SMED30027694

Overview
NameSMED30027694
Smed IDSMED30027694
Length (bp)1565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027694 (SMED30027694) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027694 (SMED30027694) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027694 (SMED30027694) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027694 (SMED30027694) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027694

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30027694SMESG000042511.1 dd_Smed_v4_13560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027694SMESG000042511.1 dd_Smed_v6_13560_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30027694SMESG000042511.1 dd_Smed_v4_13560_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027694 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017518:2212..3775 +7586
Homology
BLAST of SMED30027694 vs. Ensembl Celegans
Match: trhr-1 (Thyrotropin-Releasing Hormone Receptor [Source:UniProtKB/TrEMBL;Acc:Q95YD7])

HSP 1 Score: 48.521 bits (114), Expect = 8.928e-6
Identity = 32/108 (29.63%), Postives = 50/108 (46.30%), Query Frame = -2
Query: 1070 VLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIY--NIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERT 1387
            V+G  GNL+ I +  +       ++ YL   A  D LFF   +   +  +   N H +   + C L   +  +    S L IL FT+ER+  +C P   R +CTV+R 
Sbjct:   44 VIGVLGNLLVITVVLKVRGMKTPTNCYLVSLAASDTLFFFASMPHEMMYLLGPNDHYLFGSLGCVLLTYLPYLAMNTSSLSILAFTIERYYGICNPYKARTMCTVKRA 151          
BLAST of SMED30027694 vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 72.4034 bits (176), Expect = 3.110e-13
Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = -2
Query: 1067 FIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1405
            +IP     G  GN++S++++ R  +  + SS YLA  AV D C   G    W   +  N+     +  C  F   + +  + S   ++ FTVERFI+V YPL R+ +CTV R K
Sbjct:   65 YIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLAGLFAQW--LNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAK 176          
BLAST of SMED30027694 vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100552)

HSP 1 Score: 56.225 bits (134), Expect = 5.305e-8
Identity = 38/123 (30.89%), Postives = 64/123 (52.03%), Query Frame = -2
Query: 1067 IKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSI-YNIHTIKNH-VMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1429
            +++ ++ + +P  FV+G  GN +SIY+ TR  M    +++YL   A+ D  +    LI  LQ   Y  +  K +  +   F  +     Y+S  + + FT+ERFI++ YPL R+  CT    K
Sbjct:   38 VRHVVQRILVPCVFVIGLLGNSVSIYVLTRKRMR-CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLAK 159          
BLAST of SMED30027694 vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070713)

HSP 1 Score: 56.225 bits (134), Expect = 5.305e-8
Identity = 38/123 (30.89%), Postives = 64/123 (52.03%), Query Frame = -2
Query: 1067 IKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSI-YNIHTIKNH-VMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1429
            +++ ++ + +P  FV+G  GN +SIY+ TR  M    +++YL   A+ D  +    LI  LQ   Y  +  K +  +   F  +     Y+S  + + FT+ERFI++ YPL R+  CT    K
Sbjct:   38 VRHVVQRILVPCVFVIGLLGNSVSIYVLTRKRMR-CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLAK 159          
BLAST of SMED30027694 vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100551)

HSP 1 Score: 56.225 bits (134), Expect = 5.305e-8
Identity = 38/123 (30.89%), Postives = 64/123 (52.03%), Query Frame = -2
Query: 1067 IKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSI-YNIHTIKNH-VMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1429
            +++ ++ + +P  FV+G  GN +SIY+ TR  M    +++YL   A+ D  +    LI  LQ   Y  +  K +  +   F  +     Y+S  + + FT+ERFI++ YPL R+  CT    K
Sbjct:   38 VRHVVQRILVPCVFVIGLLGNSVSIYVLTRKRMR-CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLAK 159          
BLAST of SMED30027694 vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070714)

HSP 1 Score: 56.225 bits (134), Expect = 5.305e-8
Identity = 38/123 (30.89%), Postives = 64/123 (52.03%), Query Frame = -2
Query: 1067 IKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSI-YNIHTIKNH-VMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1429
            +++ ++ + +P  FV+G  GN +SIY+ TR  M    +++YL   A+ D  +    LI  LQ   Y  +  K +  +   F  +     Y+S  + + FT+ERFI++ YPL R+  CT    K
Sbjct:   38 VRHVVQRILVPCVFVIGLLGNSVSIYVLTRKRMR-CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLAK 159          
BLAST of SMED30027694 vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 50.8322 bits (120), Expect = 5.427e-7
Identity = 31/114 (27.19%), Postives = 57/114 (50.00%), Query Frame = -2
Query: 1064 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-----CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH 1390
            F +G  GNL++I + T+Y      ++LYL+  A  D     C+    + IW  +  +N      +++C LF  ++    Y + L I   +VER+ ++C+PL  + + T  R + 
Sbjct:   48 FFVGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRIWRYRP-WNF----GNILCKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKVVVTKGRVRG 156          
BLAST of SMED30027694 vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 50.0618 bits (118), Expect = 4.403e-6
Identity = 31/114 (27.19%), Postives = 57/114 (50.00%), Query Frame = -2
Query: 1064 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-----CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH 1390
            F +G  GNL++I + T+Y      ++LYL+  A  D     C+    + IW  +  +N      +++C LF  ++    Y + L I   +VER+ ++C+PL  + + T  R + 
Sbjct:   48 FFVGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRIWRYRP-WNF----GNILCKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKVVVTKGRVRG 156          
BLAST of SMED30027694 vs. Ensembl Zebrafish
Match: ghsrb (growth hormone secretagogue receptor b [Source:ZFIN;Acc:ZDB-GENE-090327-1])

HSP 1 Score: 49.6766 bits (117), Expect = 6.080e-6
Identity = 31/114 (27.19%), Postives = 56/114 (49.12%), Query Frame = -2
Query: 1064 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-----CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH 1390
            F++G  GNL++I + T+Y      ++LYL   A+ D     C+    + +W  +  +N        +C LF  ++    Y + L I   +VER+ ++C+PL  + + T  R K 
Sbjct:   53 FLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVWRYRP-WNF----GDELCKLFQFVSESCTYSTILNITALSVERYFAICFPLRAKVIVTRGRVKG 161          
BLAST of SMED30027694 vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 49.6766 bits (117), Expect = 6.544e-6
Identity = 30/113 (26.55%), Postives = 56/113 (49.56%), Query Frame = -2
Query: 1067 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-----CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1390
            FV+G  GNL+++ + +R+      ++LYL+  A  D     C+      +W  +  +N       ++C LF  ++    Y + L I   +VER+ ++C+PL  + + T  R K
Sbjct:   53 FVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRP-WNF----GDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVK 160          
BLAST of SMED30027694 vs. UniProt/SwissProt
Match: sp|Q95254|GHSR_PIG (Growth hormone secretagogue receptor type 1 OS=Sus scrofa OX=9823 GN=GHSR PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 9.657e-6
Identity = 30/113 (26.55%), Postives = 58/113 (51.33%), Query Frame = -2
Query: 1067 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-----CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1390
            FV+G  GNL+++ + +R+      ++LYL+  A  D     C+      +W  +  +N+     +++C LF  ++    Y + L I   +VER+ ++C+PL  + + T  R K
Sbjct:   54 FVVGIAGNLLTMLVVSRFREMRTTTNLYLSSMAFSDLLIFLCMPLDLFRLWQYRP-WNL----GNLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVK 161          
BLAST of SMED30027694 vs. TrEMBL
Match: A0A0K0PUI8 (Orphan G-protein coupled receptor 50 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.855e-46
Identity = 114/361 (31.58%), Postives = 192/361 (53.19%), Query Frame = -2
Query:  374 PTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQ----FIRLFYQSK---------------NVPKCNQFSHQSNMSRL 1399
            P W+V+GFP N+++  +W +  M    S  YLA  A+ D +F   HL++ LQ  +++  +K  V+C +FP+  +  QY+SPLL+L FTVERFI++C+P  R K CT  R   VI+ + I+   +   Q YF+ Y+   D+ D+C                  + + ++        +++++ I+E  +F ++P +IL LNI VI    +  K  R        +   +  +AT++LLSVSF+LI+T+LP ++   M L   + D  +SDDEI  DP W+ +F    I+  +E L ++H+A NF+IY+ T + FR +    F+++F + K               +VP+    S   N++ L
Sbjct:   52 PVWYVIGFPSNMLAFTVWVQPRMRPS-SGCYLAALAMSDVIFLILHLVFELQMTWDVRLLKLPVLCEVFPIFFLSSQYMSPLLVLAFTVERFIAICHPFRREKFCTTSRAIKVIIGLVILSMCIHAVQGYFWIYRA--DI-DEC------------------TIRDEMMLGGTKSVWSVWSWITELLVFGLVPVVILILNILVI---KEAQKLSRTEESRLCLRRGHKTSAATLTLLSVSFYLILTTLPVTLFYAMYLSFPEGDFFMSDDEIAADPTWQRHFTYFLIRTLVEELGMSHFACNFFIYVSTGKLFRRELTVLFLKIFNKKKLEEMRRGEFNESMMTSVPRAGNHSQNGNVAHL 387          
BLAST of SMED30027694 vs. TrEMBL
Match: A0A4Z2CPS7 (Putative G-coupled receptor OS=Schistosoma japonicum OX=6182 GN=EWB00_008547 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.436e-40
Identity = 125/368 (33.97%), Postives = 185/368 (50.27%), Query Frame = -2
Query:  377 LEVVFIPTWFVLGFPGNLISIYIWTRYSMHH---MVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRK---LCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRR----ILTRNF-SKKHEDRQL----------SATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKNVPKCNQFSHQSNMSR 1417
            +E    P W +LGFPG++ SI +W+   M       +++Y A   VVD  FF  HL W+L   + +  +   V+C  FP+IN ++QYLSP L   FT+ER++++C+P   ++     TV+     I ++F  C I +  Q + Y Y N +  T   V+             +  S    L T+W +        I+ES  F  +P   L LNI VI  L Q  K +R    + T N  S  + DR L          S+T++LL  SF+LII  L  +I  ++   L   +  L+D++IR DP W  YF    ++V IE  ++THYAA F IYL T +QFR +F R+F       +C  F HQS +SR
Sbjct:   32 VERANFPLWAILGFPGSIFSIIVWSSRPMRRGGSAAAAVYQASLGVVDLCFFIIHLHWYLHVAWQLGVLDYPVVCETFPVINYLIQYLSPTLAFTFTLERYLAICHPFRSQRSIMRSTVKSAIKCIAIMFAFCLITASVQAFVYAYNNGVCTTRPSVE-------------DPHSIGFSLYTNWTF--------ITESLYFFCLPITCLVLNILVIGVLRQSIKSKRNALIVTTVNGNSNTNSDRNLTSQPLSKGARSSTLTLLCTSFYLIIAHLSVAIAVLIHKRLPTGNEYLTDEQIRNDPGWTTYFRFFTVRVLIECFAMTHYAAKFPIYLATSKQFRYEFCRIF-------QC-CFKHQSYLSR 370          
BLAST of SMED30027694 vs. TrEMBL
Match: A0A0L8I0D0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22039887mg PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 2.705e-40
Identity = 110/336 (32.74%), Postives = 173/336 (51.49%), Query Frame = -2
Query:  392 PTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKNVPKCNQFSHQ 1399
            P  +++GFPGN++S  +W +  M H  S  YLA  A+ D  F    ++   QS + +  +   ++C  +P++ M  QYL PL +LGFTVER+ISVC+P  R + CT  R K VI+ + I+ F LS  Q YF+HY +       C        S  E   N+S             F+ ++  I E  IF+++P L+L  NI VI+++ ++ K            +E R  + T+ LL+VSF+LI T LP ++   +          +S++E R DP W+ +F    I+  +  + LTH+  NF+IYL T R FR++  +L   S    K N +  +
Sbjct:   16 PFLYIIGFPGNILSFIVWIQRRMRHS-SGYYLAAIALADLFFLALQIVHEAQSAWFLTVLDYPIICGGYPVLFMTCQYLPPLFVLGFTVERYISVCHPFKRERYCTTRRAKIVILALIILSFSLSSMQGYFWHYDS---ACKSC--------SPREWAINTS-------------FWTIWTWIVEFLIFMLVPGLVLIFNILVILEVRRMSKIEL-------HGNEQRTSATTLMLLTVSFYLIFTVLPVTVATSLYTTFPYGKLGMSEEETRADPKWQRFFTYVFIKAIVNEIGLTHFVFNFFIYLITGRLFRKELEKLITSSIICTKWNAYRQR 319          
BLAST of SMED30027694 vs. TrEMBL
Match: A0A183R1X8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.576e-39
Identity = 118/348 (33.91%), Postives = 178/348 (51.15%), Query Frame = -2
Query:  437 LEVVFIPTWFVLGFPGNLISIYIWTRYSMHH---MVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRK---LCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRR---ILT-----------RN-FSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLF 1417
            +E    P W +LGFPG++ SI +W+   M       +++Y A   VVD  FF  HL W+L   + +  + + V+C  FP+IN ++QYLSP L   FT+ER++++C+P   ++     TV+     I ++F+ C I +  Q + Y Y N +  T   V+             + +S    L T+W +        I+ES  F  +P   L LNI VI  L Q  K +R   I+T           RN  S+       S+T++LL  SF+LII  L  +I  ++   L   +  LSD++IR DP W  YF    ++V IE  ++THYAA F IYL T +QFR +F R+F
Sbjct:   32 VERANFPLWAILGFPGSIFSIIVWSSRPMRRGGSAAAAVYQASLGVVDLCFFIIHLNWYLHVAWQLGVLDHPVICETFPVINYLIQYLSPTLAFTFTLERYLAICHPFRSQRSVMRSTVKSAFKFIAIMFVFCLITASVQAFVYAYNNGVCTTRPSVE-------------DPNSIGFSLYTNWTF--------ITESLYFFCLPITCLVLNILVIGVLRQSIKSKRNTLIVTTVNGNSNINCDRNQTSQPISKGARSSTLTLLCTSFYLIIAHLSVAIAVVIHKRLPTGNEYLSDEQIRNDPGWTTYFRFFTVRVLIECFAMTHYAAKFPIYLATSKQFRHEFCRIF 358          
BLAST of SMED30027694 vs. TrEMBL
Match: A0A183NUB9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS5705 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 5.163e-39
Identity = 118/348 (33.91%), Postives = 176/348 (50.57%), Query Frame = -2
Query:  437 LEVVFIPTWFVLGFPGNLISIYIWTRYSMHH---MVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRK---LCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRR---ILT-----------RN-FSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLF 1417
            +E    P W +LGFPG++ SI +W+   M       +++Y A   VVD  FF  HL W+L   + +  + + V+C  FP+IN ++QYLSP L   FT+ER++++C+P   ++     TV+     I ++F  C I +  Q + Y Y N +  T   V+             + +S    L T+W +        I+ES  F  +P   L LNI VI  L Q  K +R   I T           RN  S+       S+T++LL  SF+LII  L  +I  ++   L   +  LSD++IR DP W  YF    ++V IE  ++THYAA F IYL T +QFR +F R+F
Sbjct:   32 VERANFPLWAILGFPGSIFSIIVWSSRPMRRGGSAAAAVYQASLGVVDLCFFIIHLNWYLHVAWQLGVLDHPVICETFPVINYLIQYLSPTLAFTFTLERYLAICHPFRSQRSVMRSTVKSAFKFIAIMFAFCLITASVQAFVYAYNNGVCTTRPSVE-------------DPNSIGFSLYTNWTF--------ITESLYFFCLPITCLVLNILVIGVLRQSIKSKRNTLIATTVNGNSNINCDRNQISQPISKGARSSTLTLLCTSFYLIIAHLSVAIAVVIHKRLPTGNEYLSDEQIRNDPGWTTYFRFFTVRVLIECFAMTHYAAKFPIYLATSKQFRHEFCRIF 358          
BLAST of SMED30027694 vs. Ensembl Cavefish
Match: ghsrb (growth hormone secretagogue receptor [Source:NCBI gene;Acc:103029199])

HSP 1 Score: 52.373 bits (124), Expect = 6.655e-7
Identity = 32/114 (28.07%), Postives = 57/114 (50.00%), Query Frame = -2
Query: 1064 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVD-----CLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH 1390
            F++G  GNL++I + T+Y      ++LYL   A+ D     C+    + +W  +  +N+       +C LF  ++    Y + L I   +VER+ ++C+PL  + L T  R K 
Sbjct:   45 FLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVWRYRP-WNL----GDELCKLFQFVSECCTYSAILSITALSVERYFAICFPLRAKVLVTRGRVKG 153          
BLAST of SMED30027694 vs. Ensembl Cavefish
Match: agtr2 (type-2 angiotensin II receptor-like [Source:NCBI gene;Acc:103035052])

HSP 1 Score: 50.8322 bits (120), Expect = 1.891e-6
Identity = 32/112 (28.57%), Postives = 52/112 (46.43%), Query Frame = -2
Query: 1085 RLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLC 1420
            RL  +F    F+LGF GN++ IY++ + S    V++ YL   A  D LF      W +        +   + C L   +  +  Y S   I   +V+R+ ++ YPL  R +C
Sbjct:   36 RLVPIFYTFIFLLGFFGNMLVIYVFCQSSSRRTVANTYLVNLAASDLLFLSSLPFWAVYYSMGYDWVFGRLACKLCGALLTINVYASVFFITCMSVDRYRAIVYPLSTRSVC 147          
BLAST of SMED30027694 vs. Ensembl Sea Lamprey
Match: ackr4a (atypical chemokine receptor 4a [Source:ZFIN;Acc:ZDB-GENE-070301-6])

HSP 1 Score: 48.9062 bits (115), Expect = 1.894e-6
Identity = 37/143 (25.87%), Postives = 65/143 (45.45%), Query Frame = -2
Query: 1064 NGSKSAYMRHKSDLEFDNQFTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH 1492
            NGS  A  R+    +FD +   K  L +++    F+L F GN + I I  ++  H  V++ YL   ++ D +F      W  +S  N   I  ++MC L      V  Y    L++  +++RF +V       K+  ++  K+
Sbjct:   34 NGSDYASGRNGMSCDFDAEELSKTLLPIIY-SIVFILAFIGNALVILILVKFKRHKEVTNFYLLNLSIADLIFAATMPFWAHESA-NGTWIFGNIMCKLVTACYSVNFYSGIFLLVCMSIDRFNAVVLATKFNKIRRLQNVKY 174          
BLAST of SMED30027694 vs. Ensembl Medaka
Match: ghsrb (growth hormone secretagogue receptor type 1 [Source:NCBI gene;Acc:101167158])

HSP 1 Score: 51.9878 bits (123), Expect = 9.720e-7
Identity = 33/118 (27.97%), Postives = 54/118 (45.76%), Query Frame = -2
Query: 1067 FVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFF----------GRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK 1390
            F++G  GN+++I +  RY      ++LYL   AV D L F           R+  W L             +C LF  ++    Y + L I   +VER++++C+PL  + L T  R +
Sbjct:   78 FLVGVTGNVMTILVVGRYRDMRTTTNLYLCSMAVSDLLIFLCMPLDLYRMWRYRPWRL----------GDALCKLFQFVSESCTYSTILSITALSVERYLAICFPLRAKALVTKRRVR 185          
BLAST of SMED30027694 vs. Planmine SMEST
Match: SMESG000042511.1 (SMESG000042511.1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 368/385 (95.58%), Postives = 368/385 (95.58%), Query Frame = -2
Query:  362 MNSSLICLNGSKSAYMRHKSDLEFDNQFTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKNVPKCNQFSHQSNMSRLTLKT 1516
            MNSSLICLNGSKSAYMRHKSDLEFDNQFTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAV AVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH                IYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESFIFIVIPFLILFLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKNVPKCNQFSHQSNMSRLTLKT
Sbjct:    1 MNSSLICLNGSKSAYMRHKSDLEFDNQFTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVLAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKH----------------IYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESFIFIVIPFLILFLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKNVPKCNQFSHQSNMSRLTLKT 369          
BLAST of SMED30027694 vs. Planmine SMEST
Match: SMESG000012527.1 (SMESG000012527.1)

HSP 1 Score: 245.743 bits (626), Expect = 3.380e-76
Identity = 159/384 (41.41%), Postives = 232/384 (60.42%), Query Frame = -2
Query:  377 MNSSLI--CLNGSKSAYMRHKSDLEFDNQFTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKNVPKCNQF--SHQSNMSR 1516
            MN S I  C+NGS   Y RHKSDL   N FT+K+  E + +P    LG PG + S  IWTR  M +  SS+YL   A+ D LF   H+IWHL S YNI  I N   C++FP+ N++LQY+SP+L L FTVER+IS+C+P  + +LC++ R   V  ++FI  F ++LP +YF+ +    D T+     ++  ++ YE+ + SS+ K +  TDW +    ++N+I+ES +F  IPF+IL +NI VI+++ +++K  +   R+  + H+    + T++LLSVSF+LI  SLP +IV +   +L + + C SD EI  D  W+ +F   N+QV IE  SLT+Y A FYIYL T   FR  F++LF     VP    F  S  S M R
Sbjct:    1 MNDSDIRKCINGSLDVYGRHKSDLGLYNHFTVKHLFEQITVPILVCLGLPGTIFSFIIWTRKQMRYS-SSIYLISLAISDSLFIIGHIIWHLDSTYNIPVINNRFTCNIFPVFNLLLQYMSPILTLAFTVERYISICWPFSKERLCSINRAITVSSVLFIKSFCIALPMLYFFRF----DSTN-----INRCLTIYEI-YKSSNPKDE-STDWLF----IYNIITESIMFACIPFIILIINIRVIIEMWKIYKSSKTGIRSSERSHKG---ATTVTLLSVSFYLICASLPLTIVHLCGFNLEEGNLCASDSEILADAIWRKHFRYVNVQVFIEFFSLTYYGAKFYIYLGTSEAFRTAFLQLF-----VPDNKAFPDSKSSRMDR 360          
BLAST of SMED30027694 vs. Planmine SMEST
Match: SMESG000066742.1 (SMESG000066742.1)

HSP 1 Score: 197.978 bits (502), Expect = 5.651e-58
Identity = 131/347 (37.75%), Postives = 196/347 (56.48%), Query Frame = -2
Query:  422 FTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAV-----IVKLNQVHKFRRILTRN---FSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKL-DLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLFYQSKN 1435
            FTIK  L  + IP W +LG PG++  + +WTR  M H  SS+YLA     D  FF    +W L++ + I  +   V+C LF +IN  LQYLSPL    FT+ERFI +C+P    +  +V R   V ++I +I F+LSL Q YF+ YK   +   +C++               SS  Q  +  W+      +NLI+E+ IF +IP  IL LN+ V     I++ N   KF+ I  R     SK  ++R  S T+ LLS+SF+ I+++LP +I+Q++ + +    D CL+  E+  DP W+A+F   N++  IE L+L+HY+A FYIY+ T  QFR QF+ +F +  N
Sbjct:   31 FTIKGSLHRIIIPIWLILGIPGSIFCVIVWTRPKMLH-TSSVYLAALGASDLGFFICQFVWFLKTAWRIDLLNVPVLCELFAVINFFLQYLSPLFTFAFTLERFILICFPFKGERFLSVPRAITVTLVITLIAFLLSLIQGYFFEYK---EEIKECIE--------------RSSVVQ--EGTWQNRLLFYWNLITETVIFGLIPLSILILNLFVIKETKILQSNAPVKFKLIENRQNVINSKTTDNRNASTTVMLLSISFYFILSTLPVTIMQLLIIHNFWNGDECLTVTEVYSDPIWQAHFKAVNVKSVIETLALSHYSAKFYIYMITGVQFRIQFLNIFKRHSN 357          
BLAST of SMED30027694 vs. Planmine SMEST
Match: SMESG000032057.1 (SMESG000032057.1)

HSP 1 Score: 164.466 bits (415), Expect = 2.308e-45
Identity = 119/355 (33.52%), Postives = 197/355 (55.49%), Query Frame = -2
Query:  437 CLNGSKSAYMRHK-SDLEFDNQFTIKYRLEVVFIPTWFVLGFPGNLISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFIRLF 1498
            C N S +  +R+    +   + FT  Y +E +F+P W  LG PG++I   IW+    HH  S LYL + ++ D LFF  H +++L + + I TI N  MC  FP IN++LQY +PLL LGF+VER +SVC+P    ++   + T     L+  IC +L+LP++YFY Y+   +    C     ++    EL+       Q L    R +    + +++E+ +F V+P +I  +NI VI +L  +   R I T   S+       ++T +LL VSF+L+  ++P ++ Q++K +    + C+SD +I  +  WK +  + +IQ+ +EML+ T+ AA F+IY+ T + FR  F  +F
Sbjct:    7 CSNSSLNILVRYNHQSMNIYHNFTYIYTMEYIFMPIWLCLGIPGSIICFRIWSIRRQHHS-SVLYLCLLSINDLLFFIFHFLFYLNNYHYIKTIDNPFMCKFFPFINIILQYAAPLLTLGFSVERCVSVCHPFISDRISNYKTTVRTCFLLISICVLLALPKLYFYSYEGENEEKGSCTVYYQYI----ELK------DQNLIKKLR-NIMLTYEIVTETMVFAVVPLMIFLVNIRVIFELISMKNRRLISTA--SQPSYSNNAASTTTLLIVSFYLLCATIPATVFQLLKFNNFPKNLCISDSDIWLNYEWKMHLRHVSIQIPVEMLAKTYNAAKFFIYIVTSQWFRSNFQMMF 347          
BLAST of SMED30027694 vs. Planmine SMEST
Match: SMESG000031888.1 (SMESG000031888.1)

HSP 1 Score: 122.865 bits (307), Expect = 1.149e-30
Identity = 102/326 (31.29%), Postives = 163/326 (50.00%), Query Frame = -2
Query:  446 WFVLGFPGNLISIYIWTRYSMHHMVSS-LYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIKNHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTKHXXXXXXXXXXXLSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNSSSAKQQLQTDWRYHFFNMFNLISESXXXXXXXXXXXXLNIAVIVKLNQVHKFRRILT-RNFSKKHEDRQ--------LSATISLLSVSFFLIITSLPTSIVQMMKLDLTKDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCRQFREQFI 1393
            W ++G+ GN+ S  IW    M    SS +YLA  ++ D L     +I  LQ  +N + ++ +  C ++ +++   Q  SP+L+L FT+ER++++CYP  R+ LCT +R                   + F  Y   L     C +I +  M  Y  +F+S     QL+T+    F   +   +E      +P LIL  NI VI ++ ++ K  R  +  N  + H+  Q        L  TI LL+VSF+L  T+LP  I+  ++  +T  D  ++  +I  DP W+ YF    I+  I+ L ++HYA NF IYL T + FR+QFI
Sbjct:    5 WLLIGYIGNIFSFIIWIEPKMRRENSSAIYLAALSLNDFLVLVFVMIQDLQYSWNKNVLR-YSFCSIYMVLSTCSQLFSPVLVLAFTIERWVAICYPFKRQSLCTPKRAII----------------VSFTLYLFVL-----CYNIYNGFMWIYNERFDSC-VFNQLETNGT-DFQKQYIFATEIVFSGCVPLLILGFNILVIKEMYRITKCNRTKSMGNCPQFHDPNQRFNNERSFLFTTIMLLAVSFYLFFTTLPGGIMFALQQVITMPDENMNLSKIPSDPKWQFYFRVSIIKAVIDELCISHYALNFVIYLVTGKAFRKQFI 306          
The following BLAST results are available for this feature:
BLAST of SMED30027694 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027694 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trhr-18.928e-629.63Thyrotropin-Releasing Hormone Receptor [Source:Un... [more]
back to top
BLAST of SMED30027694 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNMaR3.110e-1334.21gene:FBgn0053696 transcript:FBtr0091684[more]
Proc-R5.305e-830.89gene:FBgn0029723 transcript:FBtr0100552[more]
Proc-R5.305e-830.89gene:FBgn0029723 transcript:FBtr0070713[more]
Proc-R5.305e-830.89gene:FBgn0029723 transcript:FBtr0100551[more]
Proc-R5.305e-830.89gene:FBgn0029723 transcript:FBtr0070714[more]
back to top
BLAST of SMED30027694 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ghsra5.427e-727.19growth hormone secretagogue receptor a [Source:ZFI... [more]
ghsra4.403e-627.19growth hormone secretagogue receptor a [Source:ZFI... [more]
ghsrb6.080e-627.19growth hormone secretagogue receptor b [Source:ZFI... [more]
back to top
BLAST of SMED30027694 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027694 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ghsr6.544e-626.55growth hormone secretagogue receptor [Source:MGI S... [more]
back to top
BLAST of SMED30027694 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q95254|GHSR_PIG9.657e-626.55Growth hormone secretagogue receptor type 1 OS=Sus... [more]
back to top
BLAST of SMED30027694 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0PUI81.855e-4631.58Orphan G-protein coupled receptor 50 OS=Platynerei... [more]
A0A4Z2CPS71.436e-4033.97Putative G-coupled receptor OS=Schistosoma japonic... [more]
A0A0L8I0D02.705e-4032.74G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183R1X84.576e-3933.91G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183NUB95.163e-3933.91G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30027694 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ghsrb6.655e-728.07growth hormone secretagogue receptor [Source:NCBI ... [more]
agtr21.891e-628.57type-2 angiotensin II receptor-like [Source:NCBI g... [more]
back to top
BLAST of SMED30027694 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ackr4a1.894e-625.87atypical chemokine receptor 4a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30027694 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027694 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027694 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ghsrb9.720e-727.97growth hormone secretagogue receptor type 1 [Sourc... [more]
back to top
BLAST of SMED30027694 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042511.10.000e+095.58SMESG000042511.1[more]
SMESG000012527.13.380e-7641.41SMESG000012527.1[more]
SMESG000066742.15.651e-5837.75SMESG000066742.1[more]
SMESG000032057.12.308e-4533.52SMESG000032057.1[more]
SMESG000031888.11.149e-3031.29SMESG000031888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027694 ID=SMED30027694|Name=SMED30027694|organism=Schmidtea mediterranea sexual|type=transcript|length=1565bp
CTCCCTTCTACAATTACAATTTTACCATTTGTATCTTCCATGTCATACAT
ATGGGTAGACAGTCAAATGTTTCCAATTTCTGTTGTGCTTCATTTCATGA
TAAACATATTCATACAGCAATAAGTCCTATAGTGAACCTCGAATTCTTTA
CAAGCTTTAAAAATATCAAAATTCCAAAAGAATTTTTATAAAAAGTAAAA
CGATCACTAAGCTTATAATGTTCAAAATTGAAATCGCAAGTCAGATATGT
TGCTTCAATTTCTTCCCGTCTTACTGCCTACAGTTTCTATGCCAAATTCT
GTAATAGTAGAGAATTTGAGACAGAATAGAATTTATTTTTCATAATGCAA
AACCGATCTCAAGTTTTTAATGTTAATCTTGACATGTTAGATTGATGGGA
AAACTGATTGCATTTCGGAACATTCTTTGACTGATAAAATAATCTTATAA
ATTGCTCTCGAAATTGTCGACAAGTACATAAATATATATAAAAATTAGCT
GCGTAATGTGTCAACGACAACATTTCTATTTGAACTTGAATGTTTTTATT
AAGAAAATAAGCCTTCCAAGCTGGATCTCGGCGGATTTCATCGTCTGATA
AGCAAGTGTCATCCTTAGTTAAGTCCAACTTCATCATTTGTACAATGGAG
GTTGGTAGTGATGTTATTATTAAAAAGAATGAGACTGATAATAGAGAGAT
TGTCGCTGACAATTGTCGGTCTTCATGTTTTTTCGAAAAGTTTCTTGTTA
ATATTCGACGAAACTTATGAACCTGGTTCAGTTTGACAATGACAGCAATG
TTGAGAAAAAGAATAAGAAAAGGAATAACGATGAAAATAAAACTCTCACT
GATAAGATTAAACATATTAAAGAAATGATATCTCCAGTCGGTTTGTAACT
GTTGCTTTGCTGAAGAAGAATTGAATTGCAATTCATATTGGCTCATCAAC
CAGGAAACAATGTCTACGCAGTCGTCTGTTAAATCAAGAAAATTTTTGTA
ATGATAGAAATAAATCTGAGGTAAAGATAAAATAAAACAAATTATGAAAA
TTAAAACAATAACATGTTTTGTTCGTTCGACTGTACAGAGTTTCCGTCTG
TATAACGGATAGCAAACCGAAATAAATCGTTCGACGGTAAATCCTAAAAT
CAAAAGAGGTGAAAGATATTGCAACACCATATTTATCATAGGAAACAGAT
GGCACATGACATGATTCTTTATGGTATGAATATTGTAGATTGACTGTAAA
TGCCATATCAAATGTCTTCCAAAAAATAGGCAGTCTACGACAGCAAAAAC
AGCCAAATAGAGAGATGACACCATGTGATGCATCGAATATCTCGTCCAGA
TATAAATGCTGATCAAATTTCCTGGGAATCCCAGCACAAACCACGTAGGA
ATGAAAACAACTTCTAGTCGATATTTGATTGTAAACTGATTATCAAACTC
CAAATCGCTTTTGTGGCGCATATAAGCACTTTTTGATCCATTTAAACAAA
TCAGAGAGCTGTTCATTTGACAAAAATTTTTAAACCTACTTCTAAAATGA
TTAAATCAAAATTCA
back to top

protein sequence of SMED30027694-orf-1

>SMED30027694-orf-1 ID=SMED30027694-orf-1|Name=SMED30027694-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
MNSSLICLNGSKSAYMRHKSDLEFDNQFTIKYRLEVVFIPTWFVLGFPGN
LISIYIWTRYSMHHMVSSLYLAVFAVVDCLFFGRHLIWHLQSIYNIHTIK
NHVMCHLFPMINMVLQYLSPLLILGFTVERFISVCYPLYRRKLCTVERTK
HVIVLIFIICFILSLPQIYFYHYKNFLDLTDDCVDIVSWLMSQYELQFNS
SSAKQQLQTDWRYHFFNMFNLISESFIFIVIPFLILFLNIAVIVKLNQVH
KFRRILTRNFSKKHEDRQLSATISLLSVSFFLIITSLPTSIVQMMKLDLT
KDDTCLSDDEIRRDPAWKAYFLNKNIQVQIEMLSLTHYAANFYIYLCTCR
QFREQFIRLFYQSKNVPKCNQFSHQSNMSRLTLKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 37..61
score: 18.83
coord: 330..356
score: 21.49
coord: 151..172
score: 20.56
coord: 115..137
score: 18.17
coord: 70..91
score: 24.25
coord: 224..247
score: 16.23
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 52..301
e-value: 7.9E-15
score: 54.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 21..369
e-value: 1.4E-42
score: 147.8
NoneNo IPR availablePANTHERPTHR24243:SF208ETHR, ISOFORM Acoord: 15..381
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 15..381
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 39..359
e-value: 9.01216E-30
score: 114.652
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 32..371
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 155..174
NoneNo IPR availableTMHMMTMhelixcoord: 120..142
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 52..348
score: 22.117