RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30027687
Length (bp)2110
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30027687) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30027687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30027687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30027687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027687SMESG000038824.1 Contig430uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000038824.1 Contig430newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000038824.1 Contig429uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000038824.1 Contig429newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000067788.1 Contig430uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000067788.1 Contig430newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000068628.1 Contig429uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027687SMESG000068628.1 Contig429newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30027687SMESG000038824.1 SmedASXL_011756SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30027687SMESG000038824.1 dd_Smed_v4_3002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027687SMESG000038824.1 dd_Smed_v4_3002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027687SMESG000038824.1 dd_Smed_v4_3002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027687SMESG000038824.1 dd_Smed_v4_3002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: Y57G11C.9 (pep chromosome:WBcel235:IV:14787168:14790843:1 gene:WBGene00013307.1 transcript:Y57G11C.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.9)

HSP 1 Score: 70.8626 bits (172), Expect = 1.614e-12
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = 3
Query:  102 RVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKK 380
            R+N   VP S+H IFIRG   D+ T +I+++  E        DF     ++ K+ +A+RFE+ D AK+ +  +++ E  G R +++WF+D+++
Sbjct:   39 RINETQVPQSKHTIFIRGLHGDISTEEIKEYIGEKV-GKISFDFVKVAQDKSKIFVAVRFENRDEAKEFMETYSDREFMGCRCDLSWFRDIRR 130          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: Y57G11C.9 (pep chromosome:WBcel235:IV:14787168:14790843:1 gene:WBGene00013307.1 transcript:Y57G11C.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.9)

HSP 1 Score: 70.8626 bits (172), Expect = 1.624e-12
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = 3
Query:  102 RVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKK 380
            R+N   VP S+H IFIRG   D+ T +I+++  E        DF     ++ K+ +A+RFE+ D AK+ +  +++ E  G R +++WF+D+++
Sbjct:   39 RINETQVPQSKHTIFIRGLHGDISTEEIKEYIGEKV-GKISFDFVKVAQDKSKIFVAVRFENRDEAKEFMETYSDREFMGCRCDLSWFRDIRR 130          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: pphln1 (periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873])

HSP 1 Score: 53.5286 bits (127), Expect = 4.590e-7
Identity = 21/60 (35.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            K   IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ LI++  +C++ ++ +I  L
Sbjct:  280 KAREIEKVYRQDCETFGMVVKMLVSKEPSLEKHLQNPLKENLIEIRERCLEDLQHFIAEL 339          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: pphln1 (periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873])

HSP 1 Score: 53.5286 bits (127), Expect = 4.886e-7
Identity = 21/60 (35.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            K   IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ LI++  +C++ ++ +I  L
Sbjct:  292 KAREIEKVYRQDCETFGMVVKMLVSKEPSLEKHLQNPLKENLIEIRERCLEDLQHFIAEL 351          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: pphln1 (periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873])

HSP 1 Score: 53.5286 bits (127), Expect = 4.886e-7
Identity = 21/60 (35.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            K   IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ LI++  +C++ ++ +I  L
Sbjct:  292 KAREIEKVYRQDCETFGMVVKMLVSKEPSLEKHLQNPLKENLIEIRERCLEDLQHFIAEL 351          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: pphln1 (periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873])

HSP 1 Score: 50.8322 bits (120), Expect = 5.476e-7
Identity = 21/60 (35.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            K   IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ LI++  +C++ ++ +I  L
Sbjct:   94 KAREIEKVYRQDCETFGMVVKMLVSKEPSLEKHLQNPLKENLIEIRERCLEDLQHFIAEL 153          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Pphln1 (periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029])

HSP 1 Score: 49.2914 bits (116), Expect = 9.599e-6
Identity = 19/66 (28.79%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQN 1706
            K + IE+ Y++D ET+  V+ +LI K P L+  ++  L+  L ++G +C++ ++ +I    ++ Q+
Sbjct:  223 KTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALRQNLHEIGERCVEELKRFITEYDNSAQD 288          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Pphln1 (periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029])

HSP 1 Score: 49.2914 bits (116), Expect = 9.599e-6
Identity = 19/66 (28.79%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQN 1706
            K + IE+ Y++D ET+  V+ +LI K P L+  ++  L+  L ++G +C++ ++ +I    ++ Q+
Sbjct:  223 KTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALRQNLHEIGERCVEELKRFITEYDNSAQD 288          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Pphln1 (periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029])

HSP 1 Score: 49.2914 bits (116), Expect = 9.599e-6
Identity = 19/66 (28.79%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQN 1706
            K + IE+ Y++D ET+  V+ +LI K P L+  ++  L+  L ++G +C++ ++ +I    ++ Q+
Sbjct:  223 KTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALRQNLHEIGERCVEELKRFITEYDNSAQD 288          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Pphln1 (periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029])

HSP 1 Score: 49.2914 bits (116), Expect = 9.989e-6
Identity = 19/66 (28.79%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQN 1706
            K + IE+ Y++D ET+  V+ +LI K P L+  ++  L+  L ++G +C++ ++ +I    ++ Q+
Sbjct:  242 KTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALRQNLHEIGERCVEELKRFITEYDNSAQD 307          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2MHK0 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001232 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.783e-26
Identity = 57/124 (45.97%), Postives = 84/124 (67.74%), Query Frame = 3
Query:   87 RNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDRSRVLILSYQEHNLVRSSDKFGF 458
            R  F+RVNP+ V PSRH +FIRG     D  K++DFF E + S C VDF S ++++++LS+A+RF+SHD+AK++L ++NN  + G+ VE++WFKDLKKA    R  +   Q  +  RS  + GF
Sbjct:    4 RQQFDRVNPRNVAPSRHTLFIRGLPGATDVTKVKDFFSEETNSKCSVDFFSTSEDKKRLSVAIRFKSHDLAKEILAKYNNKHLMGFPVELSWFKDLKKA----RAKMFEEQRQSGGRSFQRQGF 123          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5K3FIE9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.839e-26
Identity = 56/117 (47.86%), Postives = 79/117 (67.52%), Query Frame = 3
Query:   87 RNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDRSRVLILSYQEHNLVR 437
            R   +RVNP+YVPPSRH IFIRG     +   +++ F E SKS C V+F S ++++ + S+A+RF+SH+ A++ML ++N  E+ G+ VEVTWFKDLKKAR R    +   Q HN  R
Sbjct:    5 RQPMDRVNPRYVPPSRHTIFIRGLPGSTNVDSVKNHFSEESKSKCTVEFFSTSEDKVRFSVAIRFKSHETAREMLEKYNGKELMGHPVEVTWFKDLKKARAR----VYEEQRHNRFR 117          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2MFS8 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001232 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.010e-26
Identity = 57/124 (45.97%), Postives = 84/124 (67.74%), Query Frame = 3
Query:   87 RNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDRSRVLILSYQEHNLVRSSDKFGF 458
            R  F+RVNP+ V PSRH +FIRG     D  K++DFF E + S C VDF S ++++++LS+A+RF+SHD+AK++L ++NN  + G+ VE++WFKDLKKA    R  +   Q  +  RS  + GF
Sbjct:    4 RQQFDRVNPRNVAPSRHTLFIRGLPGATDVTKVKDFFSEETNSKCSVDFFSTSEDKKRLSVAIRFKSHDLAKEILAKYNNKHLMGFPVELSWFKDLKKA----RAKMFEEQRQSGGRSFQRQGF 123          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2MBI5 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001232 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.916e-26
Identity = 57/124 (45.97%), Postives = 84/124 (67.74%), Query Frame = 3
Query:   87 RNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDRSRVLILSYQEHNLVRSSDKFGF 458
            R  F+RVNP+ V PSRH +FIRG     D  K++DFF E + S C VDF S ++++++LS+A+RF+SHD+AK++L ++NN  + G+ VE++WFKDLKKA    R  +   Q  +  RS  + GF
Sbjct:    4 RQQFDRVNPRNVAPSRHTLFIRGLPGATDVTKVKDFFSEETNSKCSVDFFSTSEDKKRLSVAIRFKSHDLAKEILAKYNNKHLMGFPVELSWFKDLKKA----RAKMFEEQRQSGGRSFQRQGF 123          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5J4N6Y9 (RRM domain-containing protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0012066 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 8.781e-26
Identity = 51/100 (51.00%), Postives = 75/100 (75.00%), Query Frame = 3
Query:   87 RNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKAR 386
            R  F++VNP+ V PSRH +FIRG     D  K+++FF   + S C VDF S +D++++LS+A+RF+SHD+A++ML ++NN  + G+ VE+TWFKDLKKAR
Sbjct:    4 RQPFDKVNPRNVVPSRHTVFIRGLPGPTDVTKVKEFFSTETGSKCSVDFFSTSDDKKRLSVAIRFKSHDVAREMLTKYNNKLLMGFPVELTWFKDLKKAR 103          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000015142.2 (periphilin-1-like [Source:NCBI gene;Acc:103022647])

HSP 1 Score: 55.0694 bits (131), Expect = 1.178e-7
Identity = 20/53 (37.74%), Postives = 39/53 (73.58%), Query Frame = 3
Query: 1521 IEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYI 1679
            IEK Y++D ET+  V+ +L+ K P L+ +LE+ LK+ L+++  +C++ +R++I
Sbjct:  274 IEKLYRQDCETFGMVVKMLVAKQPTLEKQLETALKENLVEIKERCLEDLRQFI 326          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: pphln1 (periphilin 1 [Source:NCBI gene;Acc:103022650])

HSP 1 Score: 52.7582 bits (125), Expect = 6.919e-7
Identity = 28/107 (26.17%), Postives = 53/107 (49.53%), Query Frame = 3
Query: 1368 LNNWKQTASDSDDFLSKNSQNIKSKTKISVSAXXXXXXXXXXXXXXMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            L   ++ ++ SD+F  + SQ I +K +                        IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ L ++  +C++ +R +I  L
Sbjct:  237 LPATEEVSTVSDEFHERRSQAIAAKAR-----------------------EIEKVYRQDCETFGMVVKMLVAKEPSLEKHLQTPLKENLSEIRERCLEDLRHFISEL 320          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: pphln1 (periphilin 1 [Source:NCBI gene;Acc:103022650])

HSP 1 Score: 52.7582 bits (125), Expect = 7.480e-7
Identity = 28/107 (26.17%), Postives = 53/107 (49.53%), Query Frame = 3
Query: 1368 LNNWKQTASDSDDFLSKNSQNIKSKTKISVSAXXXXXXXXXXXXXXMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            L   ++ ++ SD+F  + SQ I +K +                        IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ L ++  +C++ +R +I  L
Sbjct:  256 LPATEEVSTVSDEFHERRSQAIAAKAR-----------------------EIEKVYRQDCETFGMVVKMLVAKEPSLEKHLQTPLKENLSEIRERCLEDLRHFISEL 339          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: pphln1 (periphilin 1 [Source:NCBI gene;Acc:103022650])

HSP 1 Score: 51.2174 bits (121), Expect = 2.019e-6
Identity = 28/107 (26.17%), Postives = 53/107 (49.53%), Query Frame = 3
Query: 1368 LNNWKQTASDSDDFLSKNSQNIKSKTKISVSAXXXXXXXXXXXXXXMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            L   ++ ++ SD+F  + SQ I +K +                        IEK Y++D ET+  V+ +L+ K P L+  L++ LK+ L ++  +C++ +R +I  L
Sbjct:  243 LPATEEVSTVSDEFHERRSQAIAAKAR-----------------------EIEKVYRQDCETFGMVVKMLVAKEPSLEKHLQTPLKENLSEIRERCLEDLRHFISEL 326          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035861.1 (periphilin-1 [Source:NCBI gene;Acc:101159097])

HSP 1 Score: 51.6026 bits (122), Expect = 1.549e-6
Identity = 23/60 (38.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            K   IEK YK+D ET+ +V+ +LI K P L+  LE+ L   L+++   C+D+++ +I  L
Sbjct:  254 KAVEIEKHYKQDCETFRTVVKMLIDKEPGLENSLEAPLAKNLVEIKQHCLDALKGFISEL 313          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000004039.2 (periphilin-1 [Source:NCBI gene;Acc:101159097])

HSP 1 Score: 51.6026 bits (122), Expect = 1.655e-6
Identity = 23/60 (38.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHL 1688
            K   IEK YK+D ET+ +V+ +LI K P L+  LE+ L   L+++   C+D+++ +I  L
Sbjct:  257 KAVEIEKHYKQDCETFRTVVKMLIDKEPGLENSLEAPLAKNLVEIKQHCLDALKGFISEL 316          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000038824.1 (SMESG000038824.1)

HSP 1 Score: 522.702 bits (1345), Expect = 0.000e+0
Identity = 322/339 (94.99%), Postives = 324/339 (95.58%), Query Frame = 3
Query:  699 VLDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGXXXXXXXXXXXXXXXXXXXXXXXXXGSDSRSILISKIEGDIRSKSPSVREVKDKNDLVAMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDXXXXXXXXXXXXVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSAXXXXXXXXXXXXXXMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHLE 1715
            +LDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHKRKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIR               +AMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEKSLKLLKMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHLE
Sbjct:  120 MLDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHKRKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIR---------------IAMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEKSLKLLKMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHLE 443          

HSP 2 Score: 265.774 bits (678), Expect = 3.385e-81
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 3
Query:   36 MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 392
            MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR
Sbjct:    1 MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 119          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000038824.1 (SMESG000038824.1)

HSP 1 Score: 520.005 bits (1338), Expect = 1.066e-179
Identity = 321/339 (94.69%), Postives = 323/339 (95.28%), Query Frame = 3
Query:  699 VLDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGXXXXXXXXXXXXXXXXXXXXXXXXXGSDSRSILISKIEGDIRSKSPSVREVKDKNDLVAMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDXXXXXXXXXXXXVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSAXXXXXXXXXXXXXXMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHLE 1715
            +LDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHKRKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIR+                MSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEKSLKLLKMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHLE
Sbjct:  120 MLDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHKRKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIRT----------------MSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEKSLKLLKMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHLE 442          

HSP 2 Score: 265.774 bits (678), Expect = 3.223e-81
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 3
Query:   36 MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 392
            MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR
Sbjct:    1 MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 119          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000038824.1 (SMESG000038824.1)

HSP 1 Score: 431.795 bits (1109), Expect = 5.833e-146
Identity = 278/295 (94.24%), Postives = 280/295 (94.92%), Query Frame = 3
Query:  699 VLDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGXXXXXXXXXXXXXXXXXXXXXXXXXGSDSRSILISKIEGDIRSKSPSVREVKDKNDLVAMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDXXXXXXXXXXXXVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSAXXXXXXXXXXXXXXMKVENIEKAYKKDSETYSSVISVLIR 1583
            +LDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHKRKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIR               +AMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEKSLKLLKMKVENIEKAYKKDSETYSSVISVLIR
Sbjct:  120 MLDERRVPFDEHRMNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHKRKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIR---------------IAMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVDNVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNENLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEKSLKLLKMKVENIEKAYKKDSETYSSVISVLIR 399          

HSP 2 Score: 265.003 bits (676), Expect = 1.485e-81
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 3
Query:   36 MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 392
            MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR
Sbjct:    1 MSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKARDR 119          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000002926.1 (SMESG000002926.1)

HSP 1 Score: 120.168 bits (300), Expect = 1.983e-28
Identity = 53/99 (53.54%), Postives = 77/99 (77.78%), Query Frame = 3
Query:   90 NSFERVNPKYVPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKAR 386
            NS +RV+PK V PSRH+IFIRGF +++    +R FF+  SK NC +DF SY+++++KL IALRFESH+ A D++  F++ E+ G+ +EV+WFKDL+KAR
Sbjct:    9 NSSDRVDPKMVTPSRHSIFIRGFPSNMSMENVRSFFKTESKENCKIDFFSYSEDRKKLFIALRFESHEKAVDIIENFDSKEVLGHSIEVSWFKDLRKAR 107          

HSP 2 Score: 54.6842 bits (130), Expect = 1.793e-7
Identity = 26/68 (38.24%), Postives = 44/68 (64.71%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHL 1712
            K E++EK YKKD ET +SV  ++I K+P ++  +  ILK I  D+G + ++ +R YI +L++ N   +
Sbjct:  435 KKESLEKTYKKDCETVASVAKLMISKNPTIEESILIILKSIFTDIGEKYIEELRSYINYLANINSQQI 502          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000002926.1 (SMESG000002926.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.128e-24
Identity = 47/89 (52.81%), Postives = 69/89 (77.53%), Query Frame = 3
Query:  120 VPPSRHAIFIRGFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAKDMLLRFNNTEIFGYRVEVTWFKDLKKAR 386
            V PSRH+IFIRGF +++    +R FF+  SK NC +DF SY+++++KL IALRFESH+ A D++  F++ E+ G+ +EV+WFKDL+KAR
Sbjct:    2 VTPSRHSIFIRGFPSNMSMENVRSFFKTESKENCKIDFFSYSEDRKKLFIALRFESHEKAVDIIENFDSKEVLGHSIEVSWFKDLRKAR 90          

HSP 2 Score: 54.6842 bits (130), Expect = 1.809e-7
Identity = 26/68 (38.24%), Postives = 44/68 (64.71%), Query Frame = 3
Query: 1509 KVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILIDVGNQCMDSMREYILHLSDNNQNHL 1712
            K E++EK YKKD ET +SV  ++I K+P ++  +  ILK I  D+G + ++ +R YI +L++ N   +
Sbjct:  418 KKESLEKTYKKDCETVASVAKLMISKNPTIEESILIILKSIFTDIGEKYIEELRSYINYLANINSQQI 485          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y57G11C.91.614e-1233.33pep chromosome:WBcel235:IV:14787168:14790843:1 gen... [more]
Y57G11C.91.624e-1233.33pep chromosome:WBcel235:IV:14787168:14790843:1 gen... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pphln14.590e-735.00periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873... [more]
pphln14.886e-735.00periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873... [more]
pphln14.886e-735.00periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873... [more]
pphln15.476e-735.00periphilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1873... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pphln19.599e-628.79periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029][more]
Pphln19.599e-628.79periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029][more]
Pphln19.599e-628.79periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029][more]
Pphln19.989e-628.79periphilin 1 [Source:MGI Symbol;Acc:MGI:1917029][more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MHK03.783e-2645.97RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A5K3FIE93.839e-2647.86Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2MFS84.010e-2645.97RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2MBI54.916e-2645.97RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A5J4N6Y98.781e-2651.00RRM domain-containing protein (Fragment) OS=Parago... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000015142.21.178e-737.74periphilin-1-like [Source:NCBI gene;Acc:103022647][more]
pphln16.919e-726.17periphilin 1 [Source:NCBI gene;Acc:103022650][more]
pphln17.480e-726.17periphilin 1 [Source:NCBI gene;Acc:103022650][more]
pphln12.019e-626.17periphilin 1 [Source:NCBI gene;Acc:103022650][more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000035861.11.549e-638.33periphilin-1 [Source:NCBI gene;Acc:101159097][more]
ENSORLT00000004039.21.655e-638.33periphilin-1 [Source:NCBI gene;Acc:101159097][more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038824.13.385e-8194.99SMESG000038824.1[more]
SMESG000038824.11.066e-17994.69SMESG000038824.1[more]
SMESG000038824.15.833e-14694.24SMESG000038824.1[more]
SMESG000002926.11.983e-2853.54SMESG000002926.1[more]
SMESG000002926.11.128e-2452.81SMESG000002926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027687 ID=SMED30027687|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2110bp
GAAAATTATTCTATTTATTAAAATTAAATTATATCATGTCGGGCCCCGTT
GCACGAAAATTTTTCGGGGGTAGGAATGCTCCAAATAGAAATTCATTTGA
AAGAGTTAATCCTAAATATGTTCCACCTAGCAGACATGCAATTTTTATTC
GAGGATTTGCTAATGATGTAGATACGCATAAAATCAGAGATTTTTTTCAA
GAAGCTTCTAAAAGCAATTGTGGTGTTGATTTTACTAGTTATAATGATGA
ACAACGTAAATTAAGCATTGCATTACGATTTGAATCACATGATATTGCTA
AAGATATGTTATTGAGATTCAATAATACTGAAATATTTGGATATCGAGTT
GAAGTGACATGGTTTAAAGATTTGAAGAAAGCTCGTGATAGAAGTAGAGT
GTTAATATTATCTTATCAAGAACACAATTTAGTTAGATCCAGTGATAAAT
TTGGTTTTTTCAATGTTTAAAGTTCTTATTTGGCAATATTTCAAAATTTA
ATTAATGAAAAATAATTTCAAAAACTTTTTGAAAATCATATTTTGTTTCA
ACATATAATTTGGGGTAGTCTAACTAAATTATTATGCGATATCATTTTAT
TATTGAAATTATTTATAATTTTCTAAATTGTTCACTGTAAGACTATTTTC
TTGATAAGGAAGATCAATGCATAACATTTTATAATTAATAATATTACAGT
GCTGGATGAAAGAAGAGTTCCATTTGATGAGCATCGAATGAATTTCAAAA
ATAATCGTTTTGACTATGAAAGGCGTGACAATCGCGAATGGTCTGATGCA
CGTAAAAAATTTTCACAGAATAATAACAAACACAGTAAATCAGTGGAACG
AAGTGATGTTAATAGTGAAGCTTCGTATGGTCATAAACGAAAACATTCCA
GTGAGTATGAGAAAAGCAGATCTCATTCGTCAAATCGATCGGAGAAATCT
TATTCAGGATCAGATTCTCGTTCAATTTTAATAAGTAAAATAGAGGGAGA
TATTCGCAGTAAGAGTCCATCTGTTAGAGAAGTGAAAGATAAAAACGATC
TAGTAGCAATGTCAGACAAACCCGCCGCATATAACGTGGATTTAGATGAA
AATTTCAATGAAAATCTACCACAAATTAAAGCTCCTCTTCAGAAAGAAGA
GAGTATTTCTTCTATCCCAGACAATTACAAGGTTGATAATGTAACTAATC
ATAAACATGATTCCGAAGATAAAAAGAAAAAAAAGAAAAAGCGAAAGCGT
CGACGTGTTGAGCATAGTGGTAGCGCGGATTCCTTTGGAGAATCATCTAA
GATAGCCAAATATAATCCAGCTACTGATCAGAATGAAAATCTTCAGTTTT
CAGCCATTGCCGGGGATTTAAATAATTGGAAACAAACCGCTTCTGACTCT
GATGACTTCCTCAGCAAAAATAGTCAAAATATAAAATCGAAAACAAAAAT
CTCTGTATCTGCATCAGAAAAGTTAAATAATGAAAAAAGTCTCAAACTTT
TAAAAATGAAAGTTGAAAATATTGAAAAAGCTTATAAAAAGGACAGTGAA
ACGTATTCTAGTGTTATCAGTGTTTTAATTCGAAAATCGCCAGAATTAAA
AGTGAAATTAGAATCAATTTTGAAAGATATATTAATAGATGTTGGGAATC
AATGCATGGATTCAATGCGCGAATATATACTGCATTTATCCGATAACAAT
CAAAATCACCTTGAACCGAGCGCTTCACCTGCATCGAGCATGTAAAATTC
CTGTTAATAAATATATATTAGTTGTTTTTGTCTATTTTATATACCAATTC
TCCAAATAAGATGTTTTAGAACATTTTGTTAGAAAATCAATTGTGAGAAA
GTTCAATATTATTGAACCGTGTCATTAAAGATGCGTGTGGATGAAATCCA
AGCTTGCAATCAGTTTCACCCTACATATTGATTATATAGCACTGGCTAGA
AGAAACCCGGTTTGGGACAGTGCAAGATAGATAATTCGAAATGTTTTTAT
CGATTTTAGTGGATTTATAGTTAAAAGAAAAATTAATTGACTTCTTTATA
AATCAATACAAAAAAATAAGTGTTAAAAAATGAATATGTTAAATAAATGC
TAAAAAGAAG
back to top

protein sequence of SMED30027687-orf-1

>SMED30027687-orf-1 ID=SMED30027687-orf-1|Name=SMED30027687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MNFKNNRFDYERRDNREWSDARKKFSQNNNKHSKSVERSDVNSEASYGHK
RKHSSEYEKSRSHSSNRSEKSYSGSDSRSILISKIEGDIRSKSPSVREVK
DKNDLVAMSDKPAAYNVDLDENFNENLPQIKAPLQKEESISSIPDNYKVD
NVTNHKHDSEDKKKKKKKRKRRRVEHSGSADSFGESSKIAKYNPATDQNE
NLQFSAIAGDLNNWKQTASDSDDFLSKNSQNIKSKTKISVSASEKLNNEK
SLKLLKMKVENIEKAYKKDSETYSSVISVLIRKSPELKVKLESILKDILI
DVGNQCMDSMREYILHLSDNNQNHLEPSASPASSM*
back to top

protein sequence of SMED30027687-orf-2

>SMED30027687-orf-2 ID=SMED30027687-orf-2|Name=SMED30027687-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
KLFYLLKLNYIMSGPVARKFFGGRNAPNRNSFERVNPKYVPPSRHAIFIR
GFANDVDTHKIRDFFQEASKSNCGVDFTSYNDEQRKLSIALRFESHDIAK
DMLLRFNNTEIFGYRVEVTWFKDLKKARDRSRVLILSYQEHNLVRSSDKF
GFFNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR028851Pphln1
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: biological process
TermDefinition
GO:0045892negative regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 180..195
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 160..174
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..107
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..66
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 135..149
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..195
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..107
IPR028851Periphilin-1PANTHERPTHR15836PERIPHILIN 1coord: 219..323