGMNGTVSYEIIKSEVRGMSVESYVTVNSNGEIYGVRAFNHEDT--RTFEFKVSAKDGGDPPLTSNATVRIVVLDVNDNTPVMTTPPLVNGTAEVSIPKNAGVGYLVTQIKADDYDEGENGRLT--------YSISEGDMAY-FEIDQINGEVRTT 627          
BLAST of Protocadherin gamma-A1 vs. Ensembl Zebrafish
Match: pcdh19 (protocadherin 19 [Source:ZFIN;Acc:ZDB-GENE-030131-4218])

HSP 1 Score: 157.918 bits (398), Expect = 2.870e-39
Identity = 161/637 (25.27%), Postives = 279/637 (43.80%), Query Frame = 2
Query:   89 CIVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAIC---PK-------------ISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLI---KYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD-SNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI----------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGT----------HGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDN------PPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRST 1804
            C        ++ +++ E L    ++  +T   +   +  G      ++   SE P +V    +G++ T  +IDR+A+C   PK             I    +  IDVNDN P+F  N   I+I EN        LE A+D DS   GI  Y +  ++     + +     K+  +   K LD E    Y   L   D G        +L I++ID ND  P F +  Y+V V E   + +L++ ++A D ++G  G+++Y   +  +    +  +ID KTG +  +  +L  E++    + ++A+D G     A  K+++++ID+NDN PEI          ++ EN PL  ++A+VRV D D GANGKV C+L    P +  E           F  L+ +   D+E  +  +   L   D+G P               N+ PPYF    Y A     +  EN +  A   A +    +  +NGT           G   + ++    NG++  +   + E T        +      +   TS+++V I V+D+NDN      PP + G     + +N+ +   + +IK  D D+  N + +        ++ S+  +A  F++++I GE+R+T
Sbjct:   18 CWTGVDAVFNLKYTVEEELRAGTKIANVTADAKVAGFALGNRQPYLRVISNSE-PRWVNLSPAGLLITKQKIDRDAVCRQTPKCFISLEVMSNSMEICVIKIEIIDVNDNAPRFPTNHIDIEISENAAPGTRFPLEGASDPDSGSNGIQTYTITPNDIFGLEIKTRGDGSKIAELVVEKTLDRETQSRYTFELTAEDGGDPPKSGTVQLNIKVIDSNDNNPVFDEPVYTVNVLENSPINTLVIDLNATDPDEGTNGEVVYSFINFVSNLTKQMFKIDPKTG-VITVNGVLDHEELHIHEIDVQAKDLGPNSIPAHCKVIVNVIDINDNAPEIKLLSENSEMVEVSENAPLGYVIALVRVSDNDSGANGKVQCRLQGNVPFRLNEF--------ESFSTLLVDGRLDREQRDMYNLTIL-AEDSGYPPLRSSKSFAVKVTDENDNPPYFTKPHYQA-----MVLENNVPGAFLLAVSARDPDLGMNGTVSYEIIKSEVRGMSVESYVTVNSNGEIYGVRAFNHEDT--RTFEFKVSAKDGGDPPLTSNATVRIVVLDVNDNTPVMTTPPLVNGTAEVSIPKNAGVGYLVTQIKADDYDEGENGRLT--------YSISEGDMAY-FEIDQINGEVRTT 627          
BLAST of Protocadherin gamma-A1 vs. Ensembl Zebrafish
Match: pcdh19 (protocadherin 19 [Source:ZFIN;Acc:ZDB-GENE-030131-4218])

HSP 1 Score: 157.532 bits (397), Expect = 3.746e-39
Identity = 161/637 (25.27%), Postives = 279/637 (43.80%), Query Frame = 2
Query:   89 CIVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAIC---PK-------------ISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLI---KYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD-SNEYGSRFIRIDSKTGEIYLIKPLLGLEKILV---TIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI----------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGT----------HGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDN------PPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRST 1804
            C        ++ +++ E L    ++  +T   +   +  G      ++   SE P +V    +G++ T  +IDR+A+C   PK             I    +  IDVNDN P+F  N   I+I EN        LE A+D DS   GI  Y +  ++     + +     K+  +   K LD E    Y   L   D G        +L I++ID ND  P F +  Y+V V E   + +L++ ++A D ++G  G+++Y   +  +    +  +ID KTG +  +  +L  E++ +    ++A+D G     A  K+++++ID+NDN PEI          ++ EN PL  ++A+VRV D D GANGKV C+L    P +  E           F  L+ +   D+E  +  +   L   D+G P               N+ PPYF    Y A     +  EN +  A   A +    +  +NGT           G   + ++    NG++  +   + E T        +      +   TS+++V I V+D+NDN      PP + G     + +N+ +   + +IK  D D+  N + +        ++ S+  +A  F++++I GE+R+T
Sbjct:   18 CWTGVDAVFNLKYTVEEELRAGTKIANVTADAKVAGFALGNRQPYLRVISNSE-PRWVNLSPAGLLITKQKIDRDAVCRQTPKCFISLEVMSNSMEICVIKIEIIDVNDNAPRFPTNHIDIEISENAAPGTRFPLEGASDPDSGSNGIQTYTITPNDIFGLEIKTRGDGSKIAELVVEKTLDRETQSRYTFELTAEDGGDPPKSGTVQLNIKVIDSNDNNPVFDEPVYTVNVLENSPINTLVIDLNATDPDEGTNGEVVYSFINFVSNLTKQMFKIDPKTG-VITVNGVLDHEELHIHEIDVQAKDLGPNSIPAHCKVIVNVIDINDNAPEIKLLSENSEMVEVSENAPLGYVIALVRVSDNDSGANGKVQCRLQGNVPFRLNEF--------ESFSTLLVDGRLDREQRDMYNLTIL-AEDSGYPPLRSSKSFAVKVTDENDNPPYFTKPHYQA-----MVLENNVPGAFLLAVSARDPDLGMNGTVSYEIIKSEVRGMSVESYVTVNSNGEIYGVRAFNHEDT--RTFEFKVSAKDGGDPPLTSNATVRIVVLDVNDNTPVMTTPPLVNGTAEVSIPKNAGVGYLVTQIKADDYDEGENGRLT--------YSISEGDMAY-FEIDQINGEVRTT 627          
BLAST of Protocadherin gamma-A1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 161.384 bits (407), Expect = 2.998e-40
Identity = 175/699 (25.04%), Postives = 301/699 (43.06%), Query Frame = 2
Query:  110 SLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT---SEDLPFTLISSPM---QPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL----LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            S  V + + E  PP+  +G L      + Y    H +  ++ +    P   +D  +G + +T   IDRE++                           P++    +  +D+NDN P F      + IPEN  I     +  ATD DS   G+ +Y+L+    ++DL    ++      QP+L ++  LD E+ + Y+L ++V D G  +  S   L I I+D ND APKF +  Y   + E   +G  +L+V A D+++G   +I Y    +++   R + +D  TG I +  P+    +G  K  V   A+D G+ PK A T++ I I D NDN+P I+               I E+ P+   +A+V+V D D G N  V+C +    P + K++       + K++ L T  + D E+   V  Y +     D+G+P               N+  P F          E    ++ V++ +  DAD+   ++       + +  G F    I+  +G++ +   +DRE+  R      ++ +     +   ++SV+ITV+D NDN P+ ++   NF V+EN    S +G + + D D+  NA   +S            +  I    N  G I S++  D E   HQ                       Y  ++ A D G P +++Y  +TIN+
Sbjct:   66 STKVAYRVPEEQPPNILIGSLAS---DYGYPDSKHLYKLELGH----PYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVV--AKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFS---INPDSGQIRVNTVLDREQ--REHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS------VEPESGEFVIQ---NGTGTILSSISFDRE---HQ---------------------STYTFRLKAVDGGDPPRSSYVGVTINV 713          

HSP 2 Score: 57.7658 bits (138), Expect = 7.528e-8
Identity = 112/512 (21.88%), Postives = 196/512 (38.28%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST---KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE---VVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSF 1732
            +D NDN PKF+      ++PEN  + +++   KA D D       +Y    + D    L+       L  ++  +D E V      +   D G+    ++ ++ I I D ND  P    + + +V        ++E + V + +  V   D ++G          G + ++L   ++ GS     DSK          L  E +    + I A D G+ P  +   L + + DVNDN P       E+   EN  ++ ++  V   D D G N     QLH +    P       +NP  G     ++  N   D+E   H   + +   D G P               N+  P F    Y+ +  E + +   V    + DAD        ++     G F I     +NG   ++  I  ++  +      +  +   +   +S   V I V+D NDN P +V  +N     +   +   + +  ++  D+D   NA+  +SI+S   F
Sbjct:  279 LDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-----DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPN----SQLHYSILPDPSARGIFSINPDSG-----QIRVNTVLDREQREHYD-FHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVI-----QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF 770          
BLAST of Protocadherin gamma-A1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 161.384 bits (407), Expect = 3.037e-40
Identity = 175/699 (25.04%), Postives = 301/699 (43.06%), Query Frame = 2
Query:  110 SLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT---SEDLPFTLISSPM---QPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL----LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            S  V + + E  PP+  +G L      + Y    H +  ++ +    P   +D  +G + +T   IDRE++                           P++    +  +D+NDN P F      + IPEN  I     +  ATD DS   G+ +Y+L+    ++DL    ++      QP+L ++  LD E+ + Y+L ++V D G  +  S   L I I+D ND APKF +  Y   + E   +G  +L+V A D+++G   +I Y    +++   R + +D  TG I +  P+    +G  K  V   A+D G+ PK A T++ I I D NDN+P I+               I E+ P+   +A+V+V D D G N  V+C +    P + K++       + K++ L T  + D E+   V  Y +     D+G+P               N+  P F          E    ++ V++ +  DAD+   ++       + +  G F    I+  +G++ +   +DRE+  R      ++ +     +   ++SV+ITV+D NDN P+ ++   NF V+EN    S +G + + D D+  NA   +S            +  I    N  G I S++  D E   HQ                       Y  ++ A D G P +++Y  +TIN+
Sbjct:   66 STKVAYRVPEEQPPNILIGSLAS---DYGYPDSKHLYKLELGH----PYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVV--AKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFS---INPDSGQIRVNTVLDREQ--REHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS------VEPESGEFVIQ---NGTGTILSSISFDRE---HQ---------------------STYTFRLKAVDGGDPPRSSYVGVTINV 713          

HSP 2 Score: 57.3806 bits (137), Expect = 9.120e-8
Identity = 112/512 (21.88%), Postives = 196/512 (38.28%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST---KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE---VVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSF 1732
            +D NDN PKF+      ++PEN  + +++   KA D D       +Y    + D    L+       L  ++  +D E V      +   D G+    ++ ++ I I D ND  P    + + +V        ++E + V + +  V   D ++G          G + ++L   ++ GS     DSK          L  E +    + I A D G+ P  +   L + + DVNDN P       E+   EN  ++ ++  V   D D G N     QLH +    P       +NP  G     ++  N   D+E   H   + +   D G P               N+  P F    Y+ +  E + +   V    + DAD        ++     G F I     +NG   ++  I  ++  +      +  +   +   +S   V I V+D NDN P +V  +N     +   +   + +  ++  D+D   NA+  +SI+S   F
Sbjct:  279 LDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-----DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPN----SQLHYSILPDPSARGIFSINPDSG-----QIRVNTVLDREQREHYD-FHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVI-----QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF 770          
BLAST of Protocadherin gamma-A1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 161.384 bits (407), Expect = 3.464e-40
Identity = 177/700 (25.29%), Postives = 302/700 (43.14%), Query Frame = 2
Query:  110 SLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT---SEDLPFTLISSP----MQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL----LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            S  V + + E  PP+  +G L      + Y    H +  ++ +    P   +D  +G + +T   IDRE++                           P++    +  +D+NDN P F      + IPEN  I     +  ATD DS   G+ +Y+L+    ++DL F L  +      QP+L ++  LD E+ + Y+L ++V D G  +  S   L I I+D ND APKF +  Y   + E   +G  +L+V A D+++G   +I Y    +++   R + +D  TG I +  P+    +G  K  V   A+D G+ PK A T++ I I D NDN+P I+               I E+ P+   +A+V+V D D G N  V+C +    P + K++       + K++ L T  + D E+   V  Y +     D+G+P               N+  P F          E    ++ V++ +  DAD+   ++       + +  G F    I+  +G++ +   +DRE+  R      ++ +     +   ++SV+ITV+D NDN P+ ++   NF V+EN    S +G + + D D+  NA   +S            +  I    N  G I S++  D E   HQ                       Y  ++ A D G P +++Y  +TIN+
Sbjct:   66 STKVAYRVPEEQPPNILIGSLAS---DYGYPDSKHLYKLELGH----PYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVV--AKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFS---INPDSGQIRVNTVLDREQ--REHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS------VEPESGEFVIQ---NGTGTILSSISFDRE---HQ---------------------STYTFRLKAVDGGDPPRSSYVGVTINV 713          

HSP 2 Score: 57.3806 bits (137), Expect = 8.845e-8
Identity = 112/512 (21.88%), Postives = 196/512 (38.28%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST---KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE---VVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSF 1732
            +D NDN PKF+      ++PEN  + +++   KA D D       +Y    + D    L+       L  ++  +D E V      +   D G+    ++ ++ I I D ND  P    + + +V        ++E + V + +  V   D ++G          G + ++L   ++ GS     DSK          L  E +    + I A D G+ P  +   L + + DVNDN P       E+   EN  ++ ++  V   D D G N     QLH +    P       +NP  G     ++  N   D+E   H   + +   D G P               N+  P F    Y+ +  E + +   V    + DAD        ++     G F I     +NG   ++  I  ++  +      +  +   +   +S   V I V+D NDN P +V  +N     +   +   + +  ++  D+D   NA+  +SI+S   F
Sbjct:  279 LDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-----DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPN----SQLHYSILPDPSARGIFSINPDSG-----QIRVNTVLDREQREHYD-FHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVI-----QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF 770          
BLAST of Protocadherin gamma-A1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 160.999 bits (406), Expect = 5.505e-40
Identity = 177/700 (25.29%), Postives = 302/700 (43.14%), Query Frame = 2
Query:  110 SLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT---SEDLPFTLISSP----MQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL----LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            S  V + + E  PP+  +G L      + Y    H +  ++ +    P   +D  +G + +T   IDRE++                           P++    +  +D+NDN P F      + IPEN  I     +  ATD DS   G+ +Y+L+    ++DL F L  +      QP+L ++  LD E+ + Y+L ++V D G  +  S   L I I+D ND APKF +  Y   + E   +G  +L+V A D+++G   +I Y    +++   R + +D  TG I +  P+    +G  K  V   A+D G+ PK A T++ I I D NDN+P I+               I E+ P+   +A+V+V D D G N  V+C +    P + K++       + K++ L T  + D E+   V  Y +     D+G+P               N+  P F          E    ++ V++ +  DAD+   ++       + +  G F    I+  +G++ +   +DRE+  R      ++ +     +   ++SV+ITV+D NDN P+ ++   NF V+EN    S +G + + D D+  NA   +S            +  I    N  G I S++  D E   HQ                       Y  ++ A D G P +++Y  +TIN+
Sbjct:   58 STKVAYRVPEEQPPNILIGSLAS---DYGYPDSKHLYKLELGH----PYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVV--AKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFS---INPDSGQIRVNTVLDREQ--REHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS------VEPESGEFVIQ---NGTGTILSSISFDRE---HQ---------------------STYTFRLKAVDGGDPPRSSYVGVTINV 705          

HSP 2 Score: 57.3806 bits (137), Expect = 1.066e-7
Identity = 112/512 (21.88%), Postives = 196/512 (38.28%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST---KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE---VVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSF 1732
            +D NDN PKF+      ++PEN  + +++   KA D D       +Y    + D    L+       L  ++  +D E V      +   D G+    ++ ++ I I D ND  P    + + +V        ++E + V + +  V   D ++G          G + ++L   ++ GS     DSK          L  E +    + I A D G+ P  +   L + + DVNDN P       E+   EN  ++ ++  V   D D G N     QLH +    P       +NP  G     ++  N   D+E   H   + +   D G P               N+  P F    Y+ +  E + +   V    + DAD        ++     G F I     +NG   ++  I  ++  +      +  +   +   +S   V I V+D NDN P +V  +N     +   +   + +  ++  D+D   NA+  +SI+S   F
Sbjct:  271 LDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-----DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPN----SQLHYSILPDPSARGIFSINPDSG-----QIRVNTVLDREQREHYD-FHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVI-----QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF 762          
BLAST of Protocadherin gamma-A1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 160.229 bits (404), Expect = 8.627e-40
Identity = 177/700 (25.29%), Postives = 302/700 (43.14%), Query Frame = 2
Query:  110 SLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT---SEDLPFTLISSP----MQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL----LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQI----NGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            S  V + + E  PP+  +G L      + Y    H +  ++ +    P   +D  +G + +T   IDRE++                           P++    +  +D+NDN P F      + IPEN  I     +  ATD DS   G+ +Y+L+    ++DL F L  +      QP+L ++  LD E+ + Y+L ++V D G  +  S   L I I+D ND APKF +  Y   + E   +G  +L+V A D+++G   +I Y    +++   R + +D  TG I +  P+    +G  K  V   A+D G+ PK A T++ I I D NDN+P I+               I E+ P+   +A+V+V D D G N  V+C +    P + K++       + K++ L T  + D E+   V  Y +     D+G+P               N+  P F          E    ++ V++ +  DAD+   ++       + +  G F    I+  +G++ +   +DRE+  R      ++ +     +   ++SV+ITV+D NDN P+ ++   NF V+EN    S +G + + D D+  NA   +S            +  I    N  G I S++  D E   HQ                       Y  ++ A D G P +++Y  +TIN+
Sbjct:   66 STKVAYRVPEEQPPNILIGSLAS---DYGYPDSKHLYKLELGH----PYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDL-FGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVV--AKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF-LQTTTALDYES---VKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFS---INPDSGQIRVNTVLDREQ--REHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLS------VEPESGEFVIQ---NGTGTILSSISFDRE---HQ---------------------STYTFRLKAVDGGDPPRSSYVGVTINV 713          

HSP 2 Score: 56.9954 bits (136), Expect = 1.451e-7
Identity = 112/512 (21.88%), Postives = 196/512 (38.28%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHST---KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE---VVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSF 1732
            +D NDN PKF+      ++PEN  + +++   KA D D       +Y    + D    L+       L  ++  +D E V      +   D G+    ++ ++ I I D ND  P    + + +V        ++E + V + +  V   D ++G          G + ++L   ++ GS     DSK          L  E +    + I A D G+ P  +   L + + DVNDN P       E+   EN  ++ ++  V   D D G N     QLH +    P       +NP  G     ++  N   D+E   H   + +   D G P               N+  P F    Y+ +  E + +   V    + DAD        ++     G F I     +NG   ++  I  ++  +      +  +   +   +S   V I V+D NDN P +V  +N     +   +   + +  ++  D+D   NA+  +SI+S   F
Sbjct:  279 LDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-----DSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPN----SQLHYSILPDPSARGIFSINPDSG-----QIRVNTVLDREQREHYD-FHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVI-----QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF 770          
BLAST of Protocadherin gamma-A1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 171.785 bits (434), Expect = 1.226e-43
Identity = 181/726 (24.93%), Postives = 310/726 (42.70%), Query Frame = 2
Query:   98 SATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--CP-KISGTNLPCI--------------------------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF------SSHILL 2029
            SA+ +  V + + E  PP+  +G L        Y      HL ++E  +  P   +D  +G + +T   IDRE +  C  +I G   PCI                          D+NDN P F      + IPEN  I     +  ATD D+   G+ +Y+L    +      L         QP+L ++  LD E+ + Y+L ++V D G+    S   L + ++D ND APKF +  Y   ++E   +G  +++V A D+++G   +I Y    + E   R +R+D  TG I +  P+    L  +  ++ A+D G+ PK A  ++++ + D+NDN P I+               I E+      +A+V+V D+D G N  V+C +    P + ++        + K++ +  T + Y+K  D  +    +   D+G+P               N+  P F          E  K  E V +   +DAD+ S  E     +      G F    I  +NG++ +   +DRE+  R    + ++     + +   +++VL+ V+D NDN P+ ++   NF V+EN    S +G + + D D+  NA+  +S  +             DF + N  G I S++  D E+                           Y  Q+ A D G+P ++ Y  +TIN+ +  +DN+ F      +SH LL
Sbjct:   31 SASHTTQVVYKVPEEQPPNTLIGSLAA-----DYGLPDVGHLYKLEVGA--PYLRVDGKTGDIFTTETSIDREGLRECQNQIPGN--PCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIE---IVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLF---TISPENGEIRVKTSLDREQ--RDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNG----------DFVIQNGTGTILSSLSFDREQQS------------------------TYTFQLKAVDGGVPPRSAYVGVTINV-LDENDNAPFITAPSNTSHRLL 704          
BLAST of Protocadherin gamma-A1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 171.785 bits (434), Expect = 1.226e-43
Identity = 181/726 (24.93%), Postives = 310/726 (42.70%), Query Frame = 2
Query:   98 SATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI--CP-KISGTNLPCI--------------------------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF------SSHILL 2029
            SA+ +  V + + E  PP+  +G L        Y      HL ++E  +  P   +D  +G + +T   IDRE +  C  +I G   PCI                          D+NDN P F      + IPEN  I     +  ATD D+   G+ +Y+L    +      L         QP+L ++  LD E+ + Y+L ++V D G+    S   L + ++D ND APKF +  Y   ++E   +G  +++V A D+++G   +I Y    + E   R +R+D  TG I +  P+    L  +  ++ A+D G+ PK A  ++++ + D+NDN P I+               I E+      +A+V+V D+D G N  V+C +    P + ++        + K++ +  T + Y+K  D  +    +   D+G+P               N+  P F          E  K  E V +   +DAD+ S  E     +      G F    I  +NG++ +   +DRE+  R    + ++     + +   +++VL+ V+D NDN P+ ++   NF V+EN    S +G + + D D+  NA+  +S  +             DF + N  G I S++  D E+                           Y  Q+ A D G+P ++ Y  +TIN+ +  +DN+ F      +SH LL
Sbjct:   31 SASHTTQVVYKVPEEQPPNTLIGSLAA-----DYGLPDVGHLYKLEVGA--PYLRVDGKTGDIFTTETSIDREGLRECQNQIPGN--PCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIE---IVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLF---TISPENGEIRVKTSLDREQ--RDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNG----------DFVIQNGTGTILSSLSFDREQQS------------------------TYTFQLKAVDGGVPPRSAYVGVTINV-LDENDNAPFITAPSNTSHRLL 704          
BLAST of Protocadherin gamma-A1 vs. Ensembl Mouse
Match: Pcdh18 (protocadherin 18 [Source:MGI Symbol;Acc:MGI:1920423])

HSP 1 Score: 165.236 bits (417), Expect = 1.091e-41
Identity = 190/757 (25.10%), Postives = 317/757 (41.88%), Query Frame = 2
Query:  170 LTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPC-----------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPF---TLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFI---RIDSKTGEIYLIKPL--LGLEKILVTIEAQDCG--SVPKFAWTKLLIHIIDVNDNRPEIDI-------------FENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQING----------THGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG----RNNFEVVENSLIESS--LGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDL---TSISQLKPGNYVLQVSAQDQGLP---SKT-------NYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHC 2167
            + +V+ K    + V F       +   PL V+++ +G IS  A+IDRE +C K    NL C                       +D+NDN P+F      I+I E+  +   + L+ A D D  +  +  Y L  ++       T        +L ++K LD E    Y L L   D G         L I I D ND +P F Q +Y++ + E   VG+L+L ++A D ++G  G+I+Y    S+    + I   +IDS+ G + L KP+     +   + ++AQD G  S+P  A  K++I ++DVNDN+PEI I             FE  P+   +AIVRV+DKD G NG++ C+LH     K ++   N        Y ++TN + D+E  +  S   +   D G+P               N+ PP F    Y     E + SEN    A       +  +   NG            G     ++ ID  NG +  +   D E+       ++    G   K  +S+++V++T+ID NDN P ++G     N  E+      ES   + RI++ D D   NA+FS S V                                    ++  +F +D  + D+    S+  +    + L V  QD+G P   +K        +Y+    +  M +   +     +++I+ L   CA+++    VI ++F  +  + ++        +T+ Y+C
Sbjct:   51 VADVLLKLPNPSAVRFRAMP---RGNSPLLVVNENTGEISIGAKIDREQLCQK----NLNCSIEFDVLTLPTEHLQLFHIEVDVLDINDNSPQFSRPVIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSANDYFNIEVRTRTDGAKYAELIVVKELDRELKASYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQPSYTIQLLENSPVGTLLLDLNATDPDEGANGRIVYSF--SSHVSPKIIETFKIDSEKGHLTLFKPVDYEITKSYEIDVQAQDLGPNSIP--AHCKIIIKVVDVNDNKPEISINLMSPGKEEVSYVFEGDPIDTFVAIVRVQDKDSGLNGEIICKLHGHGHFKLQKTYENN-------YLILTNATLDREKRSEYSLTVI-AEDKGTPSLSSVRHFTVQINDINDNPPRFQRSRY-----EFVISENNSPGAYITTVTATDPDLGENGHVTYTILESFVLGSSITTYVTIDPSNGAIYALRIFDHEEV-SQITFVVEARDGGSQKQLSSNTTVVLTIIDENDNVPVVIGPAMHNNTAEISIPKGAESGFHVTRIRVVDRDSGANAEFSCSIVSG----------------------------------NEENIFIMDPRSCDIHTNVSMESIPSAEWALSVIIQDKGSPPLHTKVLLRCMVFDYAESVTSTAMTSVSRASLDVSMIIIISLGAICAVLL----VIMVLFATRCNREKK--------DTRSYNC 736          
BLAST of Protocadherin gamma-A1 vs. Ensembl Mouse
Match: Pcdh18 (protocadherin 18 [Source:MGI Symbol;Acc:MGI:1920423])

HSP 1 Score: 164.851 bits (416), Expect = 2.298e-41
Identity = 190/757 (25.10%), Postives = 317/757 (41.88%), Query Frame = 2
Query:  170 LTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPC-----------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPF---TLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFI---RIDSKTGEIYLIKPLLG--LEKILVTIEAQDCG--SVPKFAWTKLLIHIIDVNDNRPEIDI-------------FENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQING----------THGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG----RNNFEVVENSLIESS--LGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDL---TSISQLKPGNYVLQVSAQDQGLP---SKT-------NYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHC 2167
            + +V+ K    + V F       +   PL V+++ +G IS  A+IDRE +C K    NL C                       +D+NDN P+F      I+I E+  +   + L+ A D D  +  +  Y L  ++       T        +L ++K LD E    Y L L   D G         L I I D ND +P F Q +Y++ + E   VG+L+L ++A D ++G  G+I+Y    S+    + I   +IDS+ G + L KP+     +   + ++AQD G  S+P  A  K++I ++DVNDN+PEI I             FE  P+   +AIVRV+DKD G NG++ C+LH     K ++   N        Y ++TN + D+E  +  S   +   D G+P               N+ PP F    Y     E + SEN    A       +  +   NG            G     ++ ID  NG +  +   D E+       ++    G   K  +S+++V++T+ID NDN P ++G     N  E+      ES   + RI++ D D   NA+FS S V                                    ++  +F +D  + D+    S+  +    + L V  QD+G P   +K        +Y+    +  M +   +     +++I+ L   CA+++    VI ++F  +  + ++        +T+ Y+C
Sbjct:   51 VADVLLKLPNPSAVRFRAMP---RGNSPLLVVNENTGEISIGAKIDREQLCQK----NLNCSIEFDVLTLPTEHLQLFHIEVDVLDINDNSPQFSRPVIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSANDYFNIEVRTRTDGAKYAELIVVKELDRELKASYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQPSYTIQLLENSPVGTLLLDLNATDPDEGANGRIVYSF--SSHVSPKIIETFKIDSEKGHLTLFKPVDYEITKSYEIDVQAQDLGPNSIP--AHCKIIIKVVDVNDNKPEISINLMSPGKEEVSYVFEGDPIDTFVAIVRVQDKDSGLNGEIICKLHGHGHFKLQKTYEN-------NYLILTNATLDREKRSEYSLTVI-AEDKGTPSLSSVRHFTVQINDINDNPPRFQRSRY-----EFVISENNSPGAYITTVTATDPDLGENGHVTYTILESFVLGSSITTYVTIDPSNGAIYALRIFDHEEV-SQITFVVEARDGGSQKQLSSNTTVVLTIIDENDNVPVVIGPAMHNNTAEISIPKGAESGFHVTRIRVVDRDSGANAEFSCSIVSG----------------------------------NEENIFIMDPRSCDIHTNVSMESIPSAEWALSVIIQDKGSPPLHTKVLLRCMVFDYAESVTSTAMTSVSRASLDVSMIIIISLGAICAVLL----VIMVLFATRCNREKK--------DTRSYNC 736          
BLAST of Protocadherin gamma-A1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 159.844 bits (403), Expect = 7.279e-40
Identity = 154/608 (25.33%), Postives = 267/608 (43.91%), Query Frame = 2
Query:  362 NDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF------SSHILL 2029
            NDN P F      + IPEN  I     +  ATD D+   G+ +Y+L    +      L         QP+L ++  LD E+ + Y+L ++V D G+    S   L + ++D ND APKF +  Y   ++E   +G  +++V A D+++G   +I Y    + E   R +R+D  TG I +  P+    L  +  ++ A+D G+ PK A  ++++ + D+NDN P I+               I E+      +A+V+V D+D G N  V+C +    P + ++        + K++ +  T + Y+K  D  +    +   D+G+P               N+  P F          E  K  E V +   +DAD+ S  E     +      G F    I  +NG++ +   +DRE+  R    + ++     + +   +++VL+ V+D NDN P+ ++   NF V+EN    S +G + + D D+  NA+  +S  +             DF + N  G I S++  D E+                           Y  Q+ A D G+P ++ Y  +TIN+ +  +DN+ F      +SH LL
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIE---IVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLF---TISPENGEIRVKTSLDREQ--RDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNG----------DFVIQNGTGTILSSLSFDREQQS------------------------TYTFQLKAVDGGVPPRSAYVGVTINV-LDENDNAPFITAPSNTSHRLL 565          

HSP 2 Score: 85.5001 bits (210), Expect = 1.596e-16
Identity = 90/384 (23.44%), Postives = 161/384 (41.93%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDRE--------------AICPKISGTNLPCI--DVNDNQPKFQ--------HNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-------LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK---ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEY 1276
            L  +D+ +G+I+    +DRE                 PK +   +     D+NDN P  +        H   +  I E+      + L + +D D  +        + + D+PF L  +         KY       LD+EKV+ Y + +   D+G+  L S   L ++++D+ND AP F Q    V   E  K G ++ +V A D + G   +++Y L +          I  + GEI  +K  L  E+     + + A D GS        +L++++D NDN P+         + EN P    + +V V D D+G N +V   +       + + ++    G      +++++S+D+E  +   ++ L   D G P  + Y
Sbjct:  168 LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA--VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSL-EPEPAAQGLFTISPENGEIR-VKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQ----DNGDFVIQNGTG-----TILSSLSFDREQQS-TYTFQLKAVDGGVPPRSAY 537          

HSP 3 Score: 71.2478 bits (173), Expect = 4.261e-12
Identity = 109/505 (21.58%), Postives = 203/505 (40.20%), Query Frame = 2
Query:  350 CIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPH-------------CNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQINGTH-GGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE---VVENSLIESSLGRIKIRDIDQNRNAQFSIS 1717
             +D NDN PKF+      ++ EN  I +++   KA D D       +Y    + ++   L+       L  ++  +D E +      +   D G+    ++ ++++ + D+ND AP    +   +V        ++E +   + +  V   D ++G+         G + ++L  ++E GS     DSK          L  EK+    + I A D G+ P  +   L + ++DVNDN P       E+   EN     ++A V   D D G+N ++   L   +P       ++P  G     ++    S D+E  +   SY L     D GSP              CN+  P F    Y+ +  E + + + +    + D D       Q++     G F   +I    G ++     DRE+       +  ++ G+  +  ++   V I V+D NDN P +   +N     +   + +  ++ ++   DID   NA+ + S
Sbjct:  109 VLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS-----DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP-EPAAQGLFTISPENG-----EIRVKTSLDREQRD---SYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF---VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPR--SAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYS 594          
BLAST of Protocadherin gamma-A1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 5.442e-41
Identity = 173/717 (24.13%), Postives = 303/717 (42.26%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI---------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVI-KFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF------SSHILL 2029
            V + + E  PP+  +G L        Y      HL ++E  +  P   +D  +G + +T   IDRE +                            P++    +   D+NDN P F      + IPEN  I     +  A+D D+   G+ +Y+L    +      L         QP+L ++  LD E+ + Y+L ++V D GS    S   L + ++D ND APKF + +Y   ++E   +G  +++V A D+++G   +I Y    + E   R +R+D  TG I +  P+    L  +  ++ A+D G+ PK A  ++++ + D+NDN P I+               I E+      +A+V+V D+D G N  V+C +    P + ++        + K++ +  T + Y+K  D  +    +   D+G+P               N+  P F          E  K   VI +   +DAD+ S  E     +      G F    I  + G++ +   +DRE+  R    + ++     + +   +++VL+ V+D NDN P+ ++   NF V+EN    S +G + + D D+  NAQ  +S  +             DF + N  G I S++  D E+                           Y  Q+ A D G+P ++ Y  +TIN+ +  +DN+ +      +SH LL
Sbjct:   60 VVYKVPEEQPPNTLIGSLAA-----DYGFPDVGHLYKLEVGA--PYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIE---IVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLF---TISPETGEIQVKTSLDREQ--RESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNG----------DFVIQNGTGTILSSLSFDREQQS------------------------TYTFQLKAVDGGVPPRSAYVGVTINV-LDENDNAPYITAPSNTSHKLL 726          

HSP 2 Score: 92.0485 bits (227), Expect = 1.100e-17
Identity = 107/467 (22.91%), Postives = 190/467 (40.69%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDRE-------AICPKISGTN---------LPCIDVNDNQPKFQ--------HNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-------LDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEY-------------PPYFDSQFYSA---TTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDR 1480
            L  +D+ +G+I+    +DRE       ++  K  GTN         +   D+NDN P  +        H   +  I E+      + L + +D D  +        + + D+PF L  +         KY       LD+EKV+ Y + +   D+G+  L S   L ++++D+ND AP F Q    V   E  K G +I ++ A D + G   +++Y L +          I  +TGEI +   L     E   + + A D GS        +L++++D NDN P+         + EN P    + +V V D D+G N +V   +       + + ++    G      +++++S+D+E  +   ++ L   D G P  + Y              PY  +   ++    T +    E V + A  D D+    E   +   G  + +  I   +G + L   I+R
Sbjct:  329 LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA--VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSL-EPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQ----DNGDFVIQNGTG-----TILSSLSFDREQQS-TYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIER 782          
BLAST of Protocadherin gamma-A1 vs. UniProt/SwissProt
Match: sp|Q8VHR0|PCD18_MOUSE (Protocadherin 18 OS=Mus musculus OX=10090 GN=Pcdh18 PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 1.607e-40
Identity = 190/757 (25.10%), Postives = 317/757 (41.88%), Query Frame = 2
Query:  170 LTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPC-----------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPF---TLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFI---RIDSKTGEIYLIKPLLG--LEKILVTIEAQDCG--SVPKFAWTKLLIHIIDVNDNRPEIDI-------------FENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQING----------THGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG----RNNFEVVENSLIESS--LGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDL---TSISQLKPGNYVLQVSAQDQGLP---SKT-------NYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHC 2167
            + +V+ K    + V F       +   PL V+++ +G IS  A+IDRE +C K    NL C                       +D+NDN P+F      I+I E+  +   + L+ A D D  +  +  Y L  ++       T        +L ++K LD E    Y L L   D G         L I I D ND +P F Q +Y++ + E   VG+L+L ++A D ++G  G+I+Y    S+    + I   +IDS+ G + L KP+     +   + ++AQD G  S+P  A  K++I ++DVNDN+PEI I             FE  P+   +AIVRV+DKD G NG++ C+LH     K ++   N        Y ++TN + D+E  +  S   +   D G+P               N+ PP F    Y     E + SEN    A       +  +   NG            G     ++ ID  NG +  +   D E+       ++    G   K  +S+++V++T+ID NDN P ++G     N  E+      ES   + RI++ D D   NA+FS S V                                    ++  +F +D  + D+    S+  +    + L V  QD+G P   +K        +Y+    +  M +   +     +++I+ L   CA+++    VI ++F  +  + ++        +T+ Y+C
Sbjct:   51 VADVLLKLPNPSAVRFRAMP---RGNSPLLVVNENTGEISIGAKIDREQLCQK----NLNCSIEFDVLTLPTEHLQLFHIEVDVLDINDNSPQFSRPVIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSANDYFNIEVRTRTDGAKYAELIVVKELDRELKASYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQPSYTIQLLENSPVGTLLLDLNATDPDEGANGRIVYSF--SSHVSPKIIETFKIDSEKGHLTLFKPVDYEITKSYEIDVQAQDLGPNSIP--AHCKIIIKVVDVNDNKPEISINLMSPGKEEVSYVFEGDPIDTFVAIVRVQDKDSGLNGEIICKLHGHGHFKLQKTYEN-------NYLILTNATLDREKRSEYSLTVI-AEDKGTPSLSSVRHFTVQINDINDNPPRFQRSRY-----EFVISENNSPGAYITTVTATDPDLGENGHVTYTILESFVLGSSITTYVTIDPSNGAIYALRIFDHEEV-SQITFVVEARDGGSQKQLSSNTTVVLTIIDENDNVPVVIGPAMHNNTAEISIPKGAESGFHVTRIRVVDRDSGANAEFSCSIVSG----------------------------------NEENIFIMDPRSCDIHTNVSMESIPSAEWALSVIIQDKGSPPLHTKVLLRCMVFDYAESVTSTAMTSVSRASLDVSMIIIISLGAICAVLL----VIMVLFATRCNREKK--------DTRSYNC 736          
BLAST of Protocadherin gamma-A1 vs. UniProt/SwissProt
Match: sp|Q9Y5H2|PCDGB_HUMAN (Protocadherin gamma-A11 OS=Homo sapiens OX=9606 GN=PCDHGA11 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.713e-39
Identity = 182/701 (25.96%), Postives = 292/701 (41.65%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAICP-----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTL---ISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEII--DINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADAD----ATSTNEFQINGTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-------GRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQ---VSAQDQGLPSKTNYSNLTINI---------------HMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR 2119
            LF ++  SG + T+  IDRE +C                  KI G  +  ID+NDN P FQ ++  I++ E+        L  A D D     + +Y+L  +      L         P+L L   LD EK   + L+L   D G    K  + I ++  D+ND  P F Q  Y V V E +  G+ +L V+A D ++G  G+++Y   +     S   ++DS+TGE+  ++  L  EK     + I+ QD G +  F  T +LI ++DVNDN PEI        I EN P   ++A++ V+D+D G NG+VSC + +  P K ++   N       +YKL+T+   D+E    V SY   L  TD GSP               N+ PP F    YSA   E   +  ++      D D    A  T     +   G     ++ I+   G L  +   D E+    DL + +I     +   +S+ S+ + V+D NDN PE++       G    E+   S     L  ++   D D  +NA  S   +K+                                   + GLF +   TG++ +   L   + + Q   V+ QD G P  +    LT+ +                +  S+ S  S ++++ +  +    LV +I  V+  + + +W K R
Sbjct:   75 LFAVNPRSGSLITAGRIDREELCETVSSCFLNMELLVEDTLKIYGVEVEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSLQLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIPMFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMESKASEIFQLDSQTGEVQ-VRGSLDFEKYRFYEMEIQGQDGGGL--FTTTTMLITVVDVNDNAPEITITSSINSILENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGN-------YYKLITSRVLDRE---LVQSYNITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQ--FRDLELRVIARDSGDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKA----------------------------------SEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSETSDLSLYLVVAVAAVSCIFLVFVI--VLLALRLWRWHKSR 724          
BLAST of Protocadherin gamma-A1 vs. UniProt/SwissProt
Match: sp|Q5DRC0|PCDGB_PANTR (Protocadherin gamma-A11 OS=Pan troglodytes OX=9598 GN=PCDHGA11 PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.700e-39
Identity = 182/701 (25.96%), Postives = 292/701 (41.65%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAICP-----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTL---ISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEII--DINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADAD----ATSTNEFQINGTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-------GRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQ---VSAQDQGLPSKTNYSNLTINI---------------HMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR 2119
            LF ++  SG + T+  IDRE +C                  KI G  +  ID+NDN P FQ ++  I++ E+        L  A D D     + +Y+L  +      L         P+L L   LD EK   + L+L   D G    K  + I ++  D+ND  P F Q  Y V V E +  G+ +L V+A D ++G  G+++Y   +     S   ++DS+TGE+  ++  L  EK     + I+ QD G +  F  T +LI ++DVNDN PEI        I EN P   ++A++ V+D+D G NG+VSC + +  P K ++   N       +YKL+T+   D+E    V SY   L  TD GSP               N+ PP F    YSA   E   +  ++      D D    A  T     +   G     ++ I+   G L  +   D E+    DL + +I     +   +S+ S+ + V+D NDN PE++       G    E+   S     L  ++   D D  +NA  S   +K+                                   + GLF +   TG++ +   L   + + Q   V+ QD G P  +    LT+ +                +  S+ S  S ++++ +  +    LV +I  V+  + + +W K R
Sbjct:   75 LFAVNPRSGSLITAGRIDREELCETVSSCFLNMELLVEDTLKIYGVEVEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSLQLRGRTDGAKNPELVLEGSLDREKEAAHLLLLTALDGGDPIRKGAVPIRVVVLDVNDHIPMFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMYSFRNMESKASEIFQLDSQTGEVQ-VRGSLDFEKYRFYEMEIQGQDGGGL--FTTTTMLITVVDVNDNAPEITITSSINSILENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGN-------YYKLITSRVLDRE---LVQSYNITLTATDQGSPPLSAETHIWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQ--FRDLQLRVIARDSGDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKA----------------------------------SEPGLFAVGEHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSEASDLSLYLVVAVAAVSCIFLVFVI--VLLALRLWRWHKSR 724          
BLAST of Protocadherin gamma-A1 vs. UniProt/SwissProt
Match: sp|Q9Y5G5|PCDG8_HUMAN (Protocadherin gamma-A8 OS=Homo sapiens OX=9606 GN=PCDHGA8 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.553e-38
Identity = 179/710 (25.21%), Postives = 293/710 (41.27%), Query Frame = 2
Query:  218 HLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICP-----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPF---TLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGT----HGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-------GRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQ---VSAQDQGLPSKTNYSNLTINIH-------------MPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR 2119
            H  +I  +    LF ++  SG + T+  IDRE +C                  K+ G  +  ID+NDN PKFQ     ++I E         L +A D D     + +Y+L  +        T  +  + P+L L + LD E+   ++LVL   D G     S  ++ + ++D ND AP F    Y V V E +  G+ +L V A D ++G  GK+ Y+    NE  +   +++  TGEI + K L   E     + I+A+D G++     TKLLI + DVNDNRPE+        + EN     ++A + V D+D G NG+V C      P K ++ + N       +Y+LVT    D+EN   VS Y +    +D G+P               N+ PP F    YSA   E  L+  ++      D D+    +   + T     G     +I I+   G L  +   D E+    DL +++      +   +S+ S+ + V+D NDN PE++       G    E+   S     L  ++   D D  +NA  S   +K+                                   + GLF +   TG++ +   L   + + Q   V+ QD G P  +    LT+ +               P+ D +  S  + L++ +     + +   AV+  + + +W K R
Sbjct:   62 HGVRIVSRGRTQLFALNPRSGSLITAGRIDREELCAQSPRCLININTLVEDKGKLFGVEIEIIDINDNNPKFQVEDLEVKINEIAVPGARYPLPEAVDPDVGVNSLQSYQLSPNHHFSLDVQTGDNGAINPELVLERALDREEEAAHHLVLTASDGGKPPRSSTVRIHVTVLDTNDNAPVFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKFRKINEKQTPLFQLNENTGEISIAKSLDYEECSFYEMEIQAEDVGAL--LGRTKLLISVEDVNDNRPEVIITSLFSPVLENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGN-------YYRLVTRKYLDREN---VSIYNITVMASDLGTPPLSTETQIALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPDSQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQSFDYEQI--RDLQLLVTASDSGDPPLSSNMSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQNAWLSYRLLKA----------------------------------SEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLTELGSLKPSVDPNDSSLTLYLVVAVAAISCVFLAFVAVLLGLRLRRWHKSR 723          
BLAST of Protocadherin gamma-A1 vs. TrEMBL
Match: A0A183SFK8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3006 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.477e-46
Identity = 181/650 (27.85%), Postives = 283/650 (43.54%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAICPKISGTNLPCI-----------------------------------------DVNDNQPKFQH------------NKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKL----IKYLDFEKVELYNLVLEVCDTGS---LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD-SNEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-------------------------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGR-HKFYKLVTNVSYDKE-NDNHVSSYFLNCTDNGSP-------------HCNEYPPYF--DSQFYSATTTEELKSEN-VIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXX----------XXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSL-GRIKIRDIDQNRNA--QFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYEKF-QHQL 1840
            LF  D+++G +  +  IDRE ICP+    N+P                                           D+ND+ PKFQH            +  ++ I E   I Y + L  ATD D    G+  Y LLT +D   +  +   QP  +L    +  LD EK   Y+ VL  CD G    LC+ Q L I + D+ND  P F +  Y V ++E L VGS++  V A D + G FGKI Y++G   ++  S +  +D  TGE+ +  PL      ++ + I AQD G +PK   T L I + DVN++ P + I                          ENQP+   + I+R  D D G NG V+C L S        +L +    R  K Y L +NV +D E   N + +  + C+D G+P               NEY  YF  D+  Y A  +E+++    V+     D D+T+  +F ++     +F+   +D+  G++  +  +DRE+   I           +     + G      + +++V + + D+NDN P L G+ +F+V EN    S + G++   D D   N    F + SV        +      F++N + G+I + V LD+E F Q+QL
Sbjct:   80 LFRADKHTGKLLVAQRIDRETICPQ--KNNVPFTMESSNAQNFDGVVQPEDAICRVELSAYIPPEHWVNIIVVVKDINDHAPKFQHVLPNSMILGTSKSPYVLYISEGVNIGYQVPLIGATDEDYGINGVQTY-LLTGKDFDKSTFAVNYQPPYELNLVVLSKLDHEKKTSYSGVLTACDGGKPTPLCTNQLLTIFVTDVNDNRPVFERALYEVNISENLTVGSVVTTVRATDQDSGTFGKIRYQIGQIYDQSQSDYFELDEWTGEVRVRIPLQAKFASRVHIPILAQDGGPIPKVGNTLLQIDVEDVNNHAPTLIITPMVTPNSRSLGSTSESSNQVQLWLEENQPVGTQIGIIRTGDDDVGINGDVTCNLISNYTFF---LLTHSNSARERKIYSLQSNVRFDHEQTQNPILTADIECSDAGTPPLVTRQGIQVNILDVNEYQAYFPEDATNYFADISEDVQPGTFVVTVRAVDRDSTAIMQFTLSEEAQKFFR---VDELTGQIYTIEHLDREQAGEIRFAVRVHDGDDVENSSDHSGDGGGKISRTANVTVRITDVNDNSPRLEGQRHFQVFENRPAYSDMIGQLVASDPDAGENGTVNFKLVSVMPVVNEVPNGT----FEINPLTGKIYAKVSLDHEMFTQYQL 716          
BLAST of Protocadherin gamma-A1 vs. TrEMBL
Match: A0A0R3VT89 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS439 PE=4 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 1.908e-45
Identity = 191/646 (29.57%), Postives = 282/646 (43.65%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAICPKISGT-----------------------------------NLPCI--DVNDNQPKFQHN------------KRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSE--DLPFTL-ISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS---LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLG---DSNEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHST-KPLKSKEILLNPIKGR-HKFYKLVTNVSYDKEN--DNHVSSYFLNCTDNGSPH-------------CNEYPPYF---DSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSS----SSVLITVIDINDNPPELVGRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYE---KFQHQLGLFDLDR 1861
            LF ID  SG +  S  IDREAICP+  GT                                   N+  I  D+ND+ P+FQHN              I+ I E   I Y + L  ATD D+   GI +Y L  S+  +  F L    P +  L + K LDFE+   Y   ++VCD G     C+ Q + I I D ND  P F ++ Y V ++ET  V ++I  V A D + G FGKI YR G   D N     F  I+  TGE+++  PL    L  + + I AQD G++PK     L I I DVN++ P I+                     + ENQP+   L I+   D+D G NG+VSC+L     P +    L     GR  K Y L + + +D E    +   +  + C+D G+P               NEYP YF    S        +      V+     D DAT   +F++  +    F+   ID  +G++  +   DRE+ ++I   + ++ + + +     S    ++V + + DINDN P L   + F ++EN    S L G++K  D D   N         +  F  S+D     F +N I G+I +  VLD E   ++Q ++ + DL R
Sbjct:   71 LFRIDGNSGKLVVSGRIDREAICPQQGGTPASNSLASHLLGNTDNSPSKCQVDFIAHIPPDHWINIAVIVEDINDHAPQFQHNDPNEFGGRITNPPYIVFISEGVSIGYEVPLNGATDEDADSNGIQSYSLCGSDIDNSTFALKFVPPAELNLVVKKKLDFEEKTSYKGQIKVCDGGRPTPQCAFQNISIFITDSNDNNPHFDKEFYEVKISETTPVMTIIAAVTAKDADSGGFGKITYRFGQIYDRNVI--NFFGINENTGEVWVKSPLDAKILSHLKIPIIAQDGGTIPKTGTAMLQIDIEDVNNHPPWIEVKPISPPVGMKKSTDGFVQLWVEENQPIGTQLGIILTGDRDIGTNGEVSCELKGNDSPFR----LSYSSSGRERKMYSLQSTIRFDLEAMLPHTPIALQVECSDGGNPKMISRQNIQVNIVDVNEYPSYFTKTQSNLVVHLPEDAPPGSLVVDIQATDRDATPKMKFELVDSSSNLFR---IDSSSGRVYTIGSFDREQIEKIYFAVRVVEMDVLDPRIPPSGYEIANVTLVLDDINDNSPVLESISTFRILENRPAYSDLVGQLKAFDPDLGENG--------TVRFMSSNDL----FDINPISGKIYAKAVLDRETVSQYQLEIEITDLGR 695          
BLAST of Protocadherin gamma-A1 vs. TrEMBL
Match: A0A0R3S941 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS731 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.815e-43
Identity = 187/660 (28.33%), Postives = 283/660 (42.88%), Query Frame = 2
Query:  206 GVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGT-----------------------------NLPCI-----DVNDNQPKFQHNKR------------IIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLL------TSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG---SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS-NEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID----------------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGR-HKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPH-------------CNEYPPYF---DSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVL--ITVI--DINDNPPELVGRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYE---KFQHQLGLFDLDR 1861
            GV  +  Q+       LF +D  SG+++ +  IDRE ICP+  G                              NL  I     D+ND+ P F+++              I+ I E   + Y + +  ATD D+  +GI +Y L       T+  L + L   P +  L + K LD+E+   Y   L+ CD G     C+ Q + I I DIND  P F ++ Y+V ++E   V S+I+ V A D + G+ G++ YR G + ++  + F  I+  TGE+++  PL    L    + + AQD G++PK   T L I + DVN++ P I+                      I ENQP+   + I+   DKD G NG+VSC L   K   S   L +   GR  K Y L + V +D E  N  S   L   C+D+G+P               NE+P YF    S        +      V K    D D T   EF++   HGG F    ID  +G +      DRE   ++   + +++  + +     + S L  +TVI  D+NDN P L     F++ EN    + L G++K  D D   N      S  +             F VN + G+I S  +LD E   ++Q  + + DL R
Sbjct:   59 GVQLYEDQV-----TGLFQVDGKSGILTVAGRIDREVICPQRGGISSTSSSSSGLTANSLSTCQIEFIAHIPPDNLINIAVTVEDINDHAPIFKNSGTNQLGSRVSSSSYIVYISEGVSVGYEVPINGATDEDAGSYGIQSYSLSIDDGDNTTFALRYVL---PSELNLIVKKKLDYEEKTAYRGQLKACDGGMPTPKCAVQNITIFITDINDNKPHFDKELYTVRISEATPVMSVIIAVTATDADSGELGRLTYRFGQTYDQIVTNFFGINEITGEVWVKSPLDAKVLSHFKIPVIAQDGGTIPKTGSTVLQIDVDDVNNHPPWIEVKPIISPLYVKKPIKDGYIQLWIEENQPVGTQIGIILTGDKDVGPNGEVSCNL---KDKDSAFRLRHSSSGRERKMYSLQSKVQFDLEAMNLNSPLKLQVECSDSGNPKLVTQQNIQVNVVDVNEFPAYFTKSQSNVIVHIPEDTPPGSLVTKIQATDRDTTPKMEFRLENDHGGLFN---IDSSSGNVFTQGKFDREVQSQVHFSVRLLDSDILDSIIPRAGSDLANVTVILNDVNDNSPILESGRTFKIFENRAAHADLIGQLKAYDPDLGENGTVRFISSNNI------------FDVNPVTGKIYSKTILDREAVAQYQLDIEITDLGR 692          
BLAST of Protocadherin gamma-A1 vs. TrEMBL
Match: A0A564YWS8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9896 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.205e-43
Identity = 187/660 (28.33%), Postives = 283/660 (42.88%), Query Frame = 2
Query:  206 GVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGT-----------------------------NLPCI-----DVNDNQPKFQHNKR------------IIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLL------TSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG---SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS-NEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID----------------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGR-HKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPH-------------CNEYPPYF---DSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVL--ITVI--DINDNPPELVGRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYE---KFQHQLGLFDLDR 1861
            GV  +  Q+       LF +D  SG+++ +  IDRE ICP+  G                              NL  I     D+ND+ P F+++              I+ I E   + Y + +  ATD D+  +GI +Y L       T+  L + L   P +  L + K LD+E+   Y   L+ CD G     C+ Q + I I DIND  P F ++ Y+V ++E   V S+I+ V A D + G+ G++ YR G + ++  + F  I+  TGE+++  PL    L    + + AQD G++PK   T L I + DVN++ P I+                      I ENQP+   + I+   DKD G NG+VSC L   K   S   L +   GR  K Y L + V +D E  N  S   L   C+D+G+P               NE+P YF    S        +      V K    D D T   EF++   HGG F    ID  +G +      DRE   ++   + +++  + +     + S L  +TVI  D+NDN P L     F++ EN    + L G++K  D D   N      S  +             F VN + G+I S  +LD E   ++Q  + + DL R
Sbjct:   59 GVQLYEDQV-----TGLFQVDGKSGILTVAGRIDREVICPQRGGISSTSSSSSGLTANSLSTCQIEFIAHIPPDNLINIAVTVEDINDHAPIFKNSGTNQLGSRVSSSSYIVYISEGVSVGYEVPINGATDEDAGSYGIQSYSLSIDDGDNTTFALRYVL---PSELNLIVKKKLDYEEKTAYRGQLKACDGGMPTPKCAVQNITIFITDINDNKPHFDKELYTVRISEATPVMSVIIAVTATDADSGELGRLTYRFGQTYDQIVTNFFGINEITGEVWVKSPLDAKVLSHFKIPVIAQDGGTIPKTGSTVLQIDVDDVNNHPPWIEVKPIISPLYVKKPIKDGYIQLWIEENQPVGTQIGIILTGDKDVGPNGEVSCNL---KDKDSAFRLRHSSSGRERKMYSLQSKVQFDLEAMNLNSPLKLQVECSDSGNPKLVTQQNIQVNVVDVNEFPAYFTKSQSNVIVHIPEDTPPGSLVTKIQATDRDTTPKMEFRLENDHGGLFN---IDSSSGNVFTQGKFDREVQSQVHFSVRLLDSDILDSIIPRAGSDLANVTVILNDVNDNSPILESGRTFKIFENRAAHADLIGQLKAYDPDLGENGTVRFISSNNI------------FDVNPVTGKIYSKTILDREAVAQYQLDIEITDLGR 692          
BLAST of Protocadherin gamma-A1 vs. TrEMBL
Match: A0A0R3TQS6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9899 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 5.683e-43
Identity = 195/688 (28.34%), Postives = 290/688 (42.15%), Query Frame = 2
Query:  116 DVTFSISENLPPSNRVG-ILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGT-----------------------------NLPCI-----DVNDNQPKFQHNK------------RIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQP-KLKLI--KYLDFEKVELYNLVLEVCDTGS---LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS-NEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF----------------------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGR-HKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPH-------------CNEYPPYFDS-QFYSATTTEELKSEN--VIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVL--ITVI--DINDNPPELVGRNNFEVVENSLIESSL-GRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYE---KFQHQLGLFDLDR 1861
            ++ +S+ E       +G IL +        +G    +Q  E Q+   LF +D  +G ++ +  IDREAICP+  G                              NL  I     D+ND+ P+F+ +              I+ I E   + Y + +  ATD D+   GI +Y L   +D   T     + P +L LI  K LD+E    Y   +  CD G     C+ Q + I I DIND  P F +  Y+V ++E   V S+IL V A D + G+ G++ YR G + ++    F  ++  TGEI++  PL    +      + AQD G++PK   T + + I DVN++ P I+I                       ENQP+   + I+   DKD G NG V C L       S   L +   GR  K Y L + V +D E+ N  S   L   C+D G P               NE+P +F   Q   A    E  S    V K    D DAT   EF++    GG F   IID  NG +      DRE   ++   + +++  + N     + S L  +TVI  D+NDN P L     F V+EN    + L G+++  D D   N      +V+    N         F VN + G+I S  +LD E   ++   + + DL R
Sbjct:   23 EIIYSVQEESENGTFIGDILADSGSSDLATSGGDIGVQLYEDQATG-LFQVDGKTGKLTVAGRIDREAICPQRGGISSVASFSPGLIANSLSTCQIEFIAHIPPDNLINIAVTVEDINDHTPRFKTDSTNQLTSRTSGSSNIVYISEGVSVGYEVPINGATDEDAGSNGIQSYSLSIDDDDGTTFALRYVLPSELNLIVKKKLDYETKTAYRGQIISCDGGKPTPRCAVQNITIAITDINDNMPHFDKDLYTVRISEATPVSSVILSVSATDADSGELGRLTYRFGQTYDQNVGVFFGVNENTGEIWVKSPLDAKVMSHFKFPVTAQDGGTIPKTGSTMVQVDIDDVNNHAPWIEIKPINSPLYAKKPTKDGYIQLWIEENQPVGTQIGIILTGDKDVGPNGDVFCTLDDK---DSSFRLRHSSSGRGRKMYSLQSKVQFDLESMNLNSPIRLQVECSDLGKPKLITKQSIQVNVIDVNEFPAFFTKVQSNVAVHIPEDTSPGSLVTKIQATDRDATPKMEFRLENDQGGLF---IIDSSNGNVFTQEKFDREVQSQVHFSVRLLDSDISNSIIPQARSDLANVTVILDDVNDNSPVLESSRTFSVLENRAAYADLIGQLRAYDPDLGENG-----TVRFLTSNNL-------FDVNPVTGKIYSKAILDREAVAQYHLDIEITDLGR 691          
BLAST of Protocadherin gamma-A1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 159.073 bits (401), Expect = 9.941e-40
Identity = 171/696 (24.57%), Postives = 299/696 (42.96%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI-------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQ-------PKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQ----INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS---SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            + + + E  PP+  +G L    ++    +G   HL ++E  +  P   +D  +G + +T   IDRE +                          P++    +   D+NDN P+F      + + EN  +  T  + +ATD D+ + G+  Y L    +    L S  M        P+L ++  LD E  + Y+L +   D G  S  S   L + I D ND AP+F + +Y   V+E   VG  +L+V A D++ G  G+I Y +  +++   + ++I+  TG I +  PL   E       + A+D G  PK + T + I + D NDN P ++               I E+ P+   +A+V+V DKD G N  V+C +    P + +    + +  + K++ +  T + Y++  D  V    +   D+G+P               N+  P F    +     EE +  E V+     DAD+ +  E       + +  G F+   ID  +G++    P+DRE  +R +  +   + G+ +   T  ++V+I V+D NDN P+ ++   +F V+EN    S +G + + D+D+  NAQ  +S    V +F               N  G I S++  D EK                          +Y  ++ A D G P +++Y  +TIN+
Sbjct:   25 ILYHVREEQPPNTLIGSL--AADQGLPDSG---HLYKLEVGA--PYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEA-SALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVE---IVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFE---IDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ------------NGTGTILSSISFDREKES------------------------SYTFRLKAVDGGEPPRSSYVGVTINV 668          

HSP 2 Score: 53.9138 bits (128), Expect = 6.827e-7
Identity = 122/530 (23.02%), Postives = 214/530 (40.38%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED-LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKF------IQKNYSVVVN--ETLKVGSLILKVHAYDNEKGD--------FGKILYRL---GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQL---HSTKPL-----KSKEILL-NPIKGRHKFYKLVTNVSYDKENDNH--VSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLI---ESSLGRIKIRDIDQNRNAQ--FSISSVKS---FCFNKSDDKIAIDFQVNK 1783
            D NDN P+F+ +    ++ EN  + Y++   KA D D    G   Y +  + D +P  L        + +   LD E++  +   +   D G     S   + IE+ D ND AP        ++ +   V N  E + VG+ +  V   D ++G+         G + ++L   GDS+        +D+K          L  E+I    V I A D G+    +   L + + D NDN P       E++  E NQP   +L ++ + D D G N ++   +    ST+ L      S E+   +P+   HK        + DK   +H   ++  +   D      N+  P F    YS +  E +   + +    + D D     + Q++     G F   ++    G ++     DREK       +  ++ G   +  +S   V I V+D NDN P +   +N      S +   +S +  ++  DID   NA+  +SI+       F  + SD +I +  ++ +
Sbjct:  235 DANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSS--------VDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIAL-DADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDR-----NDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNF---VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR--SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTR 745          
BLAST of Protocadherin gamma-A1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 159.073 bits (401), Expect = 1.203e-39
Identity = 171/696 (24.57%), Postives = 299/696 (42.96%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI-------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQ-------PKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQ----INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS---SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            + + + E  PP+  +G L    ++    +G   HL ++E  +  P   +D  +G + +T   IDRE +                          P++    +   D+NDN P+F      + + EN  +  T  + +ATD D+ + G+  Y L    +    L S  M        P+L ++  LD E  + Y+L +   D G  S  S   L + I D ND AP+F + +Y   V+E   VG  +L+V A D++ G  G+I Y +  +++   + ++I+  TG I +  PL   E       + A+D G  PK + T + I + D NDN P ++               I E+ P+   +A+V+V DKD G N  V+C +    P + +    + +  + K++ +  T + Y++  D  V    +   D+G+P               N+  P F    +     EE +  E V+     DAD+ +  E       + +  G F+   ID  +G++    P+DRE  +R +  +   + G+ +   T  ++V+I V+D NDN P+ ++   +F V+EN    S +G + + D+D+  NAQ  +S    V +F               N  G I S++  D EK                          +Y  ++ A D G P +++Y  +TIN+
Sbjct:   61 ILYHVREEQPPNTLIGSL--AADQGLPDSG---HLYKLEVGA--PYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEA-SALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVE---IVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFE---IDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGT--ATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ------------NGTGTILSSISFDREKES------------------------SYTFRLKAVDGGEPPRSSYVGVTINV 704          

HSP 2 Score: 54.299 bits (129), Expect = 5.086e-7
Identity = 122/530 (23.02%), Postives = 214/530 (40.38%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED-LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKF------IQKNYSVVVN--ETLKVGSLILKVHAYDNEKGD--------FGKILYRL---GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQL---HSTKPL-----KSKEILL-NPIKGRHKFYKLVTNVSYDKENDNH--VSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLI---ESSLGRIKIRDIDQNRNAQ--FSISSVKS---FCFNKSDDKIAIDFQVNK 1783
            D NDN P+F+ +    ++ EN  + Y++   KA D D    G   Y +  + D +P  L        + +   LD E++  +   +   D G     S   + IE+ D ND AP        ++ +   V N  E + VG+ +  V   D ++G+         G + ++L   GDS+        +D+K          L  E+I    V I A D G+    +   L + + D NDN P       E++  E NQP   +L ++ + D D G N ++   +    ST+ L      S E+   +P+   HK        + DK   +H   ++  +   D      N+  P F    YS +  E +   + +    + D D     + Q++     G F   ++    G ++     DREK       +  ++ G   +  +S   V I V+D NDN P +   +N      S +   +S +  ++  DID   NA+  +SI+       F  + SD +I +  ++ +
Sbjct:  271 DANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSS--------VDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIAL-DADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDR-----NDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNF---VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR--SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTR 781          
BLAST of Protocadherin gamma-A1 vs. Ensembl Cavefish
Match: ENSAMXT00000050733.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10707461:10713100:1 gene:ENSAMXG00000042154.1 transcript:ENSAMXT00000050733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 1.805e-36
Identity = 130/469 (27.72%), Postives = 207/469 (44.14%), Query Frame = 2
Query:  110 SLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQ-------SEKPLFVIDQYSGVISTSAEIDREAICPK-----------------ISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPF---TLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGS-RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALA 1360
            S  + +S+SE + P   VG L +          ++  L ++E +       S K  F ++  +G +     IDRE +CP                  +   ++  +DVNDN P F+   + I+I E         L  A D D     + +YKL  ++       T   S   P+L L K LD EK     L+L   D G  +      +++ ++D ND AP F ++ Y   V E   VG +ILK++A D ++G  G+I+Y   +  +  S RFI I+S +GEI +  PL    +    + +EA+D G  P  +  K+L+ ++DVNDN P+I       ++ E      ++A + V+DKD G NG V C + +  P      +L   +G  K+Y LV     D+E  N + +  +  TD G P               N+ PP F  QF +    E   +  +I    A
Sbjct:   24 SRQIVYSVSEEVSPGTFVGPLAK---------DLNLKLDELESRALRIVSTSSKKHFDVNMKTGALFVQKAIDREEVCPNSNVCTESLEAIVNNPLNVYSIDVKILDVNDNTPTFRGKYQHIKISEQTMPGAKFPLLSAEDPDVGSNSVASYKLSNNQFFSLEVNTEAESGPSPELVLQKALDREKQAEIQLILTAVDGGRPARSGTASIVVSVLDANDNAPTFAKQVYKARVPENAAVGMVILKLNATDPDEGVNGEIIYTFKEGQKGVSDRFI-INSSSGEIAIAGPLDYEDVSAYELRVEARDKGHSPLASHCKVLVEVLDVNDNAPDIKLTSLLDNVSEGAKKGSVIAFITVQDKDEGKNGIVHCSISNNSPF-----ILESTQG--KYYSLVLGQELDREQ-NELYNVSITATDEGIPPLSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAGGLIALVSA 474          

HSP 2 Score: 77.0258 bits (188), Expect = 5.281e-14
Identity = 115/504 (22.82%), Postives = 203/504 (40.28%), Query Frame = 2
Query:  611 EVCDTGSLCSKQ------------KLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---------VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNG-SP---HC---------NEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHM 1987
            EVC   ++C++              + ++I+D+ND  P F  K   + ++E    G+    + A D + G      Y+L + N++ S  +  ++++G      P L L+K L         + + A D G   +     +++ ++D NDN P       +  + EN  + +++  +   D D G NG++       +   S   ++N   G     ++      D E+   VS+Y L     D G SP   HC         N+  P           +E  K  +VI F  + D D         + ++   F +     K   L+L   +DRE+ +  ++ I   + G+     +S++ V + V D+NDNPP  + +  N  V ENS     +  +  +DID   N+Q + S      F KS    A+    +  GEI S    +YE+ +H                        +  QV A D G P  +  SN+T+N+ +
Sbjct:   90 EVCPNSNVCTESLEAIVNNPLNVYSIDVKILDVNDNTPTFRGKYQHIKISEQTMPGAKFPLLSAEDPDVGSNSVASYKLSN-NQFFSLEVNTEAESGP----SPELVLQKALDREKQAEIQLILTAVDGGRPARSGTASIVVSVLDANDNAPTFAKQVYKARVPENAAVGMVILKLNATDPDEGVNGEIIYTFKEGQKGVSDRFIINSSSG-----EIAIAGPLDYED---VSAYELRVEARDKGHSPLASHCKVLVEVLDVNDNAPDIKLTSLLDNVSEGAKKGSVIAFITVQDKDEGKNGIVHCSISNNSPFILESTQGKYYSLVLGQELDREQNELYNVSITATDEGIPP--LSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAGGLIALVSAQDIDIGENSQVTYS-----LFAKSYLSSAVSIN-SMTGEIYSMQSFNYEEIKH------------------------FQFQVQATDSGTPPLS--SNVTVNVFI 546          
BLAST of Protocadherin gamma-A1 vs. Ensembl Cavefish
Match: pcdh18b (protocadherin 18b [Source:ZFIN;Acc:ZDB-GENE-080804-1])

HSP 1 Score: 147.902 bits (372), Expect = 3.694e-36
Identity = 154/592 (26.01%), Postives = 253/592 (42.74%), Query Frame = 2
Query:  164 GILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPK-------ISGTNLPC------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLIS---SPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD--SNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCG--SVPKFAWTKLL----------IHIIDVNDNRPEID-IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTN--------EFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGR----------IKIRDIDQNRNAQFSISSV 1723
            G+ + V  +FR   G           S  PL  + +  G IS ++ IDREA+C +       +    LP             +DVND+ P+F  +   ++I E+  +   + L+ A D D  +  + +Y L  SE     + +      + +L + + LD E    + L L   D G+        L I ++D ND +P F Q+ Y+V V E+   G+L++ ++A D ++G  GK++Y  G     +    F RIDS+TG + LIK L         + ++AQD G  SVP      +           I++  ++  + E+  + E  P+   +A+VRV+D D G NG+V+C+LH     + ++   N        Y ++TNVS D+E  +  S   +   D GSP               N+ PP F+   Y    +E       +   +AD      N        E QI G+    +    ID  NG +  +   DRE+        +    G    + +S+++V+ITV+D NDN P +V      ++ N   +  L R          +K  D D   N + S S V
Sbjct:   47 GLPSSVSPRFRAMDG-----------SGTPLLSVREEDGEISVASRIDREALCAQQPNCTVELDVATLPTEHLRLFRVRVDVLDVNDHAPRFARSVVPVEISESAAVGTRVPLDGAWDPDVGENALRSYSLARSEQFRLEVRARADGSRRAELVVARELDREARASHELQLTAADAGTPPRTGSTLLRIRVLDSNDNSPAFEQQAYAVSVPESAPPGTLLVDLNATDPDEGSNGKVVYSFGPHVPQKILDTF-RIDSETGHLTLIKKLDYEASSSYEIDVQAQDMGPNSVPGHCKVVVKVVDVNDNKPRINVNLMSQGKDEVAYVSEAAPVDTFVALVRVDDSDSGPNGEVTCRLHGHGHFRLQKTYEN-------NYVILTNVSLDREKRSEYSLTVI-AEDRGSPSLSAVKHFTVQLQDENDNPPRFEKGRYEIFKSENNSPGAYLTTVVADDPDLGANGEVTYSIVESQIQGSSISTYV--TIDPSNGAIYALRSFDREEV-GRLTFTVQAQDGGGGASLSSNTTVVITVLDENDNSPVIVS----PLLSNRTADVPLWRRAEPGHLVTIVKATDRDSGANGELSCSIV 611          
BLAST of Protocadherin gamma-A1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 146.747 bits (369), Expect = 9.059e-36
Identity = 170/707 (24.05%), Postives = 290/707 (41.02%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI---------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQ-------PKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILV---TIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI---------------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQ----INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF 2011
            +T+ + E  PP+  VG L    ++     G   HL ++E     P   +D  +G + +T   IDRE +                            P++    +   D NDN P+F      + IPEN  +     +  A D D+   GI +YKL +  D    L S  +        P+L ++  LD E+ + Y+L ++V D G+    S   L I I D ND  PKF + +Y   + E   VG  +L+V A D++ G  G++ Y     +    R + ID  TG I  +K  +  E++ +   +++A+D G   K +   + I + D NDN P I               ++ E+ P+   +A+V V DKD G N  V+C +    P + +    +    + K++ L T    D E    +  Y +     D+G+P               N+  P F    Y     EE +  + V+     DAD+ +  E       +    G F I+      G++ +M+ +DRE   +      +        +   +++V++ V+D NDN P+ ++   +F V+EN    S +G + + D D+  NA   +S          + K  I    N  G I S++  D EK                           Y  ++ A D G P +++Y  +TIN+ +  +DN+ +
Sbjct:   35 ITYQLREEQPPNTLVGSL--AADQGLPDTG---HLYKLEVGG--PYLRVDGKTGDIYTTDVPIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDA-MNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTG-IIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYF-LQTTTPLDYE---RIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDIN---PNTGEVRVMNQLDRE--YKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLS------VEPENGKFVIQ---NGTGTILSSISFDREKES------------------------TYTFRLKAVDGGDPPRSSYVGITINV-LDENDNAPY 689          

HSP 2 Score: 52.373 bits (124), Expect = 2.085e-6
Identity = 112/497 (22.54%), Postives = 198/497 (39.84%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKL-LTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRI-DSKTGEIYLIKPL--LGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNN--FEVVEN-SLIESSLGRIKIRDIDQNRNAQFSIS 1717
            D NDN PKF+ +    ++ EN  +  ++   KA D D    G   Y     S ++   L        +++   +D E+V L    ++  D G  +  SK  + I + D ND AP    + + +V        V+E + VG+ +  V   D ++G+   +   +     +  R     DS +   Y ++    L  E+I    + I A D G+    +   L + + D+NDN P       E+D  E NQP   +L +V   D D G N ++   + +    K     +NP  G  +    + +  Y +  + HV        D G P               N+  P F    YS +  E +   + +    + DAD       Q++     G F   +I    G ++     DREK       +  ++ G   +  +S   + I V+D NDN P +   +N  ++ ++  +  ++ + ++   DID   NA+   S
Sbjct:  247 DTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVV-ATDADSGTNAELLYSIITDSATKGL-FDINPNTGEVRVMNQL-DREYKERYEFHVE-----AADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKF---VIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPR--SSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYS 730          
BLAST of Protocadherin gamma-A1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 128.257 bits (321), Expect = 1.019e-30
Identity = 172/738 (23.31%), Postives = 291/738 (39.43%), Query Frame = 2
Query:  101 ATKSLDVTFSISENLPPSNRVGILTEVIE-KFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGT--------NLP------------CIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPK---LKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEI--IDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS-NEYGSRFIRIDSKTGEIYLIKPLLGLE---KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYF--LNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQIN----GTHGGWFKIHI-IDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG---RNNFEVVENSLIESSLGR----IKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLP--SKTNYSNLTINIHMPTSDNSK----FSSHILLILGLIPTCALVILICAVI 2083
             T ++ V +++ E  P    VG L++ ++ +       HF L +   + +  L  +++  G +S    IDRE  C +             LP             +D+ND+ P F  ++  ++I E+  +   + LE A DLD     +  Y L  +E     L +     K   L +   LD E+   Y L L   D G        ++ I  +D ND +P F Q + +V V E    G+++L ++A D ++G  G+++Y      +    R  ++D KTG++ L K  L  E   +  ++I+A+D G     A  K+L+H+ D+NDN PEI              + E       + +V V D D   NG V+C L      K     L P +     Y +VTN S D+E    ++ YF  L  +D G+P               N+  P F    Y A+  E       +    A DADA        N       G     ++ I+  +G +  + P+D E      L   +           ++++V + ++D NDN P +     RN   VV     ++ LG     ++ RD D   N + S   V+    N         F++N++G          E F +   + D           +      + L V  +D+G P  S T    + +  H    D +       + +L ++ L   CAL +    ++
Sbjct:   25 GTTAITVKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMR---RDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSL-KGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFK-----LLPYR---DDYVVVTNSSLDRE---QMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEA--MTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPR-DAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNL--------FRINRLGG---------EVFTNAASVTD-----------AAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGDDGADETQPLDASMLAVMALGAACALTLAAVVLV 716          
BLAST of Protocadherin gamma-A1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 3.722e-27
Identity = 149/603 (24.71%), Postives = 242/603 (40.13%), Query Frame = 2
Query:  179 VIEKFRYKAGVH------FHLQQIEYQSEKPLFV-IDQYSGVISTSAEIDREAI-------------CPKISGTNLPCI---DVNDNQPKFQH-----NKRIIQIPENEEINYTLDLEKATDLDS-LQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY---LDFEKVELYNLVLEVCDTGSLCSKQK---LIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEIL-LNPIKGRHKFYKLVTNVSYDKENDNHVSSYFL--NCTDNGSPHC--------------NEYPPYFDSQFYSATTTEELKSENVIKFALADAD--ATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNAQFSISS---VKSFCFNKSDDKIAIDFQVNKI 1786
              EK  Y+A V         L+ + ++   PL V  D  +G++ST   +D EA               P +SG     I   DVNDN P  +        R   + E+        L   TD DS    G  +  ++   +    ++ +P  P L+++K    LD E++ +YNL +   D G   ++     L++ + D+ND AP+F    Y+  ++E    GS +  V A D + G   K+ Y +   N+ G  +  +D  TG +     +       +++ I AQD G+ PK A+T L + ++DVND  P            EN    + +  V   D D G NG V        P + +E+  L+ + G     K+ T  S D+E    +  Y L     D GSP                + +P ++  Q++++    E     V      D D  A  T  +Q+       F+++ +    G +     +DRE+     L +  ++ G       S + V ITV D  D PP     + +F V EN    + +G +    +D N N  + I S     SF    S  +I   F  N I
Sbjct:  135 AFEKPAYRASVAEDSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG--WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG-----KVTTLKSLDRE---ELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAV---TGAVSTRVSLDREERAVYQLQVTALDGGHLRAR--SPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRI---FTANAI 719          

HSP 2 Score: 102.064 bits (253), Expect = 2.389e-22
Identity = 103/406 (25.37%), Postives = 174/406 (42.86%), Query Frame = 2
Query:  161 VGILTEVIEKFRYKAGVHFHLQQIEYQSEKPL--FVIDQYSGVISTSAEIDREAICPKISGTNLP-----------------------CIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEK--ATDLDSLQFGIDNYKL-LTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI---DIF----ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP 1261
            VG L   ++     AG +     + Y  EKP   F +D  +G I++    DREA+  +    +                           DVNDN P+F   K + Q   +E  +    L +  A+D+D    G   Y +   +E   FT+ +S  Q  + L+  LD E+   Y LV+   D+G+  L +   + ++++D ND  P+F +   SV   E+ +VG L++ + A D + G  G + Y +   N + +    ID  TG ++L + L    + L  + + A+D G  P+ + T L++H+ D NDN P     D+F    EN P+   +  V   D D   NG++   +    P       ++P  G     ++ T    D+E    +    +  TD   P
Sbjct:  877 VGSLVGAVQATDADAGSN---GGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA--KSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQ--ITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHAT--FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFP-PGAHFTIDPESG-----EICTAAEIDREVTGGLFEVTVRATDKAIP 1267          

HSP 3 Score: 101.293 bits (251), Expect = 4.096e-22
Identity = 113/498 (22.69%), Postives = 197/498 (39.56%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAICPKI------SGT-------NLPCIDVNDNQPKFQHNKRIIQI-----PENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQP---KLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKF---AWTKLLIHIIDVNDNRPEID------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHS-------TKPLKSKEILLNPIKGRHKFYK----------LVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPP 1600
            FV+D  SGV+  S  +DRE     +       GT       ++   D NDN P+F  +     +     P+ +     +    A D DS  FG   Y L  SED  +   +  + P    L + + LD E    Y L     D G L +  +L + ++D ND AP     + +  V E    G+ +L++ A D+++G   ++ + +   +  G   +  D   G++ + + L    +    + +   D    P     +  ++ + + DVNDN P           E+ P+  ++A V+  D D G N  V   L +                 LN + G  +  +           +T ++ DK      S+  L  T       N+  P F  + Y A   E E     V++ +  D D  +  E + +   G       +D   G L +  P+DRE+T   +L +   + G   +  + ++SV +T+ D+ND  P
Sbjct: 1563 FVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND---GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVG---DANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPAR--SDTASVRVTLSDVNDCSP 2052          

HSP 4 Score: 95.9005 bits (237), Expect = 1.870e-20
Identity = 148/592 (25.00%), Postives = 243/592 (41.05%), Query Frame = 2
Query:  116 DVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDRE----------AICPKISGTNLPCI---DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKL-IKY-LDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--------LGLEKILVTIEAQDCGSVPKFAWTKLLIHII--DVNDNRPEI--DIFE---NQPLSIILAIVRV--EDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFL--NCTDNG-SP---HC---------NEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLIT-VIDINDNPPELVGRNNF-EVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSF 1732
            D +F + EN+ P   VG ++         A V +    I    ++  F I+   G I T+  IDRE          A    ++G     +   DVN++ P F      + I E+E +N      +ATD DS + G   Y++        F +      P  +L ++Y LD E  E Y+L +   DTG   L S   + + ++D+ND  P F   +Y     E  +VGSL+  V A D + G  G + Y    S E       +DS+TG I  ++           G      ++ A D G  PK    +  + +   DVNDN P+    +++   ++  S +  ++RV   D D G NG +   ++     +  +  ++   G+          S D+E     +SY L  + TD+G SP    C         N+ PP F     S    E  +  E +I    +D D   + + +     G       ID+  G + L   +D E      L +   + G   +   SS+++L+  V D NDNPP  +  + F  ++EN  I + +  +  RD D + N +   S  + F
Sbjct:  662 DYSFVVFENVAPGTLVGSVS--ASTLDLNANVTY---LIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF-----PDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTY----SFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGR-PKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGN--EGGKFTVDASTGQITLLG-----SLDRE---ETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPR---SSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQF 1225          

HSP 5 Score: 93.9745 bits (232), Expect = 6.848e-20
Identity = 131/583 (22.47%), Postives = 240/583 (41.17%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENE---EINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLK-----VGSLILKVHAYDNEKGDFGKILYRLGDS--NEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKP----LKSKEILLNPIKG----RHKFYKLVTNVS-YDKENDNHVSSYF---LNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DAD---------ATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE--VVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            DVNDN P F   +  +++ EN    E+ +TL    ATD D  Q  +  Y +L+  +  F + ++     L+  + LD E+   Y L +   D G+  +  +L + + D ND +P+F +  YS  V E          ++I  V A D + G FG++ Y L  S  +++      +   TG + + +PL    +    + A+        A  +L ++++D NDN P +       ++ E+ P    L  +   D D G N ++   + S  P        +  L+  +     R  FY LV  VS   +     +SS     L  TD      N+  P F S   SA   E+     V+    A D D         A +T+  +  G  G       ++   G++ L+  +DRE   R    + ++ +       TS++++ +TV D NDN P    R  +E  + E+    + + R+   D D+  N +          ++ +      DF+++ +                 LG   + R       + + +  +Y L V A+D G P++++ +++ + +
Sbjct: 1508 DVNDNPPVFAVPEMELEVEENTGEGEVIFTL---SATDADQGQNALVTYSVLSGSEGAFVVDAA--SGVLRASRRLDREERASYLLTVRASD-GTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTD-----VNDNAPAFTSP-RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREA--RQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFP-RREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELR--------YDIASGDPTGDFRLDPV-----------------LGTLAVAR------PLDRERTASYELAVRARDGGGPARSDTASVRVTL 2044          

HSP 6 Score: 84.3445 bits (207), Expect = 6.731e-17
Identity = 72/271 (26.57%), Postives = 124/271 (45.76%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT----------SEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-------ENQ--PLSIILAIVRVEDKDRGANGKVS 1096
            DVNDN P F  + R    PE+  +   +   +A D DS +     Y L T          +   PF L +  +  +++L++ LD E  + Y L +   D G   L S   L + + D ND AP+F ++ Y   + E    G+ +L++ A+D ++G  G++ Y +   +  G    R+D   G + + +P L  E+     + + A+D G   +     + + + DVND  P   +        EN   P  +IL +V   D D G++G+V+
Sbjct: 1828 DVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNT--VTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVLGTLAVARP-LDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVV-ARDDDLGSSGQVT 2091          

HSP 7 Score: 74.3294 bits (181), Expect = 9.732e-14
Identity = 132/581 (22.72%), Postives = 223/581 (38.38%), Query Frame = 2
Query:  284 ISTSAEIDREA-------------ICPKISG---TNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLI---KYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAP--KFI---QKNYSVVVNETLKVGSLILKVHAYDNEKGDF-GKILYRLGDSNEYGSRFIRIDSKTG-EIYLIKPLLGLEKILV---TIEAQDCGS-VPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPL------KSKEILLNPIK-GRHKFYKLVTNVSYDKENDNHVSSY---FLNCTDNGSPHCNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQIN---GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNF-EVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDY-EKFQHQLGLFDLD 1858
            ++T+  +DREA               P+  G    N+   D NDN P F+       + E+  +   L                   LL     P  +   P  PK  ++   + LDFE    Y L L   D G+  L  +   +I+++D+ND  P  +F+       S  V+E+   G++   V   D +     G++   +   NE G   +      G  +  +   L  E+I +   TI A D G  V + A   L++++ DVND+ P          + E  P    +  V   D D G N K+   + S   L      +S  ++    K  R     +V N+S   +     ++Y    +   D      N+ PP F    Y AT  E  L    V+  + AD+D       + N        + ++  +D   GK+  +  +DRE+    +  +++      +    S++ V + V D+NDN P       F  ++EN    +++  +   D D+  N          +     D   A  FQVN + G + + V LD  E+  +QL +  LD
Sbjct:   88 LATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----------------RDLLHRGRGPLAV---PFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLD-----VNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREE--LEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTV------RYQLTAGD---AARFQVNAVTGAVSTRVSLDREERAVYQLQVTALD 632          

HSP 8 Score: 58.5362 bits (140), Expect = 5.865e-9
Identity = 92/493 (18.66%), Postives = 184/493 (37.32%), Query Frame = 2
Query:  632 LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI--LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFEN-----QPLSIILAIVRVEDKDRGANGKVSCQLHSTK------------PLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHG---GWFKIHIIDKKNGKLMLMHPIDREK-TXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSIS-SVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF 2011
            + S  ++ I + D+ND  P F      + V E    G +I  + A D ++G    + Y +   +E    F+ +D+ +G +   + L   E+   L+T+ A D          +L + + D NDN P         D+ E+     +    ++  V   D D G  G+V+  L  ++            P+     +  P+    +   ++   + D       +  ++N  D      N+  P   +   +A   E+     ++++ +  D D     E + + + G   G F +      +G+L +   +DRE+ +    ++ +           +S+  V + + D+NDN P      +    E+S + + +  ++  D D  RN+    + +                F +N + GE+R    LD E  Q                        +Y L V A D+G P  T+ + L + +     +  +F
Sbjct: 1496 MSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSE--GAFV-VDAASGVLRASRRLDREERASYLLTVRASDGTHATD---ARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLD-----ANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV----GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQ------------------------SYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF 1949          
BLAST of Protocadherin gamma-A1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 1.147e-25
Identity = 156/646 (24.15%), Postives = 271/646 (41.95%), Query Frame = 2
Query:  254 LFVIDQYSGVISTSAEIDREAIC---------------------PKISG-TNLPCIDV-------NDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED-----LPFTLISSPM-----------------QPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQ-KNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD--SNEYGSRFIRIDSKTGEIY------LIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP---------------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYF--------DSQFYSATTTEELKSENVIKFALA-DADATSTNE--FQINGTHGG--WFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNN-------FEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYE-KFQHQLGLFDLD 1858
            L ++++ SG +S +  +DREA+C                      K  G +NL  +DV       ND+ P F+     + I E+E +   + L +A D D+    I +Y++  +        PF+L+ S                   +  L+L + LD E V  Y L+L   D G+  L     L I ++D ND AP F+      V + E  KVG+ ++++ A D + G  G I Y      ++      + +D  TG +       L +  + + +++V   A+D G + + A   + + + D NDN P                + I EN P    + ++ V D D G++G V  +L    P  ++    N ++   K  +L   + Y++    +VS       D G+P               N+  P F        D   Y  +  E   +  V+   LA DAD+       F ++   GG    ++  ++ + G+L L  P+DREK  R +L +   + G   +   + + V +TV+D NDN P  VG +N       F V E + + + +G +   D+D+  NA+ +++ V+        D I         G +R+ VVLD E + Q++L +  +D
Sbjct:   73 LCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVV--ARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEF--PTGAELASPNKVQFLLKTTRL---LDYEEAQQYNVSVL---AADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRK--ARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVR----EAGPDWIGGAGDTPG-GVVRTLVVLDREDRVQYELSVRAVD 701          

HSP 2 Score: 65.4698 bits (158), Expect = 3.629e-11
Identity = 84/315 (26.67%), Postives = 134/315 (42.54%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRI--------IQIPENEEINYTLDLEKATDLDSLQFGIDNYKL--LTSEDLPFTLISSPMQP-KLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEI--IDINDMAPKFIQKN------YSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFI--RIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI------DIFEN----QPLSIILAI-VRVEDKDRGANGKVSCQLHSTKPLKSKEI-LLNPIKGRHKFYKLVTNV 1192
            +D+NDN P F +   I        + + EN      +    ATD DS   G   + L  L   +    L S  M+  +L L   LD EK   Y L +E CD GS   K + I+ +  +D ND AP F+  +      Y   V E   VG+ +  V   D ++GD  ++   L    E G  +I    D+  G +  +  L   +++   +++ A D G     A  ++ I + D NDN P I      D +++     P  +++ + V   D D G NG+   ++    P   K I LLN   G     + V+++
Sbjct:  488 VDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNL--VREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNP---KGIFLLNADSGALSLARTVSSL 797          
BLAST of Protocadherin gamma-A1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 111.694 bits (278), Expect = 1.939e-25
Identity = 166/666 (24.92%), Postives = 276/666 (41.44%), Query Frame = 2
Query:  242 SEKPLFVIDQYSG-VISTSAEIDREAIC------------------PKISGTNLPCI-------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQ----------PKLKLIKYLDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGS------RFIRIDSKTGEIYLIKPLLGLEK---ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTK-PLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPEL-VGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDK--IAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNS 2005
            +  PL  ++  +G + +   ++DREA+C                  P   G     I       D+NDN P F      + +PEN        ++ A D DS   G+  Y+LL S+  P T+ +  +           P L + K LD E+ +LY + L   D GS        L I + D ND +P F Q   +V + E   VG+ ++++HA D + G   +++YRLG S           R  R+D  +G +  +  LL  E+     + I A D G  P  A   + + + DVNDN P I+             I E   +++ +A++ V D D GANG V+C +++ + P + K+ L  P +     Y L T  + D E  N      +   D G+                N+  P F    Y  +  E  +  +++I  +  D D     E             H +D + G + L   +DREK  + +    I+           +++V++ V+D+NDN P   +   +F V EN    S++G + + D D+  N +  +S +       +D++   +ID +    G IRS V  D E+  +                        YVL+V A D G P +++   + I++ M  +DNS
Sbjct:   81 AAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSD--PATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSG-LVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKK-LTYPNQ-----YLLETRETLDYETKNEYVVQ-IKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFH-MDPETGIISLTEQLDREK--KANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSIL------GTDNRQLFSIDPES---GMIRSNVGFDREQRHY------------------------YVLEVQATDGGEPVRSSTVKVVIHV-MDINDNS 699          

HSP 2 Score: 78.5666 bits (192), Expect = 3.625e-15
Identity = 63/225 (28.00%), Postives = 105/225 (46.67%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKI-LYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK-----ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP 1003
            +D NDN P F      + +PEN  I   L    ATD D  +     Y L    D P      P    + L + LD EK   Y+  +   D G   L     +I+ ++D+ND  P+F    +   VNE +   S +  V   D+++G+ G++ L  LG  N    +   ID ++G   +I+  +G ++      ++ ++A D G   + +  K++IH++D+NDN P
Sbjct:  484 LDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFL--GPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNR---QLFSIDPESG---MIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSP 700          
BLAST of Protocadherin gamma-A1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000577.1 (pep scaffold:Pmarinus_7.0:GL481640:2256:11833:1 gene:ENSPMAG00000000516.1 transcript:ENSPMAT00000000577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 2.761e-24
Identity = 67/216 (31.02%), Postives = 104/216 (48.15%), Query Frame = 2
Query:  539 PMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFI-RIDSKTGEIYLIKPL--LGLEKILVTIEAQDCG--SVPKFAWTKLLIHIIDVNDNRPEIDIF---------------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKP 1120
            P  P+L L + LD E    ++ VL   D GS       ++ + I D+ND  P+F +  Y   V E    G  ++ + A D ++G  G++ Y LGD      R +  +D  +G + L  PL          +++A+D G  SVP  A  ++L+ ++DVNDN P I+I                E  P   +LA++R  D+D G NG+V+C L  T P
Sbjct:  251 PQSPELVLARALDRETRARHSFVLRAWDGGSPPRWGAARVTVTITDVNDHVPRFERSEYLARVREGGPAGQPLVVLRARDPDEGANGEVRYSLGDHVSDDIRHLFAVDPTSGHVTLRAPLDYETATSYEFSVQARDLGVHSVPAHA--RVLVRVLDVNDNAPSIEIMPLARSTGPGEPVSVSEGAPPGTLLALIRATDRDSGPNGQVTCTLADTAP 464          

HSP 2 Score: 59.6918 bits (143), Expect = 1.415e-9
Identity = 41/167 (24.55%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKL--LTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAP--------KFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS 820
            DVND+ P+F+ ++ + ++ E       L + +A D D    G   Y L    S+D+       P    + L   LD+E    Y   ++  D G  S+ +  ++++ ++D+ND AP        +       V V+E    G+L+  + A D + G  G++   L D+
Sbjct:  296 DVNDHVPRFERSEYLARVREGGPAGQPLVVLRARDPDEGANGEVRYSLGDHVSDDIRHLFAVDPTSGHVTLRAPLDYETATSYEFSVQARDLGVHSVPAHARVLVRVLDVNDNAPSIEIMPLARSTGPGEPVSVSEGAPPGTLLALIRATDRDSGPNGQVTCTLADT 462          
BLAST of Protocadherin gamma-A1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 142.51 bits (358), Expect = 1.147e-34
Identity = 166/629 (26.39%), Postives = 260/629 (41.34%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAIC----------------PKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF 2011
            F IDQ SG+IS +  +DRE                      +   +  +DVNDN P F        + EN  I  T+    ATD D  +     Y+L   +   F +  +P    +   + LD E    Y+L +   D G  S  +   + + I D+ND +P+F Q  Y++ V E    GS IL+V A D + G  G++ Y +   N +G+ F RIDS TG I ++  +    L    +TI A+D G  P  +   + I + D NDN P          I E   +   +A+V   D+D G+N +V    +S     +    +N + G     K +        N   V +Y L    +D GSP               N+ PP F+SQ Y  +  E   +S +V+  A  D+D  +    + +   G   K   I+  +G +M   P+D E+          + +   +  +T+ ++V I VI++ND  P    +N    V ENS   +S+ ++   D D   +  +SI         K  DK +ID    + G I +  VLD E                 L S+       Y +QV   D G P  +N + +TI I     ++ KF
Sbjct: 1042 FKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEV--NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGN-HGNAF-RIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQV---FYSIVRGDTSAFAINAMNGVLTVKKEI--------NRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEE-----KSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSI------VGGKDSDKFSID---QRSGIISTADVLDRE-----------------LVSL-------YAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKF 1617          

HSP 2 Score: 110.538 bits (275), Expect = 9.555e-25
Identity = 133/533 (24.95%), Postives = 223/533 (41.84%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDRE-----AICPKISGTNLPCI-----------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDS-----LQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLC--SKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKI--RDIDQNRNAQFSI 1714
            F +D  +GV++ S  +D E     A+   ++    P +           D+NDN P F  +    ++ EN      +    ATD DS     L FGI    +  ++D  FT+  S     + + K  D+E    Y+L ++  D G        ++ I I D+ND +P F   NYS  + E+  +GS ++ V A D + G  G++ YRL   N  G+    ID+ +G I +   L         + +EA+D GS  + + T++ I + D+NDN P         + E+      +  V   D D  +NG V   L     + S       I        L T + Y+K+    V+   +   D G+P               N+ PP F    Y+ T  E L +   + +  A DAD+ +  +   +   G       +D+  G++    P+DRE        + I         F ++++V I++ D NDN P   G + F + E+S   + +G++    RDI  N    ++I
Sbjct:  319 FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGI----IKGNDDGVFTIDGS--TGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGA--FNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFS-------INTSTGLITLKTQLDYEKKTQYMVT---VTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRE--TIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAI 828          

HSP 3 Score: 108.612 bits (270), Expect = 4.367e-24
Identity = 163/709 (22.99%), Postives = 290/709 (40.90%), Query Frame = 2
Query:  125 FSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDRE-------AICPKISGT----NLPCI-----DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTS-EDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLC---SKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCT--DNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPEL-VGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTS---ISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIH---------------MPTSDNSKFSSHILLILGLIPTCA 2056
            F +SE+  P +++G +            V + L          +F I+  +G+I+   ++D E        +  K  GT    +L  +     DVNDN P+F  +     + EN      +    ATD DS   G  +Y +L+  E++ F +       ++     LD E +  Y+L +   D GSL    +   + I I D ND  P F   +    ++E    G+ + ++ A D + G  G + Y +   N+ G+ F ++D ++G I  ++  L  E I    + ++A D GS  +     + + ++DVNDN P         +I E+  +   +  V+VEDKD G+NG ++  L       S E   N       F    T + Y+       ++Y L  T  D GSP             + N+  P F S     +  E++  + +V+K    D+D T      + G  G  FK   ID+ +G + +   +DRE T    L++     G   ++  ++++  I V+D+NDN P    G     + EN  I  ++ ++   D D+  NA+ +                                   YE        F+++  TG +T+   + +    +Y L+V+A D G PS++  + +T+ I+               +  ++N+   S+IL +L   P   
Sbjct:  589 FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-----NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAM--DRFTGEITTRVPLDRETIASYSLTIN-ADDGSLVRFMAATTVNISIADENDNQPTFTGPSR-FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ-GNSF-QLDPRSG-ILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSL-------SGEGSDNFTIDSTGFVLSKTPLDYET-----TAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFK---IDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNAT--IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVT-----------------------------------YELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAG 1233          

HSP 4 Score: 107.071 bits (266), Expect = 1.287e-23
Identity = 147/606 (24.26%), Postives = 245/606 (40.43%), Query Frame = 2
Query:  308 REAICPKISGT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGID--------NYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSK--QKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRL--GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVT--IEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEE-----LKSENVIKFALAD--------ADATSTNEFQINGTHGGWF--------KIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNF-EVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKI-GEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIH 1984
            R+   P  S T    +  I+VNDN P F    ++  IPE+  IN  +    ATD D      D        ++K+  S  L            + + K LD E    Y LV+   +TGS          I ++D+ND AP F   +Y+  ++E L +G  + KV A D ++G+  K+ Y L  GD++++      ++  TG +   +PL   ++   +  + A D G   + A   + + I D+NDN P+       + + EN      +  V   D D GANG+V+  + S          ++   GR     +V     D+E    ++SY L      S   +  PP+  + F + T  +E     + + N   + + +        A  T+T+  +  G++   F            I+  NG L +   I+RE        + I      +   TS   + + V D+NDNPP    ++    V ENS   +S+  +   D D   NA    S       + +D+K    F++N   G I +T  LD+E+                           Y L+V+A D    +KTN +   IN++
Sbjct:  970 RDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGL------------ISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKF-----EVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGN--HGNAFRIDSTTGRITVVGVV-----DRE---ALASYNLTI----SAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDE--GSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETV--PTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYS-----IISGNDEK---RFKINSTSGVIMTTTPLDFEEKSQ------------------------YGLEVTATDSKYTAKTNVTIRVINLN 1508          

HSP 5 Score: 104.375 bits (259), Expect = 8.633e-23
Identity = 162/663 (24.43%), Postives = 269/663 (40.57%), Query Frame = 2
Query:  125 FSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDRE---AICPKISG------TNLPCI---DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGID---NYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLC-SKQKLI-IEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK--ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQ---INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNA--QFSIS-SVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTI 1975
            F+I EN P + +V I+T         A + + L   E +     F+++  +G I T   +D E   +   +IS       T +P I   DVNDN P F  +     + E+  +   +    A DLD    GI+   +Y L++ +   FT+ S   Q  ++     D E    Y + L   D GS   S Q  + IEI+D+ND  P F    Y+  V+E + +G+ ++ V A D + G+   + Y     N   +    +D+ TG + + + L   ++    + +   D GS P    + LLI++ D+NDN P       +  + EN P       V   D+D   NG +   +     +K  +  +  I G      +  +  Y+ +    ++   +   D G P               N++ P F    YS    E  +    V+     D D+      +   I+G   G F    ID  +G + +   +DRE T    L +   + G  ++  +SS+ V I + DINDN P   G   F V E+S     +G++   D D + N   ++++S +   F  N S   I +  Q            LDYEK                           Y++ V+A+D G PS+   S+LT+
Sbjct:   77 FNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSGENK-----FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD---VGINARLSYSLVSGDTSYFTVDS---QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNT--NHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG---TQVSATDRDSSTNGALVFGI-----IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLT---VQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFN---IDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSR--SSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQ------------LDYEKKTQ------------------------YMVTVTAKDGGTPSR---SSLTV 670          

HSP 6 Score: 100.908 bits (250), Expect = 1.061e-21
Identity = 170/627 (27.11%), Postives = 266/627 (42.42%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREA-------ICPKISGT---------NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKF-AWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNC--TDNGSPHC-------------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE--VVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEK---FQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLP--SKTNYSNLTINIHMP 1990
            F ID  +G I+    +DREA       I  K SG           +   D NDN P F  N+    I E   I   + +  ATD D        Y ++  +   F +  + M   L + K ++ E V  Y L +   D GS  + S ++L + + D+ND  P F  ++Y   V E     + +L V A D++ G    + Y +   N+   RF +I+S +G I    PL   EK    +E     S  K+ A T + I +I++ND  P          + EN P S   ++V+V   DR + G +S  +   K   S +  ++   G      + T    D+E    VS Y +    TD G+P               N+  P FDS  YS++  E    S    K A  DAD  +      N +    F   +I   +G + L  P+DRE     DL I   + G   +   SS ++ +TVIDIND+ P L+  ++    V EN   E+ + RI   D D   NA+ +     S   N+      +D   N  G+I + V LD E+   +  ++G+   D+    L+S++ +     ++ V  +D   P    T Y N+TI+  +P
Sbjct: 1251 FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAI--NAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE-KRF-KINSTSGVIMTTTPLDFEEKSQYGLEVTATDS--KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTST--SVVKVSASDRDSFGSLSYSIVGGK--DSDKFSIDQRSG-----IISTADVLDRE---LVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAF---MIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQA--SSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTF----SLLSNEHKSVFTLD---NTTGDISTKVPLDREQQAVYTLRIGV--ADKGNPSLSSVADV-----IIDVIDEDDNCPRFQPTEY-NVTISESLP 1838          

HSP 7 Score: 97.8265 bits (242), Expect = 9.486e-21
Identity = 138/592 (23.31%), Postives = 241/592 (40.71%), Query Frame = 2
Query:  128 SISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICP----------------KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRL--GDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC------------NEYPPYFDSQFYSATTTEEL-KSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPEL-VGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSFCFNKSDDKIAI 1765
            S+ ENLP    V  +T         A V + L       +   F ++  +G+++T   +DRE                     ++   L   D+NDN P+F  +K  + + EN      +    A+D D+   G   Y +++        I S    ++ ++  +D E +  YNL +   D+G     S   + I + D ND +P F     S  ++E + +GS +  V A D ++G   ++ Y +  GD++ +      I++  G +  +K  +  E +    +TI A D GS    +  +L + + DVNDN P  +       + EN   S  +  V  +D D GAN  +   + S      K   +N   G      ++T    D E     S Y L  T   S +             N+  P F  Q Y+A+  E    S +V+K + +D D+  +  + I G  G       ID+++G +     +DRE        I +      N   ++ + V I ++D NDN P+      +  ++ENS   S   ++   D D+  NA+  +++S   +F    S   I +
Sbjct: 1107 SLHENLPIGQTVAKVTATDRDEGENAKVTYELSV----GDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDS-TTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFA-----INAMNG-VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGN--DEKRFKINSTSG-----VIMTTTPLDFE---EKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVG--GKDSDKFSIDQRSGIISTADVLDRE--LVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITL 1673          

HSP 8 Score: 85.8853 bits (211), Expect = 3.915e-17
Identity = 131/528 (24.81%), Postives = 216/528 (40.91%), Query Frame = 2
Query:  245 EKPLFVIDQYSGVISTSA-EIDREA---------------ICPKISGTNLPCIDV---NDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRL--GDSNEYGSRFIRIDSKTGEIYLIKPLLGLE---KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYF--LNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDID 1687
            ++ +F ID  +G I+T+  + DRE+                C K  G  +  IDV   NDN P+F  N  +  I EN      + +  ATD DS       Y L + E+     + +    +++ +  LD E  + Y + +   D G   +   LI  + D+ND AP F    Y   V E + VGS++ ++ A D + G   ++ Y L  GD++     +  +DS+   +   K     E      V + AQD GS  +     + I I+DVNDNRP          + E+  +   +  V   DKD G N  +     S     +    L+ + G      +  + S D E     SSY   L+ TD GSP               N+ PP F    Y +   E   +    + +  D D+++          G    +  ID   G + +    D E   R DL +   + G+  K  T+  ++ I   D+ND+ P     N + ++ E+++I S++  +   D+D
Sbjct:    8 DQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHK--GRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITYSLFSGEN---KFMMNSKTGEIRTVTPLDHETKDSYTMRISAFD-GKHTTFVPLIT-VDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS-----YFTVDSQ--GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGN--TNHAFTLDAVTG-----VVTVSRSLDFE---QRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG--TQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIE--DVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLD 506          

HSP 9 Score: 83.9593 bits (206), Expect = 1.682e-16
Identity = 98/353 (27.76%), Postives = 157/353 (44.48%), Query Frame = 2
Query:  128 SISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDRE----------AICPKISG-TNLP--CIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDL-PFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHS 1111
            S+ EN   S  V  LT   +     A        I    EK  F I+  SGVI T+  +D E          A   K +  TN+    I++ND  P F        + EN   + ++    A+D DS  FG  +Y ++  +D   F++        +     LD E V LY + + V D G+  L +   + I+I+D ND +PKF   +YS  + E     S   K+ A D ++G   +I Y L  ++ +      I + +G I L +PL    K    + I+A+D G+ P+ +   + + +ID+ND+RP I+       + ENQP    +  +   D D G N +++  L S
Sbjct: 1420 SVRENSAQSTSV--LTVAADDSDVGANAVLRYSIISGNDEK-RFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSI--DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAF-----MIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLS 1760          

HSP 10 Score: 60.4622 bits (145), Expect = 2.597e-9
Identity = 60/202 (29.70%), Postives = 97/202 (48.02%), Query Frame = 2
Query:  227 QIEYQ-SEKPLFVIDQYSGVISTSAEIDRE-------AICPKISGT---------NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYD 772
            +I Y  S    F+I   SGVI+ +  +DRE       AI  +  GT          +  ID+ND++P    +     + EN+     +    A+D D+       + LL++E    FTL ++      K+   LD E+  +Y L + V D G  SL S   +II++ID +D  P+F    Y+V ++E+L  G+ I++V A D
Sbjct: 1651 RITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVP--LDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARD 1850          
BLAST of Protocadherin gamma-A1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 130.954 bits (328), Expect = 4.182e-31
Identity = 182/684 (26.61%), Postives = 289/684 (42.25%), Query Frame = 2
Query:   95 VSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICP------KISGTNLPCI------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP-FTLISS--PMQPKLKLI--KYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE---KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-------------ENQPLSIILAIVRVEDKDRGANGKVSCQLHST-------------------KPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYF--LNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSEN-VIKFALADADA--TSTNEFQINGTHG-GWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFE--VVENSLIESSLGRIKIRDIDQNRNAQ--FSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGN---YVLQVSAQDQGLP 1945
            VSA  S   TF + E  PP   VG       K    +      +Q  + S          +GVIST+A IDRE           ++ +N P        D+NDN+P+F      ++I E+ ++N T  +  ATD D+   G  +Y + + ++   F+L ++  P    L +I  K LD E  + Y L +   D G  +L     + I I+D ND AP F Q +Y   + E  K G  IL+V A D + G  G I Y +       +    +DS TG I   K  L  E        + A D G   K     + I+++D NDN P++ I              EN  ++  +A + V DKD   N +   ++ +                    KPL  +E++         FY L  NV+ DK   +  +  F  ++ TD      N+  P F S  Y+A  +E  ++ + V++    D D     T  + I G +  GWF+   +D ++G +    P+DRE+   + + I   + G   K  T S++V +T+ID NDN P  + +++++  + E + I +++ ++   D+D   N +  + ISS               D QVN                    GLF+L+  TG L + SQL       Y   V A+D G P
Sbjct:    6 VSAGSSY--TFHVQEEQPPGTYVG-------KVDGASAFEGSPKQFGFNSN---------TGVISTTARIDRETTTQISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIR-TKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLD-RELV--------PFYNLTLNVT-DKGVPSRSTLGFVLIDVTD-----VNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQ---VDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPK--TGSTTVTVTIIDGNDNKPRFM-KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS--------------DAQVN--------------------GLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDP 615          

HSP 2 Score: 123.635 bits (309), Expect = 8.455e-29
Identity = 149/590 (25.25%), Postives = 244/590 (41.36%), Query Frame = 2
Query:  128 SISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDRE-------------AICPK---ISGTNLPCIDVNDNQPKFQ------HNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED--------LPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQ---INGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVL-ITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISS 1720
            SI+EN  P   +  ++           + + +     QS   +F +D  +GVI T   +D E                P    ++   +  +D NDN P+ +      HN       EN  IN  +     TD DS        K+   +D        L F  I        +L K LD E V  YNL L V D G  S  +   ++I++ D+ND +P F    Y+  ++E  + GS +L+++A D ++GD G + Y +   N+ G  + ++D ++G +   KPL    +  + +TI AQD GS PK   T + + IID NDN+P          I E   +   +  V   D D G NG+++ ++ S+    +    LN   G      L T    D+E    + S+ +   D+G P               N+  P F    Y A+  E      +++    DAD  +        I G + G F    ID   G +  +  +D E     +   +II+       + + ++V+ +TV++  DN P  L    NF V EN    + +GR+     D+N +  ++I S
Sbjct:  214 SIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNS-IFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFI--------QLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG--WFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTG-----VLWTKSQLDRET-KSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFS---IDSSTGVISTLASLDHE---VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVS 780          

HSP 3 Score: 114.775 bits (286), Expect = 4.667e-26
Identity = 130/507 (25.64%), Postives = 208/507 (41.03%), Query Frame = 2
Query:  125 FSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQ--SEKPLFVIDQYSGVISTSAEIDREAICPKISGTNL-----------------------PCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDT--GSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSII----------LAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYF---LNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNE--FQINGTHGGWFKIHIIDKKNGKLMLMHPI 1474
            F+++EN  P   VG L          A  H   + I Y   S +  F +D  SG I+T   +DRE +  K +G+N+                          D+NDN P F      I + E       +   KA D D        Y L++   +    I+S    +L L K LD E    YNLV++  D    +L S  K+ I + D ND  P F + +Y+V + E   +GSL++ ++A D + G  G I Y + + N   +    ++S TG + + K L      L  +TI AQD G +P  +   + ++++DVNDN P   +F  QP+++           +      D+D G N  ++  ++S  P K+  +            ++ T  + D E        F   +  TD GSP               N+  P F S   +A  +    S NV+     D D  S  +  + I   + G+F +H      G+L ++H I
Sbjct: 1057 FAVAENSSPGTLVGTLVA-------HALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELI-KNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTG-ELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNL--AAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP---LFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSV-------NSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGS----SLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLH---PSTGQLQMIHQI 1535          

HSP 4 Score: 105.145 bits (261), Expect = 5.306e-23
Identity = 153/615 (24.88%), Postives = 253/615 (41.14%), Query Frame = 2
Query:  350 CIDVNDNQPKFQHNKRIIQIPE-NEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKL-KLIKYLDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQL------------HSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNH-------VSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALADA-DATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGN---YVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKF--SSHILLILGLIPTCALVILICAV 2080
              DVNDN P F  N     I E  +  +Y L L  ATD D    G  +Y +    DL +  +    Q  L    K LD E+V    + +   D GS        + + IID ND  P+F++ +Y   ++E   +G+ +L+V A D + GD G+I Y +  S+   +    ++++TG ++    L    K L   T+ A+D G     +  K+ + I D+NDN P          I EN+P   +L  V   D D G N  +S  +             ST  + +   L + ++   +F+ L+ +    K+  N        V+   LN  DN         P F  + Y+ T  E +    ++    A   D   +  + I    G    + ++D   G + +   +DRE+  +   L+ +I      K  ++ ++V I V+D NDN P+                SS+    I DID           V    +N +    A+D    K G +R      Y+   +  GL  ++  +G +    +L  G+   Y +QV A D G P +  +S +TI+I +  +   KF  SS++  +L   P       + AV
Sbjct:  415 VTDVNDNSPAFTSNAYTANISELAQNGSYVLQL-NATDPDEGDNGTVSYSITGGNDLGWFQVD--FQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQ-VTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVE---EFFSLIISA---KDGGNKYAAKTAVVNVTVLNKADN--------LPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAI--VSGDPTNLFLVDSTGGIIKINGDMDREE--KAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFS-------------TSSV----IVDIDGTW-------LVGQVVYNAA----AVDLDAGKNGLVR------YQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQ--HSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAV 971          

HSP 5 Score: 88.9669 bits (219), Expect = 5.139e-18
Identity = 119/488 (24.39%), Postives = 193/488 (39.55%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAI--------CPKISGTNLPCI--------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL------LGLEKILVTIEAQDCGSVPKFAWTK-LLIHIIDVNDNRPEIDIFENQPL-----SIILAIVRVEDKDRGANGKVSCQLHSTK-------PLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNH---VSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNE----FQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDIN 1588
            F I+  +G +  S  +DRE              S  NL           D ND +P F  +   + I E+  I   +    A+D D  Q G+  Y + ++ +L           +L + K LDFE  +LY L +   D G   L S   + + ++D+ND AP F  +  ++ V E +  G  + +  A D + G    I + +   ++  S+   ++S T EI  I  +       G +   + + A D GS PK +  K + + + D NDN P    F + P      S+ +  +  ED DR +NGKV+  + S         P   +  +++ I      Y+L    S   +       V S F      G P        F S  Y  + TE   +   +   LA    +S N     +  + +  G F++    K  G +     IDRE       L++           TSS++V ITV D+N
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSI-SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM--YSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGS-PKLSTRKSITVQVTDENDNSPG---FVSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPT-------FSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVV---KSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 86.6557 bits (213), Expect = 2.429e-17
Identity = 162/679 (23.86%), Postives = 266/679 (39.18%), Query Frame = 2
Query:  125 FSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQ--SEKP--LFVIDQYSGVISTSAEIDRE-------AICPKI---------SGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLT-SEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK--ILVTIEAQDCGSVPKF-AWTKLLIHIIDVNDNRPEIDIFENQPLSIILAIVRVEDKDRGANGKVSCQL--HSTKPLKSKEILLNPIKGRHKFY------KLVTNVSYDKE-------------------NDNHVSS----YFLNCTDNGSPHCNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKI--RDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQV-NKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            F++ EN+P    VG    V    + K G       I Y   S  P  LF++D   G+I  + ++DRE       A+  ++         +  N+  +D NDN P+F  +  I+ I     +   +    A DLD+ + G+  Y+L + +E L +   +S +   +KL + L       Y + +   D+GS      + I I    +  PKF   +Y   V  +  +      V A D + G  G++ Y +   NE G   I      G++Y+ K LL   K    + + A D G VP F A   + I+I D ND+R    +F N      +A       +  + G +   L  H+    ++K+I+ + I     F       ++ T V  D+E                   ND  +        +  TD      N+  P F    Y+ T +E  L    V +    DAD     +F  +   G       I+   G+L L   +DRE T      +++      N N  S++ + ITV D ND  P     +    + E++LI S +  +    +DI QN   ++SI          S+  +A  F V +  G +     LD+E  Q                         Y L ++AQD GL   ++  N+T+N+
Sbjct:  748 FTVYENVPKGTLVG---RVYATTKDKNG------SISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGV---IKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIF---PGGKLYIRKSLLQALKGSYDLIVRATD-GGVPSFSASVPVTIYIQDSNDHR---SLFVNNTFRFAVA-------ENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTD-----LNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETT--SSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSI----------SNGNLAAMFDVESATGRLIVAKSLDFETTQL------------------------YELTITAQDHGLIPLSSTVNVTVNV 1359          

HSP 7 Score: 80.4925 bits (197), Expect = 1.802e-15
Identity = 146/585 (24.96%), Postives = 233/585 (39.83%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREA-------ICPKISG---------TNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNL--VLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIE--AQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYK----LVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYF----DSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDK---------------------KNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTS----SSSVLITVIDINDNPPELVGRNNFEVV--ENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVN-KIGEIRSTVVLDYE 1822
            F ID  +GVIST A +D E        I  K  G          N+  ++  DN P F +      + EN      +    AT  D  + G  +Y +++ +     L+ S     +K+   +D E+   Y L  +  V     L ++  + IE++D ND AP+F   +  V ++ T  VG ++    A D + G  G + Y+L  SN  G   + I+S +G I L + L   ++   T++  A D GS P+ +   + IHI    ++ P+         +  +QPLS     V   D+D G NG    QL  + P  ++E L     G   + +         SYD           +  TD G P  +   P      DS  +       L   N  +FA+A+  +         GT  G    H +D                      ++G++     +DRE+  +     + I       N T+     + V++TV D+NDN P +  R  + +   E SL  S + RIK  D D+  NA+F  S V     +K        F +N   GE+  +  LD E
Sbjct:  684 FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDS-TGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQL-TSNAEG--LLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHS--TMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNG----QLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYD---------LIVRATDGGVPSFSASVPVTIYIQDSNDH-----RSLFVNNTFRFAVAENSSP--------GTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP-VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDK--------FFINSSTGELHLSKTLDRE 1225          

HSP 8 Score: 55.8398 bits (133), Expect = 7.138e-8
Identity = 121/512 (23.63%), Postives = 204/512 (39.84%), Query Frame = 2
Query:  374 PKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKL-LTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLI--LKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLL----GLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSIILA--------IVRVE--DKDRGANGKVSCQLHSTKPL-------KSKEILLNPIKGRHKF--YKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEE-LKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNAQ-----FSISSVKSFCFNKSDDKI----AIDFQVNKIGE 1792
            PKF  +  +  +  ++ ++Y      A D DS + G   Y +   +E+  F +       KL + K L       Y+L++   D G  S  +   + I I D ND    F+   +   V E    G+L+  L  HA D+ +     I+Y L  S  + +  +R    T  + L +  L    G    ++  EA    +  K     +++ + D+NDN P   +F     +I ++        + R++  D D G N K    L S   +        + E+ L+    R     Y LV   + D  N N  S+  +  T   S   N+  P F    Y+   TE+ L    VI    +D D       + + ++G    +  ++   G+L++   +D E T   +L I   + GL     +S+ +V + V+D+NDN P    +     V EN      +GR    D D   NA      +S +  K+F  N +  +I    AID +    G 
Sbjct:  944 PKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGG---KLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTK--DIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP---VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKAT-DASNANLYSTAKIEITVGDS---NDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIP--LSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGR 1441          
BLAST of Protocadherin gamma-A1 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 123.635 bits (309), Expect = 4.806e-29
Identity = 167/646 (25.85%), Postives = 262/646 (40.56%), Query Frame = 2
Query:  230 IEYQSEKPLFVIDQYSGVISTSAEIDREA----------------ICPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDS-----LQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG----SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHII--DVNDNRPEI-------DIFENQPLSIILAIVR-VED------------KDRGAN--------GKVSCQL---HSTKPLKSKEILLNPIKGR----------------HKFYKLVTN--------------VSYDKENDNHVSSYFLN----CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKK------NGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYE 1822
            + + +E   FVID  +GV+ +S E D E                 I   I+  ++   D NDN+P FQ  +   ++ EN  +   +   KA D DS     L + I N     + +  FT+ +S  +   +  K  DFEK E YNL + V DTG    S  +   ++I ++D ND  P+F QK Y+  V E   VG+++L+V A+D + G    + Y +   N   +  I  DS  G+I L KPL    +E   + +   D G  P  +  ++++++I   VN++ P          I EN PL   +  VR VED            KD  ++        G ++      + T+     E+  N   G                   FY +VT+              VS   E D   S Y  N      D GSP              CN+ PP F + +Y+   +E       +++ +  D D     +  +N     + K  I+ KK       G++ +   +D E+  R      +          T SSSV IT+ID+NDN P  L  R   ++VEN  I + + ++   D+D + N +     + S     SD K  ID      G + +   LDYE
Sbjct:   43 VSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQN----GNNNGSFTIDNSTGEIMTR--KEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADS--GDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRE-SVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRD---DKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEE--RSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKV----LFSILGGNSDGKFVID---QNTGVVTTNKSLDYE 667          

HSP 2 Score: 94.7449 bits (234), Expect = 5.426e-20
Identity = 77/240 (32.08%), Postives = 121/240 (50.42%), Query Frame = 2
Query:  311 EAICPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTS-EDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQ--KLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIH--IIDVNDNRP 1003
            EA     S   +  IDVNDN+P F   +  +Q+ EN  I   +    A+DLDS   G   + +L    D  F +  +     +   K LD+E V  Y LV++  D G   L S Q   L + +++IND +P F QK YS  ++E   VG +IL+V A D +    GK+L+ + + N  G +F+ +D  TG +   K L    + +  + I+A DCG  P  +    ++H  ++++NDN P
Sbjct:  578 EARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQN--TGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDG-KFV-VDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 813          

HSP 3 Score: 85.5001 bits (210), Expect = 4.315e-17
Identity = 83/317 (26.18%), Postives = 142/317 (44.79%), Query Frame = 2
Query:  242 SEKPLFVIDQYSGVISTSAEIDREAIC--------------PKISGTNL--PCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDL----PFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIH--IIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKV 1093
            S K +F  +  +GV+S +AE+DRE++               P+ +  ++    +D NDN P F      +Q+ E   I   +    A D D    G++       +D      F++  +  Q  +K  + +D+E+   Y+  +   D G   L     + I IID+ND  P F+   Y V + E + +G+ + +V A D +    GK+L+ +   N  G +F+ ID  TG +   K L    + +  + I+A DCG  P  +    ++H  ++++NDN P          I EN  +  ++  V   D D   NGKV
Sbjct:  431 SVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIK--QAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDG-KFV-IDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKV 743          

HSP 4 Score: 67.3958 bits (163), Expect = 1.644e-11
Identity = 96/405 (23.70%), Postives = 169/405 (41.73%), Query Frame = 2
Query:  686 PKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC---------------NEYPPYFDSQFYSATTTEELKSENVI-KFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGR-NNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYE 1822
            P F Q  YS ++ E   VG  +L V A D +     ++ Y +   +     F+ ID+ TG +   K      + +   ++ A+D GS  + A   + + I D NDNRP       E  + EN PL  I+A V+  DKD  +N  +   + +     S  I        +   +++T   +D E      +  ++ +D G P                 N+ PP F  + Y+AT  E      V+ +    D D+      + +   G      +I   +G + L  P+D+E  +   L++I+ ++G+          V + V  +N++ P  +    N  + EN  + +S+ R++  + D +  A+F I  +K    +K        F VN+ G+I     LDYE
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFV-IDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTI-------DNSTGEIMTRKEFDFEKTERY-NLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARF-IYVIKDAASSKV-------FLVNQTGDITLARELDYE 388          
BLAST of Protocadherin gamma-A1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 122.479 bits (306), Expect = 2.227e-28
Identity = 163/646 (25.23%), Postives = 271/646 (41.95%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAIC-------------PKISG---TNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEI--IDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL----LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEI-------DIFENQPLSIILAIVRVEDKDRGANGKVSCQ-LHSTKPLKSKE----ILLNPIKGRHKFYKLVTNVSYD------KENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTN---EFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNK-IGEIRSTVVLDYEKFQHQLGLFDLDRF--TGDLTSISQLKPGNYV 1912
            V  ++S + P S   G++       RY      +L    Y      F IDQ +GVI+T   +DRE +              P + G     +  +DVNDN P F+ N     IPE++ I   +   +A+D DS   G   Y +L S+          +   + ++K LD EKV  Y L ++  D G+      + ++I  +D+ND  P+F +K YS  + E + V  L+  V A D ++G  G++ + +   N+    F  I+   GE+ + + L    +G+  +LVT  AQD G    +  T + I +IDVNDN P+         I EN  +      V+  DKD G NG+++   + +  P    E    I +     R K  K    +         KE    ++   L+  DN        PP F  + Y  +  E  +   +V++    D D+  TN       +  H   F+I+      G + L   ++          + + ++   +   +S++ V + V D N + PE   R+ + EV E++ + +S+  +   D D   NA+ S S             +  +F V++  G I++   LD EK        D  RF  T     I QLK  ++V
Sbjct:   38 VVATVSASDPDSGSNGMI-------RYSMSPSQNLMSATY------FSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDM--NFFSINRINGEVRVKQKLDYEMIGVFNLLVT--AQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDN--------PPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRIN----PQGLITLSCTLNYN-----TKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIA----------TLVPEFSVDETTGVIKTAGSLDREK-------VDTYRFEVTATDHGIPQLKAKSFV 632          

HSP 2 Score: 89.7373 bits (221), Expect = 2.788e-18
Identity = 117/499 (23.45%), Postives = 204/499 (40.88%), Query Frame = 2
Query:  686 PKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDS-NEYGSRFIRIDSKTGEIYLIKPLLG--LEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFENQPLSIILAIVRVEDKDRGANGKVS-CQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVV--ENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNK-IGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI---------------HMPTSDNSKFSSHILLILGLIP 2047
            P+F +      V+E  +VG+++  V A D + G  G I Y +  S N   + +  ID  TG I   + L    L++    ++A+D G      +  L I+++DVNDN P         DI E++ +   +  VR  D D G+NG+V  C L+S     +    +  + G     K +     D+E    V +Y L     D G+P               N+  P F  + YSAT  E++    ++    A D D  S  E       G       I++ NG++ +   +D E        +++           + ++V I +ID+NDN P+ V  ++F+ +  EN  +     R++  D D   N +       +F F ++D    + F +N+  G I     LD EK         + +FT                 + A+D+G+P K   + +TI +               H   ++NS++ + +L +  + P
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDG--DNSAFSIGEVSGAVTVMKKL-----DREK---VPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYE--MIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVS-SHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEI------TFSFMQND----LPFSINENTGGISIKEELDREK---------VPKFT---------------FGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDP 469          

HSP 3 Score: 78.9518 bits (193), Expect = 6.084e-15
Identity = 130/536 (24.25%), Postives = 213/536 (39.74%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREAICPKIS--------------GT---NLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDN--YKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILV-----TIEAQDCGSVPKF-AWTKLLIHIIDVNDNRP-------EIDIFEN-QPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSEN-VIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVG-RNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSI 1714
            F I++ +G IS   E+DRE + PK +              GT    +  +D+NDN PKF   +    I EN     ++   KA D DS   G  N  Y +++S         +P Q  + L   L++    +Y   +   D G L S   + + + D N  AP+F +++YS  V E   +G+ +L V A D + G   KI Y +       S    +D  TG   +IK    L++  V      + A D G +P+  A + + IHI DVNDN P       E  + E+ +P   ++  V   D D G N ++     S    +     ++  +G  +  K +     D+E    +  Y L    TD G+P                + PP F+   Y  T  E+    + VI       D +       +   G   ++  I+   G +  +  +D E           + +      F + ++V++ + DINDN P L     N  V E  +   +  +I   D D +    F +
Sbjct:  385 FSINENTGGISIKEELDREKV-PKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDS---GPTNVVYSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASD-GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFS----VDETTG---VIKTAGSLDREKVDTYRFEVTATDHG-IPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIE-VSASDADIGKNAQIIYSFASNGDGQGT-FTIDSTQGIIRTLKPL-----DRET---IPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYE-----TQSEYRLTVRATLSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKV 891          
BLAST of Protocadherin gamma-A1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 119.783 bits (299), Expect = 1.508e-27
Identity = 160/639 (25.04%), Postives = 271/639 (42.41%), Query Frame = 2
Query:  344 LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDF-EKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLG---DSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSL-IESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTV-VLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLP-SKTNYSNLTINIHMPTSDNSKFSSH--ILLILGLIPTCALVILICA-------VIPIVFIVKWQKRRQHHRI 2134
            +  ID+NDN P+F  +  ++++PE+  I +T       D DS   G  ++ LL++    F L S+     L L K +D+      Y L ++  D GS    S   L ++++D+ND +P F   +Y+  V ET    S I++V A D + G+ G+I Y      D++++G R        G+I++   L    +E+  + + A D G+  + +   + + + DVNDN P          + EN+P++  L  V   D D G+NG V+ +  +    +  + +++   G     K+ T+   D+E     +SY  +   TD GS                N+  P F    YS T  E+L   + +   +A  D        I        K   +++  G L L+ P+DRE T    +L ++ +    N++  + + + I V+D+NDN P  +    F+ V   L I S +  +   D DQ  N +     V+    N + D     F++N+   + ST+  LD+E                            YVL+VSA D G    KT+Y  +TI +     +   F  +  I  I   +P    V  I A          I + +  Q  R H +I
Sbjct:  795 IAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSN--TGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLR------NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDT----QVAQFIVDKQTG-----KITTSQVLDREAK---ASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVT-HRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGK-----VRYKIVNGNTDGT---FKINETTGVISTLRALDFEVTNR------------------------YVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKI 1380          

HSP 2 Score: 110.923 bits (276), Expect = 7.791e-25
Identity = 97/361 (26.87%), Postives = 168/361 (46.54%), Query Frame = 2
Query:  125 FSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAIC--------------PKISGTNLPCI--DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG---SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCG-SVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKP 1120
            F + EN P +  +G     +       G + H+    + ++   F++D+ +G I+TS  +DREA                P++  T +  I  DVND  PKF  NK  + + E+  +  +L    ATD D      D   ++ +    F+L  + +   L L+  LD E    + L +   D G   SL +   + I ++D+ND  P FI +     V E L +GS++  V A D+++GD GK+ Y++ + N  G+   +I+  TG I  ++ L      + ++ + A D G    K ++  + I++ D NDNRP  D       I+EN P++  +  ++  D D G N ++   + S  P
Sbjct: 1023 FFVKENEPVATYLG----AVSASDSDEGSNGHVT-YRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL--NQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGT--FKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSP 1374          

HSP 3 Score: 100.138 bits (248), Expect = 1.670e-21
Identity = 158/649 (24.35%), Postives = 259/649 (39.91%), Query Frame = 2
Query:  257 FVIDQYSGVISTSAEIDREA-------ICPKISGTN----------LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSE-DLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG---SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPK---FAWTKLLIHIIDVNDNRPEI------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFL--NCTDNGSPHCNEY-------------PPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGR----IKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQL---KPGNYVLQVSAQDQGLPSKTNYSNLTI-----NIHMPTSDNSKFSSHI 2023
            F ++Q +GV++  + +DRE        +     G N          +  +DVNDN P F +      +PE   I   +    A D D    G   YK++    D  F +  +     +  ++ LDFE    Y L +   D G      S Q + I + D ND  P F +      + E + + + +  + A+D++ G   +I Y + DS    + F +I+S+TG I    P+   E  +  + + A D     +   +    L I I D+NDN P+        + E++P +  +  +   D D G  G V  ++ S    K    L      +    KL+ ++ Y+      V  Y L  + TD GSP    Y             PP F    +  T +E +    +V+K    D D+ S  E   +   G       IDK +G ++    +DREK D   L +    +    +   SS+SV I V+D NDNPP+ +      VV   + E+S  R    + ++D+D   N +     + S     +D                              G F + R TG+L++ ++L      +Y L V A+D   P  T ++N+TI     N + P    S +SS I
Sbjct: 1166 FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKI--NETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTI-DSQSPRAHF-KINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDL------KTGVLKLIGSLDYED-----VPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFR--VSSTSVRINVMDRNDNPPKFIS----PVVTLKVPENSPARLIYTLTVQDLDYGNNTKV----LYSIMSGNTD------------------------------GAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTI 1759          

HSP 4 Score: 92.8189 bits (229), Expect = 2.922e-19
Identity = 125/457 (27.35%), Postives = 202/457 (44.20%), Query Frame = 2
Query:  230 IEYQSEKPLFVIDQYSGVISTSAEIDREAICP---KISGTN--------------LPCI--DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK---ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPHC-------------NEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATSTNEFQI---NGTHGGWFKIHIIDKKNG 1450
            I+ QS +  F I+  +G+I T+  IDRE I     K+  T+              L  I  D+NDN PKF  ++ +  + E+E  N+ +    A D D+ Q G   Y++++ +   F+L        LKLI  LD+E V  Y L +   D GS  L S Q   + ++D+ND  P+F +  +   V+E    G+ ++KV AYD + G   ++ Y +    E   +F  ID  +G I +   +L  EK     +T+ A       + + T + I+++D NDN P+       + + EN P  +I  +  V+D D G N KV   + S     +  I      GR    +L T    D+E     +SY L+    D   P+              N+ PP F    YS+T +E      +++    +D D+ S         N T+G    ++ ID + G
Sbjct: 1369 IDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV-SRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSL--DLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEM-DKF-SIDKHSGLI-VTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLT-VQDLDYGNNTKVLYSIMSGNTDGAFTI------GRSTG-ELSTTTKLDRETK---ASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYG----VYSIDSRTG 1804          

HSP 5 Score: 91.2781 bits (225), Expect = 9.006e-19
Identity = 164/666 (24.62%), Postives = 281/666 (42.19%), Query Frame = 2
Query:  206 GVHFHLQ-QIEYQSE-KPLFVIDQYSGVISTSAEIDREA-------ICPKISGTN----------LPCIDVNDNQPKFQHNKRI---IQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSE---DLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGS--RFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID-------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYF---LNCTDNGSPHC-----------NEYPPYFDSQFYSATTTEELK-SENVIKFALADADAT--STNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV-GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNS-KFSSHILLI 2032
            G +  +Q  IE  S+ + +F I   +GVI  +  +D EA       +  +  G++          +  +DVNDN P    +  +    Q+ EN  I   +     +D DS + G  N  L   +    + F +++   +  + + + LD E  + + L     D G     +++   I + D+ND APKF +  Y   V E   V +L+  V+A D + G   +++Y + ++ E  S   +  ID  +G I     L    + ++++T+   D GS P      +++++ D NDN P  +       +FEN P    +  +  +D D G N   S  L+S     +    L+P KG      LVTN    +  D+ V S +   +  TD G   C           N+  P FD   YS    E  +  +++ +    D D+   +   F I    G   ++  +D  +G + L   +DRE  D   L +  ++ G  +    + + V ITV+D+ND PP       NF + E+S   S +G +     D+  NA+     V S     +D+ + I    N  G +     +D+EK                        P  Y L V A+D+G P    Y+N+TI + +  +DNS +F+S  +L+
Sbjct:  202 GTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLND--ESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGEN---SLILYSIL-TPNTPFFLDPRKG------LVTN---SRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIE--QGNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDS--VNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEV----VYSISKGNTDNIVLI----NSTGTLYLQSEVDHEKI-----------------------PSLY-LTVQAKDKGTPPLFGYANVTIAV-IDINDNSPQFNSSSILV 814          

HSP 6 Score: 89.7373 bits (221), Expect = 2.658e-18
Identity = 89/339 (26.25%), Postives = 147/339 (43.36%), Query Frame = 2
Query:  371 QPKFQHNKRIIQIPENEEINYTLDLEKATD-LDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCD--TGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL--LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP--------EIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPHC-------------NEYPPYFDSQFY 1303
            +PKF+      ++PEN  +  ++   + TD    L  G  +Y +  S        S      + + K LD+E    + LV+   D    S   +  + I + D+ND  P F Q  Y    +E + VG++++ V A D + G  G++ + +   ++ GS    ID KTG I   + L    ++   V++ A D GS P      + I ++D+NDN P        ++ + EN PL+  L  +   D+D GAN ++S  +           L++   G      L TN+++D EN   V  Y L    TD G+P               +EY P F+   Y
Sbjct: 2301 EPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSG----VISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS--FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTV--IGGTGQGLFLIDKFSGW-----LTTNITFDYEN-TAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDY 2625          

HSP 7 Score: 82.0333 bits (201), Expect = 7.650e-16
Identity = 132/560 (23.57%), Postives = 223/560 (39.82%), Query Frame = 2
Query:  275 SGVISTSAEIDREAICPKISGTNLPCI----------------DVNDNQPKFQH--NKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-------------------LDFEKVELYNLVLEVCDTGSLCSKQ--KLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGL------------EKILVTIEAQDCGSVPKFAWTKLL-IHIIDVNDNRPEI----------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEI-LLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALA-DADATSTNE--FQINGTHGGWFKIH--IIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRN-NFEVVENSLIESSLGRIKIRDIDQNRNA 1702
            +GVI+T   +DRE    K+S  NL  +                D+NDN P F    + +++    +++       +K   +DS  FG ++ +        +T++S  +    KLI                     +D E+++ Y L +   D G+  +    +L I + D ND  P+F   +YS  + E + VG+ IL+V A D + G   +I Y            I   S    I+ I P  G+               L+ ++A+D GS  + + + ++ I ++DVNDN P I           + EN  +   +A V V D D G NG+V+  L       S +  +LN          +    S D+E  +H   +FL   C D G P               N+  P FD   Y     E      ++    A D D  S +E  + I  T      +H   ID  +G +     +DRE+     +++ ++     +   + + SV++ + D NDN P     + N  + ENS   S + ++  +D D   N+
Sbjct:   11 AGVITTKTVLDRE----KVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFR-----QKLIAVDS-DFGSNSTQ-------SYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYS-----------IETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLN------DESIIAVGQSLDRETHDH---FFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQ--IPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENS 531          

HSP 8 Score: 78.5666 bits (192), Expect = 8.206e-15
Identity = 163/703 (23.19%), Postives = 284/703 (40.40%), Query Frame = 2
Query:  140 NLPPSNRVG-ILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAE--IDREAI---------CPK----ISG---TNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEK--ATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKF-------IQKNY-------SVVVNETLK-------------VGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL---LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-----ENQPLSIILAIVRVEDKDRGAN-GKVSCQLHSTKPLK----SKEILLN-PI--KGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSEN-VIKFALADADATSTNEFQINGTHGG-WFKIH--------IIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPP--ELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGN-----YVLQVSAQDQGLPSKTNYSNLTINIHMPTSD 1999
            ++P +++VG  +T V  +    A V +    I   ++   F +D ++GVIS ++   +D E+           P+    ++G    ++  ID NDN P F  +  + Q+ E+        + K  ATD+DS   G   Y + T  +     I S    ++   K LD E    ++LV+   D+G     +  ++ + + D+ND  P F       I+++        SVV  +T K              G  IL+V A D + G   +I Y    +N     + +ID+ TG I   + +   +    I + ++A D G  P+ A   + + II   + + E+  +     EN  +   +  VRV D   G   G++S  + ++   +    S  I +N P+  + + +F  +V+ +     +       ++N +D      N+  P F    Y A  +E +     V+  + AD D+         G +G  WF I          ID+K G +     +D E        + +      +    +  SV I V+D+NDNPP   + G N+ +V+EN  + S L  I   D D   NA+ S + +                     G+                GLF +D+F+G LT+       N     Y L + A D G P  +  SN+TI +++   D
Sbjct: 1971 SIPENSKVGSYITTVRARASSDAQVTY---SIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDS-TTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDY-KIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL--VYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSD-----VNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDS---------GANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHE--TIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGG------------------TGQ----------------GLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLS--SNITIIVNVADED 2614          

HSP 9 Score: 62.3882 bits (150), Expect = 6.992e-10
Identity = 150/667 (22.49%), Postives = 259/667 (38.83%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREA------------ICP----KISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLI---IEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHA--YDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIY----LIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE--------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLN--CTDNGSPHCNEY--------------PPYFDSQFYS--ATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKS-----FCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSK 1951
            VT  + EN P   R+ I T  ++   Y       L  I   +    F I + +G +ST+ ++DRE             I P      +   +   D NDN P FQ +     I E      ++    A+D DS   G   Y L +++      I S         ++    K E YN      D G    K  ++   I+I D N+ AP+F +  Y V +       +L+  V A   D +K   GK+ YRL DS    S F+ ++S TG +        P  G   + +   A+D GS P   +  + I I ++ D+ P         + I EN  +   +  VR       ++ +V+  + S    K +   ++P  G      +++  S D  +     ++ L+   T  G    N Y              P +  S   +  A  T   K   V+K    D D+ +  +   +   G    +  ID   G++     +DRE T   DL+I   + G+  K  +++  V + V D+NDNPP     +   + E++   + +  +   D D+     +++ S  +        + +D     + Q+     I ++  +DY K     G+    R T D+    +++     + V A DQG+P +
Sbjct: 1651 VTLKVPENSPA--RL-IYTLTVQDLDYGNNTKV-LYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL-SNDTYGVYSIDSRTGIVYSAARFETSIKQE-YNFFCIAKDQGQ-DPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFV-VESNTGSVRTSAGFSNPPQGRHALYII--AEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGN--KGRAFYVDPFTG------VISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPK--STNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDY-KIDADTGVISARR-TIDV----RIRDSFIQIPVQAMDQGVPPQ 2288          

HSP 10 Score: 60.4622 bits (145), Expect = 3.084e-9
Identity = 57/222 (25.68%), Postives = 94/222 (42.34%), Query Frame = 2
Query:  230 IEYQSEKPLFVIDQYSGVISTSAEIDREAI-------------CPKIS---GTNLPCIDVNDNQPKFQ-HNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY---------LDFEKVELY--NLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILY 805
            I+   +K  F ID+ +GVI T   +D E I              P +       +  +D+NDN P F+      +Q+ EN  +N  L    ATD DS            +  L FT+I    Q    + K+          D+E   +Y  +L ++  D G+  L S   +I+ + D ++  P F + +Y   V    K+G  + +V A D + GD G++ +
Sbjct: 2446 IQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSG----------ANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          
BLAST of Protocadherin gamma-A1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 164.466 bits (415), Expect = 1.772e-41
Identity = 171/692 (24.71%), Postives = 294/692 (42.49%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI---------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQ-------PKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            + + + E  PP+  +G L    +     +G   HL ++E  +  P   +D  +G + +T   IDRE +                            P++    +   D+NDN P+F  +   I +PEN  +     +  ATD DS + G+ +Y L    D   TL    +        P+L ++  LD E  + Y+L ++  D G+    S+  L + + D ND +PKF   +Y   V+E   VG  +L+V A D++ G  G+I Y L  + +   + +RID  TG IY+  PL   E   +   + A+D G  PK + T + I + D NDN P ++               I E+ P+   +A+V+V DKD G N  V+C +    P + +    +    + K++ +  T + Y++  +  V    +   D+G+P               N+  P F    +     EE +  E ++     DAD+ +  E   N     + K +  ID   G++    P+DRE  +R +  +   + G      T  ++V+I V+D NDN P+ ++   +F V+EN    S +G + + D+D+  NA   +S            K  +    N  G I S++  D EK                          +Y  ++ A D G P +++Y  +TIN+
Sbjct:   24 ILYRVQEEQPPNTLIGSL--AADHGLPDSG---HLYKLEVGA--PYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDA-ATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVE---IVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGT--ATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS------VEPDGGKFVVQ---NGTGTILSSISFDREKES------------------------SYTFRLKAVDGGEPPRSSYVGVTINV 669          

HSP 2 Score: 67.3958 bits (163), Expect = 4.151e-11
Identity = 119/507 (23.47%), Postives = 199/507 (39.25%), Query Frame = 2
Query:  350 CIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLI---ESSLGRIKIRDIDQNRNAQ--FSISS 1720
              D NDN PKF+H     ++ EN  + +++   KA D D    G   Y L  + D    L+       +  +K  LD E++   +  +   D G     SK  + IE+ D ND AP    +   +V        ++E + VG+ +  V   D ++G+         G + ++L  +++  S     D+K          L  E++    V I A D G+    +   L + + DVNDN P       E+D  E NQP   IL +    D D G N ++   +     +K     ++P  G  K          D+E+      + +   D GSP              CN+  P F    YS +  E +   + +    + D D        ++    GG F   ++    G ++     DREK       +  ++ G   +  +S   V I V+D NDN P +   +N    + S +   +S +  ++  D+D   NA   FSI+ 
Sbjct:  234 VTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTS-----DNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVT-ATDADSGTNAELFYNIVGDSYIKGL-FEIDPNTGEVK-----ARTPLDREHKERYE-FRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKF---VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR--SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAG 722          
BLAST of Protocadherin gamma-A1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 164.466 bits (415), Expect = 2.742e-41
Identity = 171/692 (24.71%), Postives = 294/692 (42.49%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSG-VISTSAEIDREAI---------------------------CPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQ-------PKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE--KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEID---------------IFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFY-KLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFK-IHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPE-LVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            + + + E  PP+  +G L    +     +G   HL ++E  +  P   +D  +G + +T   IDRE +                            P++    +   D+NDN P+F  +   I +PEN  +     +  ATD DS + G+ +Y L    D   TL    +        P+L ++  LD E  + Y+L ++  D G+    S+  L + + D ND +PKF   +Y   V+E   VG  +L+V A D++ G  G+I Y L  + +   + +RID  TG IY+  PL   E   +   + A+D G  PK + T + I + D NDN P ++               I E+ P+   +A+V+V DKD G N  V+C +    P + +    +    + K++ +  T + Y++  +  V    +   D+G+P               N+  P F    +     EE +  E ++     DAD+ +  E   N     + K +  ID   G++    P+DRE  +R +  +   + G      T  ++V+I V+D NDN P+ ++   +F V+EN    S +G + + D+D+  NA   +S            K  +    N  G I S++  D EK                          +Y  ++ A D G P +++Y  +TIN+
Sbjct:  101 ILYRVQEEQPPNTLIGSL--AADHGLPDSG---HLYKLEVGA--PYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDA-ATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVE---IVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGT--ATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS------VEPDGGKFVVQ---NGTGTILSSISFDREKES------------------------SYTFRLKAVDGGEPPRSSYVGVTINV 746          

HSP 2 Score: 67.781 bits (164), Expect = 3.879e-11
Identity = 119/509 (23.38%), Postives = 200/509 (39.29%), Query Frame = 2
Query:  356 DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKY-LDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKFIQKNYSVV--------VNETLKVGSLILKVHAYDNEKGD--------FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI---LVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRP-------EIDIFE-NQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP-------------HCNEYPPYFDSQFYSATTTEELKSENVIKF-ALADADATSTNEFQIN-GTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLI---ESSLGRIKIRDIDQNRNAQ--FSISSVKSF 1732
            D NDN PKF+H     ++ EN  + +++   KA D D    G   Y L  + D    L+       +  +K  LD E++   +  +   D G     SK  + IE+ D ND AP    +   +V        ++E + VG+ +  V   D ++G+         G + ++L  +++  S     D+K          L  E++    V I A D G+    +   L + + DVNDN P       E+D  E NQP   IL +    D D G N ++   +     +K     ++P  G  K          D+E+      + +   D GSP              CN+  P F    YS +  E +   + +    + D D        ++    GG F   ++    G ++     DREK       +  ++ G   +  +S   V I V+D NDN P +   +N    + S +   +S +  ++  D+D   NA   FSI+    +
Sbjct:  313 DANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTS-----DNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVT-ATDADSGTNAELFYNIVGDSYIKGL-FEIDPNTGEVK-----ARTPLDREHKERYE-FRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKF---VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPR--SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPY 803          
BLAST of Protocadherin gamma-A1 vs. Ensembl Medaka
Match: ENSORLT00000005205.2 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 152.91 bits (385), Expect = 8.919e-38
Identity = 187/772 (24.22%), Postives = 316/772 (40.93%), Query Frame = 2
Query:   89 CIVSATKSL-DVTFSISENLPPSNRVGILTE--VIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKIS-----------------GTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDL---PFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK---ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATST-------NEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV------GRNNFEVVENSL-IESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYV---LQVSAQDQGLPSKTNYSNLTINIHMPTS------------------DNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRR--QHHRIPL 2140
            C+VS    L  V++SI E +P  + VG + +   +E  R  +G      +I  ++      +++  GV+     IDREA+C + +                   N+   D+NDN P F+      +I E+  I     L +A DLD  + G+ +Y+L  + +    P    +     ++ L K LD EK E  +LVL   D G   +     +++ ++D+ND AP F Q+ Y   V E    G+++  V A D ++G   +I Y + ++  +      I  K GE+ LI+  +  EK     +TI A D G +      KLL+ I DVNDN+PEI+I        E+  L+ ++ ++ +ED D G NGKV C ++   P   K  + N       FY L T+   D+E     S Y   + C+D G P               N+  P F+   Y A   E      ++      DAD            +  +NG     +     D  +G +  +   D E+    D    +      +   +S+ +V I + D NDNPP+++      G    E+V  S  +   + ++   D+D  +NA        S+   K+ D++                            LF++    G++ ++ Q+   + +   L V  +D G PS++  + + +N+ +  S                  DN  F     L+L L     L I    VI  V I +W++ R   H  +P+
Sbjct:   10 CLVSLASVLGQVSYSIPEEMPKGSLVGNIAQDLGLETKRLISG----KAKIYSRNSGEYVELNRERGVLLVKERIDREALCAETALCALHFQIILENPMEHYTVNIQITDINDNAPAFEKTTVKFRISESAIIGAKFLLARAEDLDVEKNGVQSYELKPTNNFALNPHHTAAGTKNVEMVLQKPLDREKEEQISLVLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADQGSNSRITYSITNTVGHYKHLFDIHEKNGEVILIEN-IDYEKSKHFEITIGATDDGGLTDSC--KLLLDIQDVNDNKPEINIMSKSNVIQEDAKLNTVVTMIHIEDLDSGDNGKVVCLMNENIPFLLKSTINN-------FYSLQTDSELDRET---ASEYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNAHVSYVLEDSSVNGVPVSSYVSVSAD--SGVIHAVRSFDYEQ--IKDFRFSVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWL------SYKLQKATDRV----------------------------LFEVGSQNGEIRTVRQVTEKDLLKQRLTVIVEDNGQPSRS--ATVIVNVAVADSFPEVLSEFTDFPHDKDYNDNLTF----YLVLALAVVSFLFITCLVVIISVKIYRWRQSRILYHSSLPV 720          
BLAST of Protocadherin gamma-A1 vs. Ensembl Medaka
Match: ENSORLT00000030657.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 150.214 bits (378), Expect = 6.430e-37
Identity = 190/770 (24.68%), Postives = 313/770 (40.65%), Query Frame = 2
Query:   89 CIVSATKSL-DVTFSISENLPPSNRVGILTE--VIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKIS-----------------GTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPK---LKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATST-------NEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV------GRNNFEVVENSL-IESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYV---LQVSAQDQGLPSKTNYSNLTINIHMPTSDN-----SKFSSH-----------ILLILGLIPTCALVILICAVIPIVFIVKWQKRR--QHHRIPL 2140
            C+VS    L  V++SI E +P  + VG + +   +E  R  +G      +I  ++      +++  GV+     IDREA+C + +                   N+   D+NDN P F+  K   +I E+  I     L  A DLDS    +  Y+L  +     T  +SP   K   + L K LD EK E  +LVL   D G   +     +++ ++D ND AP F Q+ Y   V E    G+++  V A D + G   +I Y + ++      +  ID + GE+ LI  +   EK +   + I A D G +      KL++ I D+NDN PEI+I        EN  LS ++ ++ VED D G NGKV C ++   P   K  + N       FY L T+   D+E     S Y   + C+D G P               N+  P F+   Y A   E      ++      DAD            +  +NG     +     D  +G +  +   D E+    D    +      +   +S+ +V I + D NDNPP+++      G    E+V  S  +   + ++   D+D  +NA        S+   K+ D+                             LF++    G++ ++ Q+   + +   L V  +D G PS++     T+ +++  +D+     S+F+               L+L L     L I    VI  V I +W++ R   H  +P+
Sbjct:   30 CLVSLASVLGQVSYSIPEEMPKGSLVGNIAQDLGLEMKRLISG----KAKIYSRNSGEYVELNRERGVLLVKERIDREALCAETALCALHFQIILENPMEHYTVNIQITDINDNAPAFKKAKMNFKISESAIIGSKFVLATAEDLDSDINAVQRYELKPTNIFSLTSQNSPDVNKNVEMVLQKPLDREKEEQISLVLTAVDGGEPQMSGTMMIVVTVLDANDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADHGSNSRITYSITNTVGNVGEYFDIDKEKGEVILINNI-DYEKSISFQINIGATDDGGLTNSC--KLIVDIQDINDNEPEINIMSKSNIIPENAKLSTVVTMIHVEDLDSGNNGKVQCLMNENIPFLLKSTINN-------FYSLQTDSELDRE---KASGYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSAD--SGVIHAVRSFDYEQ--IKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWL------SYKLQKATDR----------------------------ALFEVGSQNGEIRTVRQVTEKDLLKQRLTVIVEDNGQPSRS----ATVIVNVAVADSFPEVLSEFTDFPHDKDYNDNLTFYLVLALAVVSFLFITCLVVIISVKIYRWRQSRILYHSSLPV 740          
BLAST of Protocadherin gamma-A1 vs. Ensembl Medaka
Match: ENSORLT00000045699.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 149.828 bits (377), Expect = 9.580e-37
Identity = 190/770 (24.68%), Postives = 313/770 (40.65%), Query Frame = 2
Query:   89 CIVSATKSL-DVTFSISENLPPSNRVGILTE--VIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKIS-----------------GTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPK---LKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL---VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF-------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSY--FLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTE-ELKSENVIKFALADADATST-------NEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV------GRNNFEVVENSL-IESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYV---LQVSAQDQGLPSKTNYSNLTINIHMPTSDN-----SKFSSH-----------ILLILGLIPTCALVILICAVIPIVFIVKWQKRR--QHHRIPL 2140
            C+VS    L  V++SI E +P  + VG + +   +E  R  +G      +I  ++      +++  GV+     IDREA+C + +                   N+   D+NDN P F+  K   +I E+  I     L  A DLDS    +  Y+L  +     T  +SP   K   + L K LD EK E  +LVL   D G   +     +++ ++D ND AP F Q+ Y   V E    G+++  V A D + G   +I Y + ++      +  ID + GE+ LI  +   EK +   + I A D G +      KL++ I D+NDN PEI+I        EN  LS ++ ++ VED D G NGKV C ++   P   K  + N       FY L T+   D+E     S Y   + C+D G P               N+  P F+   Y A   E      ++      DAD            +  +NG     +     D  +G +  +   D E+    D    +      +   +S+ +V I + D NDNPP+++      G    E+V  S  +   + ++   D+D  +NA        S+   K+ D+                             LF++    G++ ++ Q+   + +   L V  +D G PS++     T+ +++  +D+     S+F+               L+L L     L I    VI  V I +W++ R   H  +P+
Sbjct:   30 CLVSLASVLGQVSYSIPEEMPKGSLVGNIAQDLGLEMKRLISG----KAKIYSRNSGEYVELNRERGVLLVKERIDREALCAETALCALHFQIILENPMEHYTVNIQITDINDNAPAFKKAKMNFKISESAIIGSKFVLATAEDLDSDINAVQRYELKPTNIFSLTSQNSPDVNKNVEMVLQKPLDREKEEQISLVLTAVDGGEPQMSGTMMIVVTVLDANDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADHGSNSRITYSITNTVGNVGEYFDIDKEKGEVILINNI-DYEKSISFQINIGATDDGGLTNSC--KLIVDIQDINDNEPEINIMSKSNIIPENAKLSTVVTMIHVEDLDSGNNGKVQCLMNENIPFLLKSTINN-------FYSLQTDSELDRE---KASGYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSAD--SGVIHAVRSFDYEQ--IKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWL------SYKLQKATDR----------------------------ALFEVGSQNGEIRTVRQVTEKDLLKQRLTVIVEDNGQPSRS----ATVIVNVAVADSFPEVLSEFTDFPHDKDYNDNLTFYLVLALAVVSFLFITCLVVIISVKIYRWRQSRILYHSSLPV 740          
BLAST of Protocadherin gamma-A1 vs. Planmine SMEST
Match: SMESG000030992.1 (SMESG000030992.1)

HSP 1 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 596/702 (84.90%), Postives = 610/702 (86.89%), Query Frame = 2
Query:   86 GCIVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPC-------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE--------------------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQ-LGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLP------SKTNYSNLTINIHMPTSDNSKFS 2014
            GCIVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPC                   +DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE                    IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSP              CNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTDRIDLLIIIINIGLDNKNFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQ   + +   D+    LTS   +      LQ+  ++   P      SK NY NL++++   T  +SK +
Sbjct:   35 GCIVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPCSISLVVSVVEYLINIKINIVDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEVRFNPSQNVTSKYISDNFYQIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPRLSTVVSININILDCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTDRIDLLIIIINIGLDNKNFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQQCIISVIATDQGIPSLTSTLTVH-----LQILDENDNYPQWVFPSSKDNYLNLSVSV---TGSSSKLT 728          

HSP 2 Score: 363.229 bits (931), Expect = 1.257e-110
Identity = 284/725 (39.17%), Postives = 366/725 (50.48%), Query Frame = 2
Query:  353 IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP--FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAP------------KFIQKN-YSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKI--LVT----------------IEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSIILA-------IVRVEDKDRGANGKVSCQLHSTK----------PLKSKEILLNPI----KGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWF-----KIHIIDKKN--GKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELV---GRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHCPDVNHLTRSEFGNEIKSPKNSLTLKSKYKNALHNDELENSKGFASMPPDIQDIC 2329
            ID+ND  PKF      + + E  ++   +    A D +   FG   Y+L  S +    F  I S       +   L  EK+ +    +E  D GS+   +  KL+I IID+ND  P            K+I  N Y + + E   +  ++  V   D ++G  GK+  +L  +    S+ I          L+ P+ G  K   LVT                +   D GS        + I+I+D N+  P    F++Q  S           +++    D  A      Q++ T               K +L++PI      R     ++ N+  D +N    SS  +   D      N+ PP    +         L   ++ +  + D D     +F I+      F     KI I  + N  G++     +D EK      +I +I       + TS+ +V + ++D NDN P+ V    ++N+  +  S+  SS    +IR ID ++ A  +I+                                   K   QLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHCPDVNHLTRSEFGNEIKSPKNSLTLKSKYKNALHNDELENSKGFASMPPDIQDIC
Sbjct:  247 IDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILV---TIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEVRFNPSQNVTSKYISDNFYQIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEI----------LLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPRLSTVVSININILDCNEYPP---YFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTDRIDLLIIIINIGLDNKNFTSSSSVLITVID-----INDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEK--FQQCIISVIATDQGIPSLTSTLTVHLQILDENDNYPQWVFPSSKDNYLNLSVSVTGSSSKLTRIRAIDLDKGANENITY----------------------------------KLHSQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHCPDVNHLTRSEFGNEIKSPKNSLTLKSKYKNALHNDELENSKGFASMPPDIQDIC 914          
BLAST of Protocadherin gamma-A1 vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 344.354 bits (882), Expect = 3.573e-105
Identity = 233/648 (35.96%), Postives = 357/648 (55.09%), Query Frame = 2
Query:   92 IVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPL----FVIDQYSGVISTSAEIDREAICPKISGTNLPC-------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP---FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGS-VPKFAWTKLLIHIIDVNDNRPEI---------------------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIK-GRHKF-YKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHG---GWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV---LDYE 1822
            I+ ++K + + F I EN+P +++VG L   I+  +          Q++Y    P     F ++     I+T  EIDREAIC ++SGT   C                   +D+NDN PKFQ  +R  +I E+E +N+ + L++A DLDS Q G+ +Y L  S+      F L  +     L LIK LD+E +  + L L  CD G   LCS QKL+I+IIDIND APKF+ KNY+ VV E L VGS+ILKVHA D E GDFGKI+Y+L  + ++ + F+ ID  +G I L KPL  ++K+ +T+EA D      KF WT ++I IIDVN++RP I                     +IFEN P +  ++ + V DKD G NG V C++ +TK LK+   L + ++  ++ + YKL    S D+E  ++  ++ +NC DNG P               NEYP  F    YS +  E   + +++ FA+ D DA S NEF +N ++      F +  + + +G++ + +P+DREK+ R    I ++N   DN  FTS ++V + V+DINDN P+ VGR +FE+ EN++    LG++   D D   N++ SISS+ + C+  + +K++ +  +  I E++   V   +DYE
Sbjct:   19 ILDSSKEMIIKFRIYENVPINSKVGDLNTTIDALKLNKP----QLQVQYCDRNPFDIEFFYLNVTDASINTHTEIDREAICSELSGTTNDCFVTLGVTLNQYLINIYVYILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPT-EKLSGNEDLFWISELKILQVKQSMDYE 661          
BLAST of Protocadherin gamma-A1 vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 343.584 bits (880), Expect = 6.848e-104
Identity = 233/648 (35.96%), Postives = 357/648 (55.09%), Query Frame = 2
Query:   92 IVSATKSLDVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPL----FVIDQYSGVISTSAEIDREAICPKISGTNLPC-------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLP---FTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGS-VPKFAWTKLLIHIIDVNDNRPEI---------------------DIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIK-GRHKF-YKLVTNVSYDKENDNHVSSYFLNCTDNGSPHC-------------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHG---GWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVV---LDYE 1822
            I+ ++K + + F I EN+P +++VG L   I+  +          Q++Y    P     F ++     I+T  EIDREAIC ++SGT   C                   +D+NDN PKFQ  +R  +I E+E +N+ + L++A DLDS Q G+ +Y L  S+      F L  +     L LIK LD+E +  + L L  CD G   LCS QKL+I+IIDIND APKF+ KNY+ VV E L VGS+ILKVHA D E GDFGKI+Y+L  + ++ + F+ ID  +G I L KPL  ++K+ +T+EA D      KF WT ++I IIDVN++RP I                     +IFEN P +  ++ + V DKD G NG V C++ +TK LK+   L + ++  ++ + YKL    S D+E  ++  ++ +NC DNG P               NEYP  F    YS +  E   + +++ FA+ D DA S NEF +N ++      F +  + + +G++ + +P+DREK+ R    I ++N   DN  FTS ++V + V+DINDN P+ VGR +FE+ EN++    LG++   D D   N++ SISS+ + C+  + +K++ +  +  I E++   V   +DYE
Sbjct:   19 ILDSSKEMIIKFRIYENVPINSKVGDLNTTIDALKLNKPQ----LQVQYCDRNPFDIEFFYLNVTDASINTHTEIDREAICSELSGTTNDCFVTLGVTLNQYLINIYVYILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPT-EKLSGNEDLFWISELKILQVKQSMDYE 661          
BLAST of Protocadherin gamma-A1 vs. Planmine SMEST
Match: SMESG000026621.1 (SMESG000026621.1)

HSP 1 Score: 227.639 bits (579), Expect = 8.288e-63
Identity = 193/631 (30.59%), Postives = 304/631 (48.18%), Query Frame = 2
Query:  119 VTFSISENLPPSNRVGILT---EVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPC-------------------IDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDL--PFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL-LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDI---------------------FENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNG-----SPHC--------NEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAID-FQVNKIGEIRSTVVLDYEK 1825
            ++F+++EN P +  +G ++   +V EK        + ++ I  +  K LF ID  +G+I  S  +DRE ICP++S T+  C                   +D NDN P F ++  +I + E+  +   L L+ ATDLDSL  G+  Y+L TSE +  PF+L  +     L+++  LDFE  + Y L L VCD G+   CS Q + I I+D+ND  P F +  Y  ++NE   VG +IL+V A D +   +G + Y+   +N    R+ +ID  TG I+LI+PL    +     IEA+D G VP    T + IH+ D+N++ P+I I                     +EN P +  +  + V DKD   NG+V C +          +  N I  +   Y+LV   S + E+   V    ++C+D+G     S H         NE+P  F+   YS +  E   S N +  ++ D D TS     I   +      ++  +   +L+L   +D E    I+  I IIN G      TS++S  IT+IDINDN P L+    F + E++   S++G IK  D D+N N+      +     N S++K  ++ F++   G I+    LD EK
Sbjct:   52 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTIMNDIVNIVIIIVDENDNPPMFANSNIVINVKESTPLGTHLYLKHATDLDSLDNGVGEYRL-TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNK-VIYRLVALSSANCESRKEV-MVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN-LPLSIHDQDCTSDVIVNITDLYARSHFRYL--QATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLTSTTSFFITIIDINDNAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKI-----NVSNNKRGLENFRIESDGTIKLMKELDREK 671          

HSP 2 Score: 50.8322 bits (120), Expect = 3.790e-6
Identity = 49/160 (30.63%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  551 KLKLIKYLDFEKVELYNLVLEVCDTGS----LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGD--SNEYGSRFIRIDSKTGEIYLIKPLLGLEKIL--VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE 1006
            +L L  +LDFE     N  +E+ + G     L S     I IIDIND AP  ++   +  + E  K GS I  + A D+++     ++++  +  +N+ G    RI+S  G I L+K L   ++ L  + I A D G+        + I ++DVNDN P+
Sbjct:  551 QLVLFSHLDFETKSSINFSIEIINKGPHRNFLTSTTSFFITIIDINDNAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLMKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQ 708          

HSP 3 Score: 50.0618 bits (118), Expect = 7.122e-6
Identity = 45/155 (29.03%), Postives = 80/155 (51.61%), Query Frame = 2
Query:  554 LKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFI---QKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEI-YLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIID--VND 994
            +KL+K LD EK  LY L +   D G+  L +   + I ++D+ND  P++I   Q +  +  +   +VG++I ++HA D +      I Y +   N   +++  +    GE+ +L  P  G  K ++ I A D G+  +   T+L ++I D  +ND
Sbjct:  661 IKLMKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN---AKYFYLHPIKGELSFLTTPRQG--KNILDIVAIDNGNPVRSNQTRLFLYISDKSIND 810          
BLAST of Protocadherin gamma-A1 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.109e-54
Identity = 201/681 (29.52%), Postives = 309/681 (45.37%), Query Frame = 2
Query:  116 DVTFSISENLPPSNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPL--FVIDQYSGVISTSAEIDREAICP---------KISGTNLPCI-----------DVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGS-RFIRIDSKTGEIYLIKPLLGLEKIL----VTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIF------------ENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPH-------------CNEYPPYFDSQFYSATTTEELK-SENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVEN-SLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLT---SISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINI 1981
            ++ +++ E +   N VG L      F+ +    F L    Y   K L  F +++ +G +  +  IDRE +CP         +I  T    I           DVND+QPKF  +   IQI E  ++ Y + L  A+D D     +  Y +    D  F +  S +   L +I  LD+E    Y   L  CD G   LC  Q L I ++DIND  P F QK Y V++ E   VG ++  V A D + G FG++ YR G   +     +  I + TGEI L + +L  + I     + IEA D GSVPK  +  + +H+ DVN+ RP I+I             ENQ L    AI+ V D D G N +V C L +      K      +KGR   Y L  N  +D+E D+H     L C+D G+P               NE+ P F  Q Y+   +E       +++    D DAT+   +Q+  +   +F    ID+  G L   + +DREK D+I+L+++ I+ G      T++++V IT+ D+NDNPP ++     +V EN   +   L +I+ RD D   N          F   + +DK  +     KI E R+ +             F +D  +G+LT   S+ +    +Y+L +   DQG P  T+   +T+ +
Sbjct:  172 NIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKL----YDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND-TFNITFSNLL-YLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQR-ILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGR-DIYTLQPNRVFDREVDSHFQVRML-CSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQLLYQLAPSQNAFF---FIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQ-TATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTV------RFYIQRVEDKRGL---AEKIDENRTKI-------------FSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTV 816          

HSP 2 Score: 58.151 bits (139), Expect = 2.795e-8
Identity = 134/666 (20.12%), Postives = 263/666 (39.49%), Query Frame = 2
Query:  344 LPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSED---LPFTLISSPMQPKLKLIKYLDFEKV-ELYNLVLEVCDTGSL--CSKQKLIIEIIDINDMAPKF-------IQKNYSVVVNETLKVGSLILKVHAYD---NEKGD----FGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEK-----ILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPE-------IDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDK-------------ENDNHVSSYFLNCTD-NGSP------------HCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTXXXXXXXXXXXXXXXXXXFTSSSSVLITVIDINDNPPELVGRNNFEVVENS---LIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRSTVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDNSKFSS---------HILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHR 2131
            +  +D+NDN P F   +  + I EN  +   +    A D+DS  FG   Y+    +D   L +  IS+    ++KL + L+ + + + ++L +E  D GS+       + + + D+N+  P          +K+++V  N+TL     I+ V   D   N + D     G   ++L +S     R         +IY ++P    ++       V +   D G+       ++ + I DVN+  P        +++ EN  + ++L  +   D D  A       L+   P ++    ++   G  +   ++     DK              +    ++ F+  TD N +P               E  P F +Q  +     +L     ++F +   +       +I+       KI  ID+ +G L +   +DRE       ++ I+         TS  ++ +TV+DINDNPP+      F+ V +S     +S L + +   I Q  +     ++  ++   + DD + I                              D   GDL +   ++ G+Y++++ A D G P+ +      I I++  S  S FS+          +++++ ++ T   V+L+   I ++F+ K   + Q+ R
Sbjct:  370 ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYIST-YTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGR---------DIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQ-----LLYQLAPSQNAFFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQAR--DPDLGENGTVRFYIQRVEDKRGLAEKIDENRT---KIFSIDEISGNLTIYKSLDRE--YIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-----FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYI------------------------------DAIIGDLRARQSIREGHYLIKLVANDNGNPNLST----EIKINLYISSKSTFSTVINISDDQFRVVIVIAMV-TMGGVVLLGLFIFLMFMKKRSVKMQNER 973          
The following BLAST results are available for this feature:
BLAST of Protocadherin gamma-A1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11.133e-4124.13protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH12.936e-4124.13protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDHGA112.233e-4025.77protocadherin gamma subfamily A, 11 [Source:HGNC S... [more]
PCDHGA113.568e-4025.96protocadherin gamma subfamily A, 11 [Source:HGNC S... [more]
PCDHGA81.498e-3925.21protocadherin gamma subfamily A, 8 [Source:HGNC Sy... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-16.670e-3024.69FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-18.333e-3024.69FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.154e-1928.95CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-12.060e-1924.17Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.060e-1924.17Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan2.329e-3527.17gene:FBgn0024836 transcript:FBtr0304899[more]
stan2.329e-3527.17gene:FBgn0024836 transcript:FBtr0300578[more]
stan2.412e-3527.17gene:FBgn0024836 transcript:FBtr0304900[more]
stan2.587e-3527.17gene:FBgn0024836 transcript:FBtr0303223[more]
stan2.587e-3527.17gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.716e-4324.89protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.855e-4324.89protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh192.509e-3925.27protocadherin 19 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
pcdh192.870e-3925.27protocadherin 19 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
pcdh193.746e-3925.27protocadherin 19 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh172.998e-4025.04protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.037e-4025.04protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.464e-4025.29protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.505e-4025.29protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh178.627e-4025.29protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.226e-4324.93protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.226e-4324.93protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh181.091e-4125.10protocadherin 18 [Source:MGI Symbol;Acc:MGI:192042... [more]
Pcdh182.298e-4125.10protocadherin 18 [Source:MGI Symbol;Acc:MGI:192042... [more]
Pcdh17.279e-4025.33protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
back to top
BLAST of Protocadherin gamma-A1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN5.442e-4124.13Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q8VHR0|PCD18_MOUSE1.607e-4025.10Protocadherin 18 OS=Mus musculus OX=10090 GN=Pcdh1... [more]
sp|Q9Y5H2|PCDGB_HUMAN1.713e-3925.96Protocadherin gamma-A11 OS=Homo sapiens OX=9606 GN... [more]
sp|Q5DRC0|PCDGB_PANTR2.700e-3925.96Protocadherin gamma-A11 OS=Pan troglodytes OX=9598... [more]
sp|Q9Y5G5|PCDG8_HUMAN2.553e-3825.21Protocadherin gamma-A8 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SFK83.477e-4627.85Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3VT891.908e-4529.57Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3S9412.815e-4328.33Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YWS83.205e-4328.33Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3TQS65.683e-4328.34Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a9.941e-4024.57protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.203e-3924.57protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
ENSAMXT00000050733.11.805e-3627.72pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh18b3.694e-3626.01protocadherin 18b [Source:ZFIN;Acc:ZDB-GENE-080804... [more]
pcdh1b9.059e-3624.05protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-199f5.11.019e-3023.31protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.13.722e-2724.71pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.11.147e-2524.15pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh111.939e-2524.92protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000000577.12.761e-2431.02pep scaffold:Pmarinus_7.0:GL481640:2256:11833:1 ge... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.147e-3426.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354124.182e-3126.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333594.806e-2925.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482372.227e-2825.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.508e-2725.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.772e-4124.71protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.742e-4124.71protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
ENSORLT00000005205.28.919e-3824.22protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000030657.16.430e-3724.68protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000045699.19.580e-3724.68protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Protocadherin gamma-A1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030992.11.257e-11084.90SMESG000030992.1[more]
SMESG000043597.13.573e-10535.96SMESG000043597.1[more]
SMESG000043597.16.848e-10435.96SMESG000043597.1[more]
SMESG000026621.18.288e-6330.59SMESG000026621.1[more]
SMESG000076350.11.109e-5429.52SMESG000076350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027704 ID=SMED30027704|Name=Protocadherin gamma-A1|organism=Schmidtea mediterranea sexual|type=transcript|length=2330bp
TTTTTTTTCAAATTTATTACTCCTCATTGATTTATTCATTGTTATTCGAT
TATCTCGATTGTCATTGGATAGTTTTTTCTTTTTTGGATGTATTGTGAGT
GCAACAAAATCATTAGACGTGACTTTTAGCATTTCAGAAAATTTACCCCC
CTCAAATAGAGTCGGTATTTTGACAGAAGTCATTGAGAAATTTAGATATA
AAGCTGGAGTTCATTTTCATCTGCAACAAATTGAATATCAGTCTGAAAAA
CCTTTATTTGTAATAGACCAGTATTCAGGAGTCATTTCTACGTCGGCTGA
GATTGACAGAGAGGCCATTTGTCCTAAGATCTCGGGAACGAACTTGCCTT
GCATTGACGTCAATGATAATCAACCAAAATTTCAGCACAATAAACGAATT
ATACAAATACCAGAGAATGAAGAAATAAATTATACCTTGGATTTGGAAAA
AGCAACTGACTTGGATAGCCTTCAATTTGGCATAGACAATTATAAACTGT
TGACATCAGAAGACTTGCCGTTTACACTTATCTCCTCTCCAATGCAACCT
AAGCTGAAGTTAATAAAATATTTGGATTTTGAAAAGGTTGAACTGTACAA
TTTGGTACTAGAGGTTTGTGACACGGGCTCATTGTGTTCTAAACAAAAGC
TAATAATAGAAATAATAGACATAAATGATATGGCACCAAAGTTTATTCAA
AAGAACTATTCAGTTGTCGTCAATGAAACCCTCAAGGTCGGATCCCTAAT
TCTTAAAGTCCATGCATATGACAACGAAAAAGGGGATTTTGGTAAAATAC
TTTATCGGTTAGGAGATTCCAATGAATATGGGTCCCGATTTATTAGAATT
GATTCTAAAACCGGTGAAATTTATTTAATTAAACCTTTATTGGGATTGGA
AAAAATCCTTGTCACCATTGAAGCTCAAGATTGTGGTTCAGTTCCAAAGT
TTGCTTGGACGAAATTATTAATTCACATAATTGATGTTAACGACAATCGG
CCTGAGATTGACATATTCGAAAACCAACCTCTTTCCATTATTTTAGCAAT
CGTACGAGTCGAAGATAAAGATAGAGGAGCTAATGGGAAAGTCTCTTGTC
AACTTCATAGTACAAAGCCATTGAAATCGAAAGAAATCCTTTTGAATCCT
ATAAAGGGTAGACATAAATTTTATAAGCTTGTGACAAATGTGTCCTACGA
CAAGGAAAACGATAATCATGTATCTTCTTATTTTTTAAATTGTACGGATA
ATGGGTCTCCACACTGCAACGAATACCCCCCATATTTTGATAGCCAATTT
TACAGCGCGACAACGACGGAAGAATTGAAATCGGAAAACGTTATTAAGTT
TGCGTTGGCTGACGCAGACGCAACGTCGACCAATGAATTTCAAATCAACG
GCACCCATGGAGGTTGGTTTAAAATTCATATAATCGATAAGAAAAACGGA
AAATTAATGTTGATGCACCCGATTGATCGGGAGAAAACTGATCGGATCGA
TTTGTTAATAATTATAATAAATATTGGACTTGATAATAAAAATTTCACCA
GCAGCAGCTCGGTATTAATAACTGTGATAGATATTAACGATAATCCTCCA
GAGCTCGTTGGGAGAAATAACTTTGAAGTCGTTGAAAATTCCTTAATCGA
ATCCTCTTTGGGGAGGATTAAAATTCGTGATATTGATCAAAATAGAAATG
CTCAATTTTCAATTTCAAGCGTTAAATCGTTTTGTTTTAATAAGAGCGAT
GATAAAATCGCTATCGATTTTCAAGTGAATAAAATCGGTGAAATTAGATC
AACAGTCGTTTTGGATTATGAAAAGTTTCAACATCAACTGGGATTGTTTG
ATCTCGACCGATTTACCGGTGATTTAACTTCAATAAGTCAATTGAAACCG
GGAAATTATGTTCTTCAAGTTTCAGCTCAAGATCAAGGATTACCTAGTAA
AACAAATTATTCAAATTTAACAATAAATATTCACATGCCAACGAGTGACA
ATTCAAAATTCTCATCTCACATTTTGCTCATTCTCGGACTGATTCCAACT
TGCGCATTGGTTATTTTGATATGCGCCGTGATTCCCATTGTTTTTATTGT
CAAGTGGCAAAAACGACGACAACACCATAGGATTCCTCTCTCGATTGAAA
CCCAGCTTTATCACTGTCCTGATGTTAATCATTTGACGAGGTCAGAGTTT
GGAAACGAAATCAAATCTCCGAAAAACAGTTTGACTTTGAAATCTAAATA
TAAAAACGCCCTTCACAATGATGAGTTGGAAAACAGTAAAGGTTTCGCAT
CGATGCCACCCGATATTCAGGATATTTGTG
back to top

protein sequence of SMED30027704-orf-1

>SMED30027704-orf-1 ID=SMED30027704-orf-1|Name=SMED30027704-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=776bp
FFSNLLLLIDLFIVIRLSRLSLDSFFFFGCIVSATKSLDVTFSISENLPP
SNRVGILTEVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAE
IDREAICPKISGTNLPCIDVNDNQPKFQHNKRIIQIPENEEINYTLDLEK
ATDLDSLQFGIDNYKLLTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYN
LVLEVCDTGSLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLI
LKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLE
KILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEIDIFENQPLSIILAI
VRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYD
KENDNHVSSYFLNCTDNGSPHCNEYPPYFDSQFYSATTTEELKSENVIKF
ALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTDRID
LLIIIINIGLDNKNFTSSSSVLITVIDINDNPPELVGRNNFEVVENSLIE
SSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVNKIGEIRS
TVVLDYEKFQHQLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSK
TNYSNLTINIHMPTSDNSKFSSHILLILGLIPTCALVILICAVIPIVFIV
KWQKRRQHHRIPLSIETQLYHCPDVNHLTRSEFGNEIKSPKNSLTLKSKY
KNALHNDELENSKGFASMPPDIQDIC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 84..103
score: 31.54
coord: 517..534
score: 44.01
coord: 315..334
score: 38.46
coord: 481..507
score: 20.29
coord: 231..260
score: 30.75
coord: 301..313
score: 31.03
coord: 427..440
score: 31.46
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 253..334
e-value: 7.6E-12
score: 55.4
coord: 556..663
e-value: 0.79
score: 4.9
coord: 149..229
e-value: 1.7E-6
score: 37.6
coord: 450..533
e-value: 4.5E-8
score: 42.8
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 236..326
e-value: 9.6E-8
score: 32.4
coord: 540..660
e-value: 9.9E-7
score: 29.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 228..332
e-value: 5.5E-22
score: 80.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 135..227
e-value: 1.3E-9
score: 40.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 531..661
e-value: 1.8E-11
score: 46.5
coord: 333..424
e-value: 6.7E-7
score: 31.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 425..530
e-value: 6.1E-14
score: 54.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 39..134
e-value: 1.2E-7
score: 33.7
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 39..740
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 232..336
score: 16.688
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 430..535
score: 17.543
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 128..231
score: 15.921
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 541..670
score: 10.923
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 540..667
e-value: 2.56076E-9
score: 53.0862
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 434..531
e-value: 2.32311E-5
score: 41.9154
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 41..123
e-value: 6.00668E-7
score: 46.1526
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 134..226
e-value: 1.25879E-12
score: 62.3309
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 236..332
e-value: 1.0828E-22
score: 91.2209
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.648
NoneNo IPR availableTMHMMTMhelixcoord: 678..700
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 324..334
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 523..533
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 528..660
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 423..535
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 121..231
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 219..336