Lipoyl synthase, mitochondrial

Overview
NameLipoyl synthase, mitochondrial
Smed IDSMED30027700
Length (bp)1802
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipoyl synthase, mitochondrial (SMED30027700) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipoyl synthase, mitochondrial (SMED30027700) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipoyl synthase, mitochondrial (SMED30027700) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipoyl synthase, mitochondrial (SMED30027700) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027700

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30027700h1SMcG0008460 SmedASXL_004768SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30027700h1SMcG0008460 SmedASXL_007164SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30027700h1SMcG0008460 SmedASXL_004768SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30027700h1SMcG0008460 dd_Smed_v4_19176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
whole organismSMED30027700h1SMcG0008460 Contig19144newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30027700h1SMcG0008460 Contig19144uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30027700h1SMcG0008460 dd_Smed_v4_19176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Human
Match: GCNA (germ cell nuclear acidic peptidase [Source:HGNC Symbol;Acc:HGNC:15805])

HSP 1 Score: 105.916 bits (263), Expect = 2.796e-24
Identity = 50/135 (37.04%), Postives = 73/135 (54.07%), Query Frame = 3
Query: 1098 KSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNC 1502
            K +  EL Q+IY ++N+S  +  LPE + I W+  +  TAG C   +          KIQ+  KV   A+R+  TL+HEMCH A W+I+  + +HG  WK +  K++   P +    RCHNY I+ K  Y C  C
Sbjct:  515 KRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGC 649          

HSP 2 Score: 26.9498 bits (58), Expect = 2.796e-24
Identity = 13/29 (44.83%), Postives = 17/29 (58.62%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQK-GNRI 1612
            S+D +R +C  CKG   +  L QK G RI
Sbjct:  659 SLDTSRFICAKCKGSLVMVPLTQKDGTRI 687          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Human
Match: GCNA (germ cell nuclear acidic peptidase [Source:HGNC Symbol;Acc:HGNC:15805])

HSP 1 Score: 105.916 bits (263), Expect = 2.796e-24
Identity = 50/135 (37.04%), Postives = 73/135 (54.07%), Query Frame = 3
Query: 1098 KSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNC 1502
            K +  EL Q+IY ++N+S  +  LPE + I W+  +  TAG C   +          KIQ+  KV   A+R+  TL+HEMCH A W+I+  + +HG  WK +  K++   P +    RCHNY I+ K  Y C  C
Sbjct:  515 KRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGC 649          

HSP 2 Score: 26.9498 bits (58), Expect = 2.796e-24
Identity = 13/29 (44.83%), Postives = 17/29 (58.62%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQK-GNRI 1612
            S+D +R +C  CKG   +  L QK G RI
Sbjct:  659 SLDTSRFICAKCKGSLVMVPLTQKDGTRI 687          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Celegans
Match: gcna-1 (Germ Cell Nuclear Antigen [Source:UniProtKB/TrEMBL;Acc:Q23462])

HSP 1 Score: 107.457 bits (267), Expect = 1.956e-29
Identity = 54/152 (35.53%), Postives = 86/152 (56.58%), Query Frame = 3
Query: 1089 LKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNG-NHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCL--NCNKSVKRHSNPL 1535
            L+YK H + L  ++  I  +  F+ +  E +++ W+  LR +AG+C     R     +S  +++S  V T AER+  TL+HE+CH A WV+++ +   HGP WK+W A+    F ++   ERCH+Y+I  KF Y C    C+  +KR S  L
Sbjct:  289 LRYKKHRESLLTRLQDILVRRIFSAIPSEKLKVIWNARLRKSAGQC-----RNHSNGNST-VEMSPVVCTTAERVRDTLIHELCHAATWVVDRLHKEGHGPGWKRWGARCSSVFKSLPFIERCHSYEIEAKFFYVCEKDGCDVEIKRQSKSL 434          

HSP 2 Score: 41.5874 bits (96), Expect = 1.956e-29
Identity = 28/95 (29.47%), Postives = 42/95 (44.21%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGN-RIAVGDATKKM------------------------NGFSMFVKENYNKYRKSGTSHAEVMKKLSELYK 1738
            S+D +RK C  C G+F L+R  ++ N RI + D   K                          GF  + +E+Y KY   G  H++VM KL + +K
Sbjct:  433 SLDTSRKACGRCFGRFILYRYCRRTNTRIRIEDPKAKPVGPILSNSSKPSPPAPRRIVSEHPEGFKEYSEEHYWKYTAQGLKHSDVMGKLLKEFK 527          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Fly
Match: CG14814 (gene:FBgn0023515 transcript:FBtr0339494)

HSP 1 Score: 149.443 bits (376), Expect = 1.081e-44
Identity = 73/171 (42.69%), Postives = 100/171 (58.48%), Query Frame = 3
Query: 1014 KLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHS 1526
            K  F+ SL      +R D EA FYR  +  +  +LAQ +Y++YN   FNN L  ++ I WS  LR TAG+C+  +   +    S  ++LS KVLT A+RL  TL+HE+CH A WV N   G HG VWK W  +A+  FP +   + CHNY I  K+ Y CL+C+K+   HS
Sbjct:  767 KCGFLKSLEGQVSRDRADNEAFFYRENFARNKDQLAQHLYKMYNAQVFNNEL--DVPITWSKLLRNTAGRCMNKRKLNQ---RSSVVELSVKVLTTADRLRCTLIHELCHAAAWVFNG-EGGHGRVWKMWAQRANDKFPDLPQIKVCHNYSIEFKYTYKCLSCDKASHAHS 931          

HSP 2 Score: 51.2174 bits (121), Expect = 1.081e-44
Identity = 29/88 (32.95%), Postives = 52/88 (59.09%), Query Frame = 2
Query: 1553 CRICKGKFTLF--RLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLS-ELYKTANKPSNDQ--DLCSMIGSMNLD 1801
            CRIC+G  TLF  + D++GN ++      K  GF+ FVK+N+ ++++   + A+VM+ LS E  K   +P+ +    + S + ++ LD
Sbjct:  941 CRICRGPITLFLNKKDKQGNTVSTPAGEAK--GFAKFVKDNFQRHKRDNMTAAQVMRILSVEYAKQKGQPAEETAASIASRVETLTLD 1026          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Fly
Match: CG14814 (gene:FBgn0023515 transcript:FBtr0070370)

HSP 1 Score: 149.443 bits (376), Expect = 1.081e-44
Identity = 73/171 (42.69%), Postives = 100/171 (58.48%), Query Frame = 3
Query: 1014 KLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHS 1526
            K  F+ SL      +R D EA FYR  +  +  +LAQ +Y++YN   FNN L  ++ I WS  LR TAG+C+  +   +    S  ++LS KVLT A+RL  TL+HE+CH A WV N   G HG VWK W  +A+  FP +   + CHNY I  K+ Y CL+C+K+   HS
Sbjct:  767 KCGFLKSLEGQVSRDRADNEAFFYRENFARNKDQLAQHLYKMYNAQVFNNEL--DVPITWSKLLRNTAGRCMNKRKLNQ---RSSVVELSVKVLTTADRLRCTLIHELCHAAAWVFNG-EGGHGRVWKMWAQRANDKFPDLPQIKVCHNYSIEFKYTYKCLSCDKASHAHS 931          

HSP 2 Score: 51.2174 bits (121), Expect = 1.081e-44
Identity = 29/88 (32.95%), Postives = 52/88 (59.09%), Query Frame = 2
Query: 1553 CRICKGKFTLF--RLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLS-ELYKTANKPSNDQ--DLCSMIGSMNLD 1801
            CRIC+G  TLF  + D++GN ++      K  GF+ FVK+N+ ++++   + A+VM+ LS E  K   +P+ +    + S + ++ LD
Sbjct:  941 CRICRGPITLFLNKKDKQGNTVSTPAGEAK--GFAKFVKDNFQRHKRDNMTAAQVMRILSVEYAKQKGQPAEETAASIASRVETLTLD 1026          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Fly
Match: CG14814 (gene:FBgn0023515 transcript:FBtr0070369)

HSP 1 Score: 149.443 bits (376), Expect = 1.117e-44
Identity = 73/171 (42.69%), Postives = 100/171 (58.48%), Query Frame = 3
Query: 1014 KLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHS 1526
            K  F+ SL      +R D EA FYR  +  +  +LAQ +Y++YN   FNN L  ++ I WS  LR TAG+C+  +   +    S  ++LS KVLT A+RL  TL+HE+CH A WV N   G HG VWK W  +A+  FP +   + CHNY I  K+ Y CL+C+K+   HS
Sbjct:  789 KCGFLKSLEGQVSRDRADNEAFFYRENFARNKDQLAQHLYKMYNAQVFNNEL--DVPITWSKLLRNTAGRCMNKRKLNQ---RSSVVELSVKVLTTADRLRCTLIHELCHAAAWVFNG-EGGHGRVWKMWAQRANDKFPDLPQIKVCHNYSIEFKYTYKCLSCDKASHAHS 953          

HSP 2 Score: 51.2174 bits (121), Expect = 1.117e-44
Identity = 29/88 (32.95%), Postives = 52/88 (59.09%), Query Frame = 2
Query: 1553 CRICKGKFTLF--RLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLS-ELYKTANKPSNDQ--DLCSMIGSMNLD 1801
            CRIC+G  TLF  + D++GN ++      K  GF+ FVK+N+ ++++   + A+VM+ LS E  K   +P+ +    + S + ++ LD
Sbjct:  963 CRICRGPITLFLNKKDKQGNTVSTPAGEAK--GFAKFVKDNFQRHKRDNMTAAQVMRILSVEYAKQKGQPAEETAASIASRVETLTLD 1048          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Fly
Match: CG11322 (gene:FBgn0031856 transcript:FBtr0290242)

HSP 1 Score: 68.5514 bits (166), Expect = 7.112e-12
Identity = 53/177 (29.94%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  984 TVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLK-YKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFP-AVVMSERCHNYDIHTKFEYTCLNCNK 1508
            +VP   R P+   F+ SL  +       P A+ YR   +K     LA+ ++ I+N + F+  L   + I W   + T   +C C  T +       KI L + + T AE L+  L+HEMCH A +V N+  G HG   ++W  +A ++ P A  + + C +      F+YTC  C +
Sbjct:  233 SVPCLERHPKFYGFVRSLSPSISLNMCHPLALTYRQNNFKICKVALAKVLFNIFNHAIFHCGL--QVPIVWKHAMHT---RCTCQLTVDAHGKRRAKILLLRSIKTTAE-LIRCLLHEMCHVAAFVFNRELG-HGDNCRRWAYQAKMALPEAPTIEDNCID-----SFKYTCTMCTR 397          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Fly
Match: CG2694 (gene:FBgn0024991 transcript:FBtr0070481)

HSP 1 Score: 63.929 bits (154), Expect = 2.980e-10
Identity = 48/171 (28.07%), Postives = 80/171 (46.78%), Query Frame = 3
Query: 1002 RCPEKLDFISSLRDAADNERRDPEAV-FYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKS 1511
            R P    F+ SLR +       P A+ F R  ++     LA+ ++ ++N + F+  L   + I W   ++    +  C    +     + +I L   + T AE L+  L+HEMCH A ++ N+  G HG   ++WT +A ++FP V     C        F YTC  C++S
Sbjct:  585 RHPHFYGFVQSLRPSVSLNMCHPLALTFRRTNFQQSKVALAKVLFNMFNHAVFHCGL--QVPIVWKHAMKK---RWKCELGFDASGRRTAQILLLHSIDTAAE-LIYLLLHEMCHVAAFLFNRELG-HGDNCRRWTYQAKMAFPEVPALMEC-----IASFMYTCSMCSRS 743          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Zebrafish
Match: gcna (germ cell nuclear acidic peptidase [Source:ZFIN;Acc:ZDB-GENE-050320-153])

HSP 1 Score: 144.436 bits (363), Expect = 2.911e-41
Identity = 65/156 (41.67%), Postives = 96/156 (61.54%), Query Frame = 3
Query: 1068 PEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            P +V+ R  +K +  EL  K+YQ+YN S F++ LP ++ + W+  +R TAG C+  + R     ++ +I+LS KV   A+RL  TL+HEMCH A W+IN     HGP W+ +  KA L+ P + M  RCH+YDI+ KF+Y C  C  ++ RHS  L
Sbjct:  365 PGSVYCR-SFKQNKDELTSKLYQLYNTSVFDSQLPVDMSVTWNNKMRKTAGYCISGQERGTGKRYA-RIELSVKVCDSADRLRDTLIHEMCHAATWLINNVRDGHGPFWRLYARKAMLAHPELPMVSRCHSYDINYKFQYQCNRCKNTIGRHSKSL 518          

HSP 2 Score: 45.0542 bits (105), Expect = 2.911e-41
Identity = 23/68 (33.82%), Postives = 34/68 (50.00%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLS 1726
            S+D  + VC +C G+  L                +    F+ FVKENY   ++  +G SHAE+M+KLS
Sbjct:  517 SLDTTKFVCALCTGQLVLL----------TPSKPRAPTPFATFVKENYGSTKQELTGQSHAEIMRKLS 574          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Xenopus
Match: ENSXETT00000038004.1 (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:100379792])

HSP 1 Score: 135.191 bits (339), Expect = 1.353e-40
Identity = 59/152 (38.82%), Postives = 89/152 (58.55%), Query Frame = 3
Query: 1080 FYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
             Y   +K   +EL  ++Y +YN++ F+  LPEN+EI W+  +R TAG C+  + R   +    +I+LS+KV   A+RL  TL+HE+CH A W+IN     HG  W+ +  KA +  P + M  RCH Y+I+ K+ Y C  C  ++ RHS  L
Sbjct:  376 LYVKNFKQKKEELTSRLYSLYNRTVFDQKLPENMEITWNKKMRKTAGYCVTGQKRLPMLQRYARIELSEKVCDSADRLRDTLIHEICHAATWLINGVRDGHGQFWRFYAKKATVVHPELPMVTRCHTYEINYKYTYECSRCKNTIGRHSKSL 527          

HSP 2 Score: 52.7582 bits (125), Expect = 1.353e-40
Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELYKTANK 1750
            S+D  + VC +CKGK  L    +K    A G    ++  F+ +VKENY   +K  +G SHAEVM+KLS  + +  K
Sbjct:  526 SLDTEKFVCALCKGKLVLLSSTRKDGSPAGG----QLTPFAKYVKENYGSTKKVMTGMSHAEVMRKLSADFSSKTK 597          
BLAST of Lipoyl synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q96QF7|ACRC_HUMAN (Acidic repeat-containing protein OS=Homo sapiens OX=9606 GN=GCNA PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.226e-23
Identity = 50/135 (37.04%), Postives = 73/135 (54.07%), Query Frame = 3
Query: 1098 KSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNC 1502
            K +  EL Q+IY ++N+S  +  LPE + I W+  +  TAG C   +          KIQ+  KV   A+R+  TL+HEMCH A W+I+  + +HG  WK +  K++   P +    RCHNY I+ K  Y C  C
Sbjct:  515 KRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGC 649          

HSP 2 Score: 26.9498 bits (58), Expect = 1.226e-23
Identity = 13/29 (44.83%), Postives = 17/29 (58.62%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQK-GNRI 1612
            S+D +R +C  CKG   +  L QK G RI
Sbjct:  659 SLDTSRFICAKCKGSLVMVPLTQKDGTRI 687          
BLAST of Lipoyl synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|O42953|YGM4_SCHPO (HMG box-containing protein C19G7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.04 PE=4 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 6.857e-21
Identity = 50/146 (34.25%), Postives = 79/146 (54.11%), Query Frame = 3
Query: 1116 LAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKC-LCTKTREEPVIHSIK--IQLSKKVLTDAERLLGTLVHEMCHGAVWVI-NKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLN--CNKSVKRHSNPL 1535
            LA+   +++     ++L  + I I WS +  TTAG+  L    ++ P+       I+LS KV+   ERL  TL HE+CH A W+I N+    HG  +K W  +   + P + ++ + HNYDI  K+++ C+N  CNK   RHS  +
Sbjct:  138 LARLEDEVFQGRLTSSLEKKEIGIVWSKSFSTTAGRANLKRNNKDAPLGKKTYAYIELSDKVIVTKERLYNTLAHEVCHLACWIIDNEMQNPHGACFKAWGKRIMNNMPYIEITSK-HNYDIDFKYKWLCINEKCNKLYGRHSKSI 282          

HSP 2 Score: 41.9726 bits (97), Expect = 6.857e-21
Identity = 24/71 (33.80%), Postives = 37/71 (52.11%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELY 1735
            SI+  ++VCR+CK +              +    K+ N F +F+KEN  + RK     +H E+MKKLS+ Y
Sbjct:  281 SINPQKQVCRLCKSQIK-----------QICPKIKQPNAFQIFLKENSKRLRKLHPHITHKELMKKLSDEY 340          
BLAST of Lipoyl synthase, mitochondrial vs. TrEMBL
Match: A0A1S3D3C3 (acidic repeat-containing protein OS=Diaphorina citri OX=121845 GN=LOC103510578 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.280e-44
Identity = 73/178 (41.01%), Postives = 106/178 (59.55%), Query Frame = 3
Query: 1014 KLDFISSLRDAA-DNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTR---EEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            +L F+SSL     D+    PEA  Y+ KYKS  +ELA++++ +YN+  F++ LP ++ +EW+  +RTT+G C   + R    +P   S +I LSKK+L   +RL  TL+HEMCH A W+I+     HGP W+KWT  A   FP +   +RCH+Y I  K+ Y C  C+    RHS  L
Sbjct:  188 RLTFLSSLSAVIPDSYIPHPEAAVYKAKYKSKKEELARRLFHLYNREVFDDKLPPDMPLEWNARMRTTSGFCYNKRERIGPFQPDRRSSRIALSKKILDKPDRLRDTLIHEMCHAASWLIDGVRDGHGPNWQKWTIYAMQRFPELPRIKRCHDYKIDFKYIYRCSQCDYEFGRHSKSL 365          

HSP 2 Score: 58.151 bits (139), Expect = 5.280e-44
Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKK-MNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELY 1735
            S++  RKVC  C GKF L     KG  +A  DA K+    F+MFVK+NY K ++  +GT H +VMK LS+ +
Sbjct:  364 SLNTERKVCGYCHGKFNLITNTSKGETVAADDAPKRPPTQFAMFVKDNYAKVKQENAGTKHGDVMKILSKKF 435          
BLAST of Lipoyl synthase, mitochondrial vs. TrEMBL
Match: K7J0J2 (SprT-like domain-containing protein OS=Nasonia vitripennis OX=7425 GN=103315839 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 9.816e-44
Identity = 76/184 (41.30%), Postives = 111/184 (60.33%), Query Frame = 3
Query:  990 PANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREE--PVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            P   + P K  F++SL      ++ D +A+ YR+KY +  +EL   +Y+++N+  F++ LP+NI IEWST LR TAGKC   ++ +     + S ++ L+ K+L   +RL  TL+HEMCH A W+IN  +  HG  WK W  KA   FP +    RCHNY+I TK+ Y CL+C  S+ RHS  L
Sbjct:  739 PQAQKQPTKKSFLASLSKDVPLDQADFKAMTYRVKYNTLREELCNVLYKLFNEKVFDSQLPDNIPIEWSTRLRGTAGKCYNKQSLKALGKTVRSSRLVLATKILDSPDRLRDTLIHEMCHAATWLINNVSDGHGSFWKAWANKAVKVFPELPPVSRCHNYEIQTKYTYKCLSCGYSIGRHSKSL 922          

HSP 2 Score: 45.8246 bits (107), Expect = 9.816e-44
Identity = 28/74 (37.84%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLF--RLDQKGNRIAVGDA-TKKMNGFSMFVKENYN--KYRKSGTSHAEVMKKLSELY 1735
            S+D++RK C  C G+F L   ++ + G       A TK+ +GF+++VKENY+  K   +G  H EVMK L + +
Sbjct:  921 SLDLSRKRCGYCHGQFELLINKVTKDGMVQKKSTAQTKEPSGFALYVKENYHLVKQNGAGIKHGEVMKILGQQF 994          
BLAST of Lipoyl synthase, mitochondrial vs. TrEMBL
Match: A0A232F4E3 (SprT-like domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_016298 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.130e-43
Identity = 75/184 (40.76%), Postives = 111/184 (60.33%), Query Frame = 3
Query:  990 PANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREE--PVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            P   + P K  F++SL      ++ D +A+ YR+KY +  +EL   +Y+++N+  F++ LP+N+ IEWST LR TAGKC   ++ +     + S ++ L+ K+L   +RL  TL+HEMCH A W+IN  +  HG  WK W  KA   FP +    RCHNY+I TK+ Y CL+C  S+ RHS  L
Sbjct:  741 PQAQKQPTKKSFLASLSKDVPLDQADFKAMTYRVKYNALREELCNVLYKLFNEKVFDSQLPDNMPIEWSTRLRGTAGKCYNKQSLKALGKTVRSSRLVLATKILDSPDRLRDTLIHEMCHAATWLINNVSDGHGSFWKAWANKAVKVFPELPPVSRCHNYEIQTKYTYKCLSCGYSIGRHSKSL 924          

HSP 2 Score: 46.595 bits (109), Expect = 1.130e-43
Identity = 28/74 (37.84%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLF--RLDQKGNRIAVGDA-TKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELY 1735
            S+D+ RK C  C G+F L   ++ + G       A TK+ +GF+++VKENY+  +K  +G  H EVMK L + +
Sbjct:  923 SLDLTRKRCGYCHGQFELLINKVTKDGMVQKKSTAQTKEPSGFALYVKENYHLVKKNGAGIKHGEVMKILGQQF 996          
BLAST of Lipoyl synthase, mitochondrial vs. TrEMBL
Match: A0A154NZ86 (Neuropeptides capa receptor OS=Dufourea novaeangliae OX=178035 GN=WN55_02736 PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.224e-43
Identity = 81/200 (40.50%), Postives = 116/200 (58.00%), Query Frame = 3
Query:  960 KIPKQIPQTVPA-----NTRCPEKLD-FISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREE--PVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            KI +QIP+T  A     + R  EK + F++SL +        P+A  YR  YK++ ++L++ +Y++YN   F+  LP+++ IEW+  +R TAG C   K+      V+ S +I LS KVL   +RL  TL+HEMCH A W+IN  +  HGP W  W  KA  +FP +    RCH+Y I TKF Y C+ C  S+ RHS  L
Sbjct: 1021 KISRQIPKTYTAIKPTSDIRKYEKNESFLASLSENVPLANAHPDAKKYRTNYKNNKEDLSKYLYKLYNDKVFDTQLPKDLSIEWNVRMRGTAGYCYNKKSVRTLGGVMRSSRIVLSTKVLDTPDRLRDTLIHEMCHAAAWLINSVSDGHGPFWTGWANKAMKTFPELPPIRRCHDYKIKTKFTYKCVGCGYSIGRHSKSL 1220          

HSP 2 Score: 52.7582 bits (125), Expect = 1.224e-43
Identity = 29/71 (40.85%), Postives = 41/71 (57.75%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLF-RLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKS-GTSHAEVMKKLSELY 1735
            S+DI +K C  C GKF L      K   + V    +++NGF+++VKENYN  +K     HAEVMK L + +
Sbjct: 1219 SLDIEKKRCGHCYGKFELLLNKTTKSGTVQVQTPKREINGFALYVKENYNTIKKKRNIRHAEVMKILGQQF 1289          
BLAST of Lipoyl synthase, mitochondrial vs. TrEMBL
Match: A0A0L7RER7 (Acidic repeat-containing protein OS=Habropoda laboriosa OX=597456 GN=WH47_11563 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.441e-43
Identity = 78/199 (39.20%), Postives = 116/199 (58.29%), Query Frame = 3
Query:  948 TPRQKIPKQIPQTVPANTRCPEKLD-FISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREE--PVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            TPRQ      P    +N R  EK + F++SL ++   +   P+A  YRL +K++  +L   +Y++YN+  F+N LP+++ IEW+  +R TAG C   K+ +    ++ S +I L+ K+L   +RL  TL+HEMCH A W+IN  +  HGP W  W  KA  +FP +    RCH+Y I TKF Y C+ C  S+ RHS  L
Sbjct:  646 TPRQTFKLNAPSK--SNNRKHEKFNSFLASLSESVPIDSAHPDAKKYRLNFKNNKDDLCSSLYKLYNEKVFDNELPKDLLIEWNIRMRGTAGYCYNKKSVKTLGGIVKSSRIVLATKILDTPDRLRDTLIHEMCHAAAWLINNVSDGHGPFWTGWANKAMKTFPELPPIRRCHDYKIKTKFTYKCVGCGYSIGRHSKSL 842          

HSP 2 Score: 48.9062 bits (115), Expect = 2.441e-43
Identity = 27/73 (36.99%), Postives = 38/73 (52.05%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLF-RLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKS-GTSHAEVMKKLSELYKT 1741
            S+DI RK C  C GKF L      K   I V    ++   F++++KENYN  +K     H E+MK L + + T
Sbjct:  841 SLDIERKRCGHCYGKFELLVNKTTKSGTIQVQTPKREPTAFALYIKENYNSVKKERNAKHGEIMKILGQQFST 913          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Cavefish
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:103028451])

HSP 1 Score: 145.591 bits (366), Expect = 5.975e-43
Identity = 67/156 (42.95%), Postives = 97/156 (62.18%), Query Frame = 3
Query: 1068 PEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            P + F R  +K   ++L +K+YQ+YN S F++ LP ++ + W+T LR TAG C+  + R     ++ +I+LS KV   A+RL  TLVHEMCH A W+IN     HGP WK +  KA L+ P + M  RCH+YDI+ K++Y C  C  ++ RHS  L
Sbjct:  368 PGSSFCR-DFKQKKEDLTKKLYQLYNSSVFDSKLPTDMSVTWNTKLRKTAGYCITGQERVTSKRYA-RIELSVKVCDSADRLRDTLVHEMCHAATWLINNVRDGHGPFWKIYARKATLAHPELPMVTRCHSYDINYKYQYQCSRCKNTIGRHSKSL 521          

HSP 2 Score: 49.2914 bits (116), Expect = 5.975e-43
Identity = 27/68 (39.71%), Postives = 35/68 (51.47%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLS 1726
            S+D  R VC +C GK  L               ++    F+ FVKENY   R+  +G SHAEVM+KLS
Sbjct:  520 SLDTERFVCALCTGKLVLL----------TPANSRGPTPFATFVKENYGPVRQELAGQSHAEVMRKLS 577          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Cavefish
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:103028451])

HSP 1 Score: 145.206 bits (365), Expect = 6.931e-43
Identity = 67/156 (42.95%), Postives = 97/156 (62.18%), Query Frame = 3
Query: 1068 PEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            P + F R  +K   ++L +K+YQ+YN S F++ LP ++ + W+T LR TAG C+  + R     ++ +I+LS KV   A+RL  TLVHEMCH A W+IN     HGP WK +  KA L+ P + M  RCH+YDI+ K++Y C  C  ++ RHS  L
Sbjct:  386 PGSSFCR-DFKQKKEDLTKKLYQLYNSSVFDSKLPTDMSVTWNTKLRKTAGYCITGQERVTSKRYA-RIELSVKVCDSADRLRDTLVHEMCHAATWLINNVRDGHGPFWKIYARKATLAHPELPMVTRCHSYDINYKYQYQCSRCKNTIGRHSKSL 539          

HSP 2 Score: 49.2914 bits (116), Expect = 6.931e-43
Identity = 27/68 (39.71%), Postives = 35/68 (51.47%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLS 1726
            S+D  R VC +C GK  L               ++    F+ FVKENY   R+  +G SHAEVM+KLS
Sbjct:  538 SLDTERFVCALCTGKLVLL----------TPANSRGPTPFATFVKENYGPVRQELAGQSHAEVMRKLS 595          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003196.1 (pep scaffold:Pmarinus_7.0:GL481285:6911:9692:1 gene:ENSPMAG00000002918.1 transcript:ENSPMAT00000003196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.661e-35
Identity = 59/151 (39.07%), Postives = 81/151 (53.64%), Query Frame = 3
Query: 1083 YRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            Y   +K    +L   +Y+ YN++ F N LP N+E+ W+  +R TAG C+  K          +I+LS KV  + ERL  TLVHEMCH A W+IN     HG +W+ +   A L  P +    RCH Y+I  K+ Y C  C  S+ RHS  L
Sbjct:   22 YARNFKKCKAQLTASLYKFYNETIFKNKLPNNMELLWNNKMRKTAGYCVMGKGPGPACQPYARIELSVKVCDNPERLRDTLVHEMCHAATWLINGQRDGHGRLWQLYARTATLVHPELPTVSRCHTYNITFKYRYECTRCKNSIGRHSKSL 172          

HSP 2 Score: 46.2098 bits (108), Expect = 1.661e-35
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYR--KSGTSHAEVMKKLSELY 1735
            S+D  R VC +C+G+F L  L  +G R      ++ +  F+ FVKE Y   R  +  +SHA++M+ L E +
Sbjct:  171 SLDTERFVCALCQGRFVL--LPPEG-RDGTPVTSRALTPFTRFVKEQYGTTRSARPDSSHADIMRILGEQF 238          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003198.1 (pep scaffold:Pmarinus_7.0:GL481285:6974:9692:1 gene:ENSPMAG00000002918.1 transcript:ENSPMAT00000003198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.090e-27
Identity = 54/155 (34.84%), Postives = 77/155 (49.68%), Query Frame = 3
Query: 1083 YRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCT-KTREEP---VIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            Y   +K    +L   +Y+ YN++ F N      ++ WS  L +    C CT KT++E      +S+ + L    +   ERL  TLVHEMCH A W+IN     HG +W+ +   A L  P +    RCH Y+I  K+ Y C  C  S+ RHS  L
Sbjct:    1 YARNFKKCKAQLTASLYKFYNETIFKN------KVWWSMLLESNRYGCACTSKTKDEKRTNCYNSVDVCL----MHGTERLRDTLVHEMCHAATWLINGQRDGHGRLWQLYARTATLVHPELPTVSRCHTYNITFKYRYECTRCKNSIGRHSKSL 145          

HSP 2 Score: 45.4394 bits (106), Expect = 1.090e-27
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYR--KSGTSHAEVMKKLSELY 1735
            S+D  R VC +C+G+F L  L  +G R      ++ +  F+ FVKE Y   R  +  +SHA++M+ L E +
Sbjct:  144 SLDTERFVCALCQGRFVL--LPPEG-RDGTPVTSRALTPFTRFVKEQYGTTRSARPDSSHADIMRILGEQF 211          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Nematostella
Match: EDO49719 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFH1])

HSP 1 Score: 123.635 bits (309), Expect = 9.089e-33
Identity = 57/149 (38.26%), Postives = 89/149 (59.73%), Query Frame = 3
Query: 1095 YKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLN--CNKSVKRHSNPL 1535
            +K   ++LA++++++YN + F   LP +  I W+  +R+TAG C   +      I++ +I+L+ KV+  A+RL  TL+HEMCH A W+I+     HGPVWKKW  KA+     +    RCH Y I+ KF Y C N  C+ ++ RHS  +
Sbjct:   18 FKKGKEQLAKELFELYNNTVFEKKLPADFSITWNNKMRSTAGFCYYGRL---AGINTARIELADKVIDSADRLRDTLIHEMCHAAAWLISGVKAGHGPVWKKWQVKANYILQDLPPISRCHTYKINAKFVYACTNEFCSNTISRHSKSI 163          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Medaka
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:101164819])

HSP 1 Score: 136.732 bits (343), Expect = 2.875e-39
Identity = 62/157 (39.49%), Postives = 93/157 (59.24%), Query Frame = 3
Query: 1065 DPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            DP +  Y   +K + ++L  K+YQ+YN S F+N LP ++ + W+  +R TAG C+  + +     ++ +I+LS+KV   A+RL  TL+HE+CH A W+IN     HG  WK +  KA +  P + M  RCH+YDI  KF Y C  C  ++ RHS  L
Sbjct:  323 DPGSC-YSSSFKKNKEQLTSKLYQLYNSSVFDNKLPVDMSVTWNKKMRKTAGYCVTGQEKGGGSRYA-RIELSEKVCDSADRLRDTLIHELCHAATWLINGVRDGHGAFWKLYARKATVLHPELPMVTRCHSYDITYKFRYQCTRCQNTIGRHSKSL 477          

HSP 2 Score: 46.2098 bits (108), Expect = 2.875e-39
Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELYKTANK 1750
            S+D  + VC +C G+  L                +    F+ FVKENY   R+  +G SHAEVM+KLS  + +  K
Sbjct:  476 SLDTQKFVCALCTGRLVLM----------TPSKPRAPTPFANFVKENYGSVRQELAGQSHAEVMRKLSTDFASKTK 541          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Medaka
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:101164819])

HSP 1 Score: 136.732 bits (343), Expect = 2.875e-39
Identity = 62/157 (39.49%), Postives = 93/157 (59.24%), Query Frame = 3
Query: 1065 DPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            DP +  Y   +K + ++L  K+YQ+YN S F+N LP ++ + W+  +R TAG C+  + +     ++ +I+LS+KV   A+RL  TL+HE+CH A W+IN     HG  WK +  KA +  P + M  RCH+YDI  KF Y C  C  ++ RHS  L
Sbjct:  323 DPGSC-YSSSFKKNKEQLTSKLYQLYNSSVFDNKLPVDMSVTWNKKMRKTAGYCVTGQEKGGGSRYA-RIELSEKVCDSADRLRDTLIHELCHAATWLINGVRDGHGAFWKLYARKATVLHPELPMVTRCHSYDITYKFRYQCTRCQNTIGRHSKSL 477          

HSP 2 Score: 46.2098 bits (108), Expect = 2.875e-39
Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELYKTANK 1750
            S+D  + VC +C G+  L                +    F+ FVKENY   R+  +G SHAEVM+KLS  + +  K
Sbjct:  476 SLDTQKFVCALCTGRLVLM----------TPSKPRAPTPFANFVKENYGSVRQELAGQSHAEVMRKLSTDFASKTK 541          
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Medaka
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:101164819])

HSP 1 Score: 135.961 bits (341), Expect = 5.047e-39
Identity = 62/157 (39.49%), Postives = 93/157 (59.24%), Query Frame = 3
Query: 1065 DPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPL 1535
            DP +  Y   +K + ++L  K+YQ+YN S F+N LP ++ + W+  +R TAG C+  + +     ++ +I+LS+KV   A+RL  TL+HE+CH A W+IN     HG  WK +  KA +  P + M  RCH+YDI  KF Y C  C  ++ RHS  L
Sbjct:  283 DPGSC-YSSSFKKNKEQLTSKLYQLYNSSVFDNKLPVDMSVTWNKKMRKTAGYCVTGQEKGGGSRYA-RIELSEKVCDSADRLRDTLIHELCHAATWLINGVRDGHGAFWKLYARKATVLHPELPMVTRCHSYDITYKFRYQCTRCQNTIGRHSKSL 437          

HSP 2 Score: 45.8246 bits (107), Expect = 5.047e-39
Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRK--SGTSHAEVMKKLSELYKTANK 1750
            S+D  + VC +C G+  L                +    F+ FVKENY   R+  +G SHAEVM+KLS  + +  K
Sbjct:  436 SLDTQKFVCALCTGRLVLM----------TPSKPRAPTPFANFVKENYGSVRQELAGQSHAEVMRKLSTDFASKTK 501          
BLAST of Lipoyl synthase, mitochondrial vs. Planmine SMEST
Match: SMESG000004184.1 (SMESG000004184.1)

HSP 1 Score: 809.675 bits (2090), Expect = 0.000e+0
Identity = 477/492 (96.95%), Postives = 477/492 (96.95%), Query Frame = 3
Query:   81 MSSEXXXXXXXXXXXXXXEKLKHKFVELSELEKIDKEMNDFIVDSDKEILFPNSDLSDRNLSPHLQTNIRQIKKHHKQRETRKPDIKVPLKSKHNPNENLSSFTGSSDKNKKSNINDLDSSDNLFSEDSDGSESLPYEINTNITESPEVLLANEIHKKLDLEDILPMFKTPKFPAQKLDKSCTTDILKPATFPIENKENLQMTPRKKIDLSRLIKTRDNKEKIFPRKFSRLIVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITVTPRQKIPKQIPQTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPLI*IGRSV 1556
            MSSEDDVDVFNDFVKKNKEKLKHKFVEL ELEKIDKEMNDFIVDSDKEILF NSDLSDRNLSPHLQTNIRQIKKH KQRETRKPDIKVPLKSKHNPNENLSSFTGSSDKNKKSNINDLDSSDNLFSEDSD SESLP EINTNITE PEVLLANEIHKKLDLEDILPMFKTPKFP QKLDKSCTTDILKPATFPIENKENLQMTPRKKIDLSRLIKT DNKEKIFPRKFSRLIVESSSESFESSDKDDSFIDDSIYSGDSRSDASD ESVFSSSGSSSSDSDRISKSITVTPRQKIPKQIPQTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHS   I I R V
Sbjct:    1 MSSEDDVDVFNDFVKKNKEKLKHKFVELPELEKIDKEMNDFIVDSDKEILFSNSDLSDRNLSPHLQTNIRQIKKH-KQRETRKPDIKVPLKSKHNPNENLSSFTGSSDKNKKSNINDLDSSDNLFSEDSDDSESLPDEINTNITECPEVLLANEIHKKLDLEDILPMFKTPKFPVQKLDKSCTTDILKPATFPIENKENLQMTPRKKIDLSRLIKTCDNKEKIFPRKFSRLIVESSSESFESSDKDDSFIDDSIYSGDSRSDASDGESVFSSSGSSSSDSDRISKSITVTPRQKIPKQIPQTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSKS-IDINRKV 490          

HSP 2 Score: 192.586 bits (488), Expect = 1.682e-53
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 2
Query: 1529 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLSELYKTANKPSNDQDLCSMIGSMNLD 1801
            SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLSELYKTANKPSNDQDLCSMIGSMNLD
Sbjct:  483 SIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLSELYKTANKPSNDQDLCSMIGSMNLD 573          
BLAST of Lipoyl synthase, mitochondrial vs. Planmine SMEST
Match: SMESG000004174.1 (SMESG000004174.1)

HSP 1 Score: 507.294 bits (1305), Expect = 2.822e-176
Identity = 320/331 (96.68%), Postives = 321/331 (96.98%), Query Frame = 3
Query:  135 EKLKHKFVELSELEKIDKEMNDFIVDSDKEILFPNSDLSDRNLSPHLQTNIRQIKKHHKQRETRKPDIKVPLKSKHNPNENLSSFTGSSDKNKKSNINDLDSSDNLFSEDSDGSESLPYEINTNITESPEVLLANEIHKKLDLEDILPMFKTPKFPAQKLDKSCTTDILKPATFPIENKENLQMTPRKKIDLSRLIKTRDNKEKIFPRKFSRLIVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITVTPRQKIPKQIPQTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQK 1127
            +KLKHKFVEL ELEKIDKEMNDFIVDSDKEILF NSDLSDRNLSPHLQTNIRQIKKH KQRETRKPDIKVPLKSKHNPNENLSSFTGSSDK KKSNINDLDSSDNLFSEDSD SESLP EINTNITE PEVLLANEIHKKLDLEDILPMFKTPKFP QKLDKSCTTDILKPATFPIENKENLQMTPRKKIDLSRLIKT DNKEKIFPRKFSRLIVESSSESFESSDKDDSFIDDSIYSGDSRSDASD ESVFSSSGSSSSDSDRISKSITVTPRQKIPKQIPQTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQK
Sbjct:  119 QKLKHKFVELPELEKIDKEMNDFIVDSDKEILFSNSDLSDRNLSPHLQTNIRQIKKH-KQRETRKPDIKVPLKSKHNPNENLSSFTGSSDKIKKSNINDLDSSDNLFSEDSDDSESLPDEINTNITECPEVLLANEIHKKLDLEDILPMFKTPKFPVQKLDKSCTTDILKPATFPIENKENLQMTPRKKIDLSRLIKTCDNKEKIFPRKFSRLIVESSSESFESSDKDDSFIDDSIYSGDSRSDASDGESVFSSSGSSSSDSDRISKSITVTPRQKIPKQIPQTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQK 448          
BLAST of Lipoyl synthase, mitochondrial vs. Planmine SMEST
Match: SMESG000016996.1 (SMESG000016996.1)

HSP 1 Score: 143.28 bits (360), Expect = 5.100e-41
Identity = 71/171 (41.52%), Postives = 104/171 (60.82%), Query Frame = 3
Query: 1014 KLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKIYQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHS 1526
            KL+FI SL +  DN+ RD EA  +R+ +K    ELA KI++I+N+S F N LP + ++ ++  L TT G+C      EE   H + I LS K+  D+ RLL  ++HEMCH A ++I+K N  HG +W+ W   A ++FP V +SERCH+Y    K++Y C  C     +HS
Sbjct:  211 KLNFIHSLLNDIDNKYRDEEAHRFRINFKYWKLELAMKIFKIFNESVFYNKLPHDTKVIFNPRLLTTGGRCHNRHKTEETPRH-VFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLSERCHSYRAKFKYQYRCETCPFVKAKHS 380          

HSP 2 Score: 44.669 bits (104), Expect = 5.100e-41
Identity = 25/63 (39.68%), Postives = 31/63 (49.21%), Query Frame = 2
Query: 1547 KVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLSELY 1735
            K+C  CK K  LF     G    V D  K + GF+ FVKENY   R    +H + M  LSE +
Sbjct:  386 KICPKCKSKLILFSDRGYGVHFEV-DTNKPLVGFAAFVKENYKSARSKDVNHKQAMSILSERF 447          
The following BLAST results are available for this feature:
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GCNA2.796e-2437.04germ cell nuclear acidic peptidase [Source:HGNC Sy... [more]
GCNA2.796e-2437.04germ cell nuclear acidic peptidase [Source:HGNC Sy... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcna-11.956e-2935.53Germ Cell Nuclear Antigen [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG148141.081e-4442.69gene:FBgn0023515 transcript:FBtr0339494[more]
CG148141.081e-4442.69gene:FBgn0023515 transcript:FBtr0070370[more]
CG148141.117e-4442.69gene:FBgn0023515 transcript:FBtr0070369[more]
CG113227.112e-1229.94gene:FBgn0031856 transcript:FBtr0290242[more]
CG26942.980e-1028.07gene:FBgn0024991 transcript:FBtr0070481[more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcna2.911e-4141.67germ cell nuclear acidic peptidase [Source:ZFIN;Ac... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000038004.11.353e-4038.82germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipoyl synthase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q96QF7|ACRC_HUMAN1.226e-2337.04Acidic repeat-containing protein OS=Homo sapiens O... [more]
sp|O42953|YGM4_SCHPO6.857e-2134.25HMG box-containing protein C19G7.04 OS=Schizosacch... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3D3C35.280e-4441.01acidic repeat-containing protein OS=Diaphorina cit... [more]
K7J0J29.816e-4441.30SprT-like domain-containing protein OS=Nasonia vit... [more]
A0A232F4E31.130e-4340.76SprT-like domain-containing protein OS=Trichomalop... [more]
A0A154NZ861.224e-4340.50Neuropeptides capa receptor OS=Dufourea novaeangli... [more]
A0A0L7RER72.441e-4339.20Acidic repeat-containing protein OS=Habropoda labo... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gcna5.975e-4342.95germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
gcna6.931e-4342.95germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003196.11.661e-3539.07pep scaffold:Pmarinus_7.0:GL481285:6911:9692:1 gen... [more]
ENSPMAT00000003198.11.090e-2734.84pep scaffold:Pmarinus_7.0:GL481285:6974:9692:1 gen... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO497199.089e-3338.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gcna2.875e-3939.49germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
gcna2.875e-3939.49germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
gcna5.047e-3939.49germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
back to top
BLAST of Lipoyl synthase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000004184.11.682e-5396.95SMESG000004184.1[more]
SMESG000004174.12.822e-17696.68SMESG000004174.1[more]
SMESG000016996.15.100e-4141.52SMESG000016996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027700 ID=SMED30027700|Name=Lipoyl synthase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1802bp
TAAATAATTAGTAATTTAATTTAAAAGTTACAATTTTAATATTAAATTTT
AATCTTAAATATTTATTTGATAGTTTTAAAATGAGTTCTGAAGATGATGT
AGATGTTTTTAATGATTTTGTGAAAAAAAATAAAGAAAAATTGAAACACA
AATTTGTTGAGTTGTCAGAACTAGAAAAGATAGATAAAGAAATGAATGAT
TTCATTGTTGATAGTGATAAAGAAATATTATTTCCAAACTCTGATTTAAG
TGACAGAAATTTATCTCCACATTTACAAACCAATATCAGACAAATAAAGA
AACATCATAAACAACGGGAGACGAGAAAACCTGATATAAAGGTCCCGCTA
AAATCTAAACACAACCCAAATGAGAATTTATCTTCATTTACTGGTTCATC
TGATAAAAATAAAAAGTCCAACATAAACGATTTAGACTCATCAGATAATT
TATTTTCAGAAGATAGTGATGGTTCAGAGTCTTTACCATATGAAATAAAT
ACAAATATTACTGAATCTCCTGAAGTTCTATTAGCAAATGAAATCCATAA
AAAACTTGATTTGGAAGATATTTTACCAATGTTCAAAACTCCGAAATTTC
CAGCTCAGAAACTCGATAAATCATGCACAACGGATATATTAAAACCAGCT
ACATTTCCTATTGAAAATAAAGAAAATTTGCAAATGACACCTCGTAAGAA
AATCGATCTTTCTAGGCTTATTAAGACACGTGATAACAAGGAAAAAATCT
TTCCCAGAAAATTTTCACGTCTAATAGTAGAAAGCAGCTCGGAAAGTTTC
GAATCTAGCGATAAAGATGACAGTTTTATTGATGATTCGATTTATTCTGG
TGATTCTAGATCGGATGCGTCTGACAGCGAATCGGTTTTCAGTAGCAGCG
GCAGTAGCTCCAGTGATAGTGACAGAATCAGCAAATCGATTACCGTGACT
CCCAGACAGAAAATCCCCAAACAAATCCCACAAACAGTCCCCGCAAACAC
TCGATGCCCAGAGAAACTCGATTTCATCTCATCTCTCCGCGACGCTGCTG
ACAACGAGCGACGAGACCCCGAAGCAGTTTTCTATCGACTGAAATACAAA
TCTCACTACAAAGAATTGGCGCAAAAAATCTATCAAATCTATAATAAATC
CGCTTTTAACAACTTGCTCCCGGAAAATATCGAAATCGAATGGAGCACAA
CTTTGCGCACGACAGCTGGGAAGTGTTTGTGCACAAAAACAAGAGAGGAA
CCAGTAATACATTCAATAAAAATTCAATTATCGAAAAAAGTCCTCACTGA
TGCTGAGAGATTATTGGGCACACTGGTTCATGAAATGTGCCATGGGGCAG
TGTGGGTTATCAACAAAACTAACGGAAATCATGGTCCCGTATGGAAAAAA
TGGACAGCAAAAGCTCATCTTTCATTCCCGGCTGTGGTAATGTCAGAACG
TTGTCACAATTATGATATCCACACCAAATTCGAGTACACATGCTTGAATT
GCAATAAGTCAGTCAAAAGGCATTCTAATCCATTGATATAAATAGGAAGG
TCTGTAGAATATGCAAAGGTAAATTTACGCTTTTTAGGTTAGACCAGAAA
GGCAATAGAATTGCTGTGGGAGATGCAACTAAGAAAATGAATGGATTCTC
AATGTTTGTCAAGGAAAACTATAACAAATATCGGAAATCTGGAACTAGTC
ACGCGGAAGTGATGAAAAAATTATCGGAATTATACAAAACGGCTAATAAA
CCTTCAAATGATCAGGATTTATGCTCAATGATAGGATCAATGAATCTCGA
TG
back to top

protein sequence of SMED30027700-orf-1

>SMED30027700-orf-1 ID=SMED30027700-orf-1|Name=SMED30027700-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MSSEDDVDVFNDFVKKNKEKLKHKFVELSELEKIDKEMNDFIVDSDKEIL
FPNSDLSDRNLSPHLQTNIRQIKKHHKQRETRKPDIKVPLKSKHNPNENL
SSFTGSSDKNKKSNINDLDSSDNLFSEDSDGSESLPYEINTNITESPEVL
LANEIHKKLDLEDILPMFKTPKFPAQKLDKSCTTDILKPATFPIENKENL
QMTPRKKIDLSRLIKTRDNKEKIFPRKFSRLIVESSSESFESSDKDDSFI
DDSIYSGDSRSDASDSESVFSSSGSSSSDSDRISKSITVTPRQKIPKQIP
QTVPANTRCPEKLDFISSLRDAADNERRDPEAVFYRLKYKSHYKELAQKI
YQIYNKSAFNNLLPENIEIEWSTTLRTTAGKCLCTKTREEPVIHSIKIQL
SKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFP
AVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSNPLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
GO:0016783sulfurtransferase activity
GO:0016992lipoate synthase activity
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0009107lipoate biosynthetic process
GO:0009249protein lipoylation
GO:0080111DNA demethylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000136whole organism
PLANA:0000419prepharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR009071HMG_box_dom
IPR006640SprT-like_domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006640SprT-likeSMARTSM00731sprt_6coord: 343..486
e-value: 6.0E-27
score: 105.5
IPR006640SprT-likePFAMPF10263SprT-likecoord: 346..449
e-value: 3.7E-23
score: 81.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..299
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 54..68
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 53..134
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 93..121
NoneNo IPR availablePANTHERPTHR23099TRANSCRIPTIONAL REGULATORcoord: 75..485