Golgi phosphoprotein 3

Overview
NameGolgi phosphoprotein 3
Smed IDSMED30027683
Length (bp)1752
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgi phosphoprotein 3 (SMED30027683) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgi phosphoprotein 3 (SMED30027683) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgi phosphoprotein 3 (SMED30027683) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgi phosphoprotein 3 (SMED30027683) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027683

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027683h1SMcG0012509 SmedASXL_001613SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027683h1SMcG0012509 dd_Smed_v4_1770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027683h1SMcG0012509 Contig45455newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027683h1SMcG0012509 Contig45455uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30027683h1SMcG0012509 dd_Smed_v6_1770_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgi phosphoprotein 3 vs. Ensembl Human
Match: GOLPH3 (golgi phosphoprotein 3 [Source:HGNC Symbol;Acc:HGNC:15452])

HSP 1 Score: 309.686 bits (792), Expect = 5.417e-101
Identity = 148/221 (66.97%), Postives = 179/221 (81.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+H+KE +  E ++ WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M++R L+LI LA+ASDVLENAF PL D++Y+L+ KRVR++LD D + E LK    E++W V  +F
Sbjct:   76 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAF 296          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Human
Match: GOLPH3L (golgi phosphoprotein 3 like [Source:HGNC Symbol;Acc:HGNC:24882])

HSP 1 Score: 290.426 bits (742), Expect = 1.080e-93
Identity = 137/221 (61.99%), Postives = 175/221 (79.19%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIELA+R RI LE   MRK+ +L RKV+    +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M+KRTL+L++LA++SDVLEN F  L+DD+Y+++M R +++++ D + E  K  A E++W V  +F
Sbjct:   62 GYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLAAF 282          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Human
Match: GOLPH3L (golgi phosphoprotein 3 like [Source:HGNC Symbol;Acc:HGNC:24882])

HSP 1 Score: 265.388 bits (677), Expect = 2.698e-84
Identity = 127/186 (68.28%), Postives = 153/186 (82.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEY 829
            GYTSFWND ISSGLRG ILIELA+R RI LE   MRK+ +L RKV+    +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M+KRTL+L++LA++SDVLEN F  L+DD+Y
Sbjct:   84 GYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKY 269          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Human
Match: ING4 (inhibitor of growth family member 4 [Source:HGNC Symbol;Acc:HGNC:19423])

HSP 1 Score: 165.236 bits (417), Expect = 1.679e-46
Identity = 88/237 (37.13%), Postives = 130/237 (54.85%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDL--------------------------QQYKKKISKRIKGNSDSKYSGKVAE------------DIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F++M +LD++  ++  +I  L      +  + S  +    + +I++ +   ++  +DKV LA   YEM+DK IR LDTDL                          Q+ KK    R KG +  + + K A+             +PS+   ++  +D    +LDMPVDPNEP YCLCHQVS+GEM+ CDN +CSIEWFHF+CV LT+KP+G WFCP C
Sbjct:    6 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSD----VLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRC 238          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Human
Match: ING4 (inhibitor of growth family member 4 [Source:HGNC Symbol;Acc:HGNC:19423])

HSP 1 Score: 164.851 bits (416), Expect = 1.996e-46
Identity = 88/238 (36.97%), Postives = 130/238 (54.62%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDL---------------------------QQYKKKISKRIKGNSDSKYSGKVAE------------DIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F++M +LD++  ++  +I  L      +  + S  +    + +I++ +   ++  +DKV LA   YEM+DK IR LDTDL                           Q+ KK    R KG +  + + K A+             +PS+   ++  +D    +LDMPVDPNEP YCLCHQVS+GEM+ CDN +CSIEWFHF+CV LT+KP+G WFCP C
Sbjct:    6 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKEGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSD----VLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRC 239          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Celegans
Match: Y47G6A.18 (pep chromosome:WBcel235:I:3509698:3512735:-1 gene:WBGene00021644.1 transcript:Y47G6A.18.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.18)

HSP 1 Score: 310.842 bits (795), Expect = 3.802e-102
Identity = 149/221 (67.42%), Postives = 183/221 (82.81%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKE-NEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIEL LR RI LE  GMR++++L RKV    S PTGDV+LDEALRH+KE N  E + +WIEYLSGETWNPLKL+ QLRNVRERLAKNLVEKGV TT+KQNF+LF++TTHPL +   K KLIK+VQ++VL +W NDV +M+K+ LSLI+LA+ASDVLENAF PLSD +YE++MKRVR +LD D+D ++ K G  ++MW VFE+F
Sbjct:   59 GYTSFWNDCISSGLRGCVLIELVLRGRIQLEGGGMRRKNLLNRKVTVKSSEPTGDVILDEALRHMKETNPPETVTSWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVLTTDKQNFLLFEITTHPLSDGNQKTKLIKEVQEAVLGKWTNDVHRMDKKMLSLIVLAHASDVLENAFAPLSDQDYEVAMKRVRSLLDLDYDQQAEKKGN-DVMWAVFEAF 278          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Celegans
Match: Y47G6A.18 (pep chromosome:WBcel235:I:3508397:3512733:-1 gene:WBGene00021644.1 transcript:Y47G6A.18.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.18)

HSP 1 Score: 310.842 bits (795), Expect = 3.802e-102
Identity = 149/221 (67.42%), Postives = 183/221 (82.81%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKE-NEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIEL LR RI LE  GMR++++L RKV    S PTGDV+LDEALRH+KE N  E + +WIEYLSGETWNPLKL+ QLRNVRERLAKNLVEKGV TT+KQNF+LF++TTHPL +   K KLIK+VQ++VL +W NDV +M+K+ LSLI+LA+ASDVLENAF PLSD +YE++MKRVR +LD D+D ++ K G  ++MW VFE+F
Sbjct:   59 GYTSFWNDCISSGLRGCVLIELVLRGRIQLEGGGMRRKNLLNRKVTVKSSEPTGDVILDEALRHMKETNPPETVTSWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVLTTDKQNFLLFEITTHPLSDGNQKTKLIKEVQEAVLGKWTNDVHRMDKKMLSLIVLAHASDVLENAFAPLSDQDYEVAMKRVRSLLDLDYDQQAEKKGN-DVMWAVFEAF 278          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Celegans
Match: ing-3 (Inhibitor of growth protein [Source:UniProtKB/TrEMBL;Acc:Q9XWJ8])

HSP 1 Score: 72.0182 bits (175), Expect = 4.131e-13
Identity = 20/45 (44.44%), Postives = 33/45 (73.33%), Query Frame = 3
Query: 1575 YCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            +C C++ S+G+MV CDN++C++ WFH+ C+ +   P G W+CP C
Sbjct:  430 WCFCNEKSYGDMVQCDNRHCTLRWFHYPCIGMVEPPTGKWYCPRC 474          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Celegans
Match: Y43H11AL.1 (pep chromosome:WBcel235:II:222704:230070:-1 gene:WBGene00021545.1 transcript:Y43H11AL.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43H11AL.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.859e-9
Identity = 30/91 (32.97%), Postives = 47/91 (51.65%), Query Frame = 3
Query: 1452 SDSKYSG---KVAEDIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCH--QVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            SD+ +SG   K+ + +  M+      T    E         +  +C+C+   ++ G MV C+NKNC I+WFHF CV L + P   W+C +C
Sbjct:   80 SDTSFSGRPRKLTDRVTEMIISNRERTKKYRE---------QEEWCICNGMNINSGMMVECENKNCPIKWFHFECVGLLAAPLDEWYCTDC 161          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Celegans
Match: Y43H11AL.1 (pep chromosome:WBcel235:II:222704:223799:-1 gene:WBGene00021545.1 transcript:Y43H11AL.1e.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43H11AL.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.943e-9
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 3
Query: 1575 YCLCH--QVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            +C+C+   ++ G MV C+NKNC I+WFHF CV L + P   W+C +C
Sbjct:   18 WCICNGMNINSGMMVECENKNCPIKWFHFECVGLLAAPLDEWYCTDC 64          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Fly
Match: sau (gene:FBgn0267378 transcript:FBtr0100674)

HSP 1 Score: 316.235 bits (809), Expect = 5.541e-104
Identity = 152/221 (68.78%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIEL LR R+ +E +GMR+R +  RK+I      TGDVLLDEAL+HIKE +  E +++WIEYLSGETWNPLKL+ QL+NVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL + VVK +L+KK+QDSVL +W ND Q+M+KR L+LI LA+ASDV+ENAF PL+DD+YE++MKRVRE+LD DF+ ES K  A EI+W VF +F
Sbjct:   72 GYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAF 292          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Fly
Match: sau (gene:FBgn0267378 transcript:FBtr0077840)

HSP 1 Score: 316.235 bits (809), Expect = 5.541e-104
Identity = 152/221 (68.78%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIEL LR R+ +E +GMR+R +  RK+I      TGDVLLDEAL+HIKE +  E +++WIEYLSGETWNPLKL+ QL+NVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL + VVK +L+KK+QDSVL +W ND Q+M+KR L+LI LA+ASDV+ENAF PL+DD+YE++MKRVRE+LD DF+ ES K  A EI+W VF +F
Sbjct:   72 GYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAF 292          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Fly
Match: sau (gene:FBgn0267378 transcript:FBtr0100673)

HSP 1 Score: 316.235 bits (809), Expect = 5.541e-104
Identity = 152/221 (68.78%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIEL LR R+ +E +GMR+R +  RK+I      TGDVLLDEAL+HIKE +  E +++WIEYLSGETWNPLKL+ QL+NVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL + VVK +L+KK+QDSVL +W ND Q+M+KR L+LI LA+ASDV+ENAF PL+DD+YE++MKRVRE+LD DF+ ES K  A EI+W VF +F
Sbjct:   72 GYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAF 292          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Fly
Match: Ing5 (gene:FBgn0032516 transcript:FBtr0080525)

HSP 1 Score: 119.783 bits (299), Expect = 6.278e-30
Identity = 43/58 (74.14%), Postives = 51/58 (87.93%), Query Frame = 3
Query: 1536 EILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            +++DMPVDPNEP YCLCHQVS+GEM+ CDN +C IEWFHF+CV LT+KPKG WFCP C
Sbjct:  221 DVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKC 278          

HSP 2 Score: 67.0106 bits (162), Expect = 8.037e-12
Identity = 38/112 (33.93%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXX---XXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKR 1439
            YLE +LDGL+ +P  L++ FK+M +LD +     K I             N   S+ +       I+ LF   ++  +DKV LA   YE++DKQIR LD DL +++ +I ++
Sbjct:    6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEK 117          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Fly
Match: Ing5 (gene:FBgn0032516 transcript:FBtr0080526)

HSP 1 Score: 119.398 bits (298), Expect = 7.639e-30
Identity = 43/58 (74.14%), Postives = 51/58 (87.93%), Query Frame = 3
Query: 1536 EILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            +++DMPVDPNEP YCLCHQVS+GEM+ CDN +C IEWFHF+CV LT+KPKG WFCP C
Sbjct:  207 DVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKC 264          

HSP 2 Score: 67.0106 bits (162), Expect = 6.666e-12
Identity = 38/112 (33.93%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXX---XXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKR 1439
            YLE +LDGL+ +P  L++ FK+M +LD +     K I             N   S+ +       I+ LF   ++  +DKV LA   YE++DKQIR LD DL +++ +I ++
Sbjct:    6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEK 117          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Zebrafish
Match: golph3 (golgi phosphoprotein 3 [Source:ZFIN;Acc:ZDB-GENE-041010-209])

HSP 1 Score: 316.62 bits (810), Expect = 4.683e-104
Identity = 151/221 (68.33%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+HIK+ +  E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ+SVL +W ND  +M+KR L+LI LA++SDVLENAF PL DD+Y+L+MKRVR++LD + + ES+K+ A E++W V  +F
Sbjct:   73 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLARKVICKSDAPTGDVLLDEALKHIKDTQPPETVQSWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQESVLEKWVNDPHRMDKRLLALIFLAHSSDVLENAFAPLLDDQYDLAMKRVRQLLDLEPEGESMKNNANELLWAVVAAF 293          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Zebrafish
Match: golph3 (golgi phosphoprotein 3 [Source:ZFIN;Acc:ZDB-GENE-041010-209])

HSP 1 Score: 316.62 bits (810), Expect = 4.683e-104
Identity = 151/221 (68.33%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+HIK+ +  E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ+SVL +W ND  +M+KR L+LI LA++SDVLENAF PL DD+Y+L+MKRVR++LD + + ES+K+ A E++W V  +F
Sbjct:   73 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLARKVICKSDAPTGDVLLDEALKHIKDTQPPETVQSWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQESVLEKWVNDPHRMDKRLLALIFLAHSSDVLENAFAPLLDDQYDLAMKRVRQLLDLEPEGESMKNNANELLWAVVAAF 293          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Zebrafish
Match: si:dkey-27b3.2 (si:dkey-27b3.2 [Source:ZFIN;Acc:ZDB-GENE-091117-10])

HSP 1 Score: 311.612 bits (797), Expect = 4.984e-102
Identity = 144/221 (65.16%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELA+R R+ LEA+GMR++S+L RKV+C    PTGD+LLDEAL+H+KE +  E +++W+E LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    VKQ+L++KVQ++VL +W N+ Q+M+KR L+L+ LA++SDVLENAF PL DD+Y+L+MKRVR +LD + + E+ K GA E++W V  +F
Sbjct:   72 GYTSFWNDCISSGLRGCMLIELAIRGRLQLEASGMRRKSLLTRKVLCKSDAPTGDMLLDEALKHVKETQPPETVQSWVELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNTVKQRLVRKVQEAVLEKWVNEPQRMDKRILALLFLAHSSDVLENAFAPLLDDQYDLAMKRVRMLLDLEPEVEAAKSGANELLWAVVAAF 292          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Zebrafish
Match: si:dkey-27b3.2 (si:dkey-27b3.2 [Source:ZFIN;Acc:ZDB-GENE-091117-10])

HSP 1 Score: 311.612 bits (797), Expect = 4.984e-102
Identity = 144/221 (65.16%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELA+R R+ LEA+GMR++S+L RKV+C    PTGD+LLDEAL+H+KE +  E +++W+E LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    VKQ+L++KVQ++VL +W N+ Q+M+KR L+L+ LA++SDVLENAF PL DD+Y+L+MKRVR +LD + + E+ K GA E++W V  +F
Sbjct:   72 GYTSFWNDCISSGLRGCMLIELAIRGRLQLEASGMRRKSLLTRKVLCKSDAPTGDMLLDEALKHVKETQPPETVQSWVELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNTVKQRLVRKVQEAVLEKWVNEPQRMDKRILALLFLAHSSDVLENAFAPLLDDQYDLAMKRVRMLLDLEPEVEAAKSGANELLWAVVAAF 292          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Zebrafish
Match: golph3l (golgi phosphoprotein 3-like [Source:ZFIN;Acc:ZDB-GENE-051113-168])

HSP 1 Score: 276.944 bits (707), Expect = 1.160e-88
Identity = 132/223 (59.19%), Postives = 170/223 (76.23%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNES--LKDGACEIMWGVFESF 934
            GYTSFWNDSISSGLR C+L+EL LR RI LE  G R+R +L RKV+   + PTGDVLLDEAL+HIK  E  EN+ +WIE L+GETWNP+K+  Q+RNVRERLAK+LVEKGV TTEKQNF+LFDMTTHPL +   K++L+++VQDS+L RW ND ++++ R L+L++LA+ SDVLENA   L D+ YEL+  R R +L+ D D ES  +   A EI+W +  +F
Sbjct:   61 GYTSFWNDSISSGLRSCMLVELGLRGRIQLEPQGTRRRKLLERKVLLKSAAPTGDVLLDEALKHIKNTEPAENMASWIELLTGETWNPMKMHFQMRNVRERLAKSLVEKGVLTTEKQNFLLFDMTTHPLTDRTEKERLLQRVQDSLLDRWTNDSRRISHRMLALLLLAHVSDVLENALSSLPDECYELASTRSRTLLEADPDQESSRVSSPAEEIVWAILAAF 283          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Xenopus
Match: med22 (mediator complex subunit 22 [Source:Xenbase;Acc:XB-GENE-959336])

HSP 1 Score: 303.908 bits (777), Expect = 6.267e-99
Identity = 145/221 (65.61%), Postives = 177/221 (80.09%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND IS+GLRGC+LIELA R RI LE+ GMR++S+L RKV      PTGDV+LDEAL+HIKE+   E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W  D  +M +R L+LI LA++SDV+ENAF PL DD+Y+L+MKRVR++LD D + ES K  A EI+W V  +F
Sbjct:   68 GYTSFWNDCISAGLRGCMLIELAFRGRIALESGGMRRKSLLARKVTFKSDAPTGDVMLDEALKHIKESPTPETVQSWIELLSGETWNPLKLHFQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVKDPHRMERRLLALIYLAHSSDVIENAFAPLLDDQYDLAMKRVRQLLDLDPEVESTKPNANEILWAVVATF 288          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Xenopus
Match: pigw (phosphatidylinositol glycan anchor biosynthesis class W [Source:Xenbase;Acc:XB-GENE-976534])

HSP 1 Score: 286.96 bits (733), Expect = 1.526e-92
Identity = 134/221 (60.63%), Postives = 175/221 (79.19%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIEL LRNR+ LE + +RK+ +  RKV+    TPTGDVLLDE L+H+K  E  E +++WIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+Q+S+L +W ND  +M++RTL+L++LA++SDVLENAF  LSD++Y+++M R +E+LD D D E  K   CE++W V  +F
Sbjct:   57 GYTSFWNDCISSGLRGGILIELFLRNRVVLEPSTLRKKRLTDRKVLLKSDTPTGDVLLDETLKHMKATEPAETVQSWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVSNTTEKQRLVKKLQESLLEKWVNDPHRMDRRTLALLVLAHSSDVLENAFSSLSDEKYDMAMTRSKELLDLDPDTEGNKPNTCEMIWAVLSAF 277          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Xenopus
Match: pigw (phosphatidylinositol glycan anchor biosynthesis class W [Source:Xenbase;Acc:XB-GENE-976534])

HSP 1 Score: 248.054 bits (632), Expect = 9.220e-78
Identity = 126/220 (57.27%), Postives = 161/220 (73.18%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIEL LRNR+ LE + +RK+ +  RKV+    TPTGDVL    L H       NI  W      ETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+Q+S+L +W ND  +M++RTL+L++LA++SDVLENAF  LSD++Y+++M R +E+LD D D E  K   CE++W V  +F
Sbjct:   57 GYTSFWNDCISSGLRGGILIELFLRNRVVLEPSTLRKKRLTDRKVLLKSDTPTGDVL--PQLSH-------NI--W-----RETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVSNTTEKQRLVKKLQESLLEKWVNDPHRMDRRTLALLVLAHSSDVLENAFSSLSDEKYDMAMTRSKELLDLDPDTEGNKPNTCEMIWAVLSAF 260          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Xenopus
Match: lman1l (lectin, mannose-binding, 1 like [Source:Xenbase;Acc:XB-GENE-5754170])

HSP 1 Score: 163.696 bits (413), Expect = 4.524e-46
Identity = 83/225 (36.89%), Postives = 127/225 (56.44%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDSKYSGK------------------VAED--------IPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F++M +LD++  +  K+I  L +       +++       + KI+  +   ++  +DKV LA   YEM+DK IR LD DL +++  + ++++G+     +G+                  V+E+            V     L+    ++LDMPVDPNEP YCLCHQVS+GEM+ CDN +C IEWFHF+CV LT+KPKG WFCP C
Sbjct:    6 YLEHYLDSIENLPCELQRNFQLMSDLDQRTEDKKKEIDALASEYIAKVRDYTPEQRVQHLQKIQSAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKEKLEGSEFDSPAGRGVKKNRGQKEKRGSRGRRVSEEDTVKKKKMKGGPVYADSVLSVTPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRC 230          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Xenopus
Match: ING4 (inhibitor of growth family member 4 [Source:NCBI gene;Acc:100491241])

HSP 1 Score: 149.058 bits (375), Expect = 4.936e-40
Identity = 82/251 (32.67%), Postives = 126/251 (50.20%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDSKYSGKVAEDIPSM--------------------VALTMALTDNKDE--------------------------------ILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F++M +LD++  ++   I  L+     N  + +  +    + ++++ +   ++  +DKV LA   YEM+DK IR LDTDL +++  + ++   +SD        + IP +                     A   +   N D+                                +LDMPVDPNEP YCLCHQVS+GEM+ CDN +CSIEWFHF+CV L +KP+G WFCP C
Sbjct:   31 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKCHIDRLSCQYMSNARSMNSEEKLQLLRQVQEAYGKCKEYGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKHIESSDYDSCSSKGKKIPVLNWDNTLIILPAEGRGQKEKKAAKVRSKVKNSDDEAAKNTQKKIKLVQTAEYGAPAGNFGKVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLATKPRGKWFCPRC 281          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Mouse
Match: Golph3 (golgi phosphoprotein 3 [Source:MGI Symbol;Acc:MGI:1913879])

HSP 1 Score: 311.612 bits (797), Expect = 6.776e-102
Identity = 149/221 (67.42%), Postives = 179/221 (81.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+H+KE +  E ++ WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M+KR L+LI LA+ASDVLENAF PL D++Y+L+ KRVR++LD D + E LK    E++W V  +F
Sbjct:   76 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDKRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAF 296          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Mouse
Match: Golph3l (golgi phosphoprotein 3-like [Source:MGI Symbol;Acc:MGI:1917129])

HSP 1 Score: 285.804 bits (730), Expect = 3.385e-92
Identity = 136/221 (61.54%), Postives = 175/221 (79.19%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIELA+R RI LE   MRK+ +L RKV+    +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M++RTL+L++LA++SDVLEN F  L+DD+Y+++M R +++++ D + E  K  A E++W V  +F
Sbjct:   57 GYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLMKKLQDSVLERWVNDPQRMDRRTLALLVLAHSSDVLENVFSCLTDDKYDVAMNRTKDLVELDPEVEGTKHNATEMIWAVLAAF 277          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Mouse
Match: Golph3l (golgi phosphoprotein 3-like [Source:MGI Symbol;Acc:MGI:1917129])

HSP 1 Score: 285.804 bits (730), Expect = 3.728e-92
Identity = 136/221 (61.54%), Postives = 175/221 (79.19%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIELA+R RI LE   MRK+ +L RKV+    +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M++RTL+L++LA++SDVLEN F  L+DD+Y+++M R +++++ D + E  K  A E++W V  +F
Sbjct:   57 GYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLMKKLQDSVLERWVNDPQRMDRRTLALLVLAHSSDVLENVFSCLTDDKYDVAMNRTKDLVELDPEVEGTKHNATEMIWAVLAAF 277          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Mouse
Match: Golph3l (golgi phosphoprotein 3-like [Source:MGI Symbol;Acc:MGI:1917129])

HSP 1 Score: 286.189 bits (731), Expect = 1.631e-91
Identity = 136/221 (61.54%), Postives = 175/221 (79.19%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIELA+R RI LE   MRK+ +L RKV+    +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M++RTL+L++LA++SDVLEN F  L+DD+Y+++M R +++++ D + E  K  A E++W V  +F
Sbjct:  120 GYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLMKKLQDSVLERWVNDPQRMDRRTLALLVLAHSSDVLENVFSCLTDDKYDVAMNRTKDLVELDPEVEGTKHNATEMIWAVLAAF 340          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Mouse
Match: Golph3l (golgi phosphoprotein 3-like [Source:MGI Symbol;Acc:MGI:1917129])

HSP 1 Score: 225.328 bits (573), Expect = 9.949e-69
Identity = 106/188 (56.38%), Postives = 145/188 (77.13%), Query Frame = 2
Query:  374 GMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            G++ + VL +       +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M++RTL+L++LA++SDVLEN F  L+DD+Y+++M R +++++ D + E  K  A E++W V  +F
Sbjct:  114 GLKDKEVLLKS-----DSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLMKKLQDSVLERWVNDPQRMDRRTLALLVLAHSSDVLENVFSCLTDDKYDVAMNRTKDLVELDPEVEGTKHNATEMIWAVLAAF 296          
BLAST of Golgi phosphoprotein 3 vs. UniProt/SwissProt
Match: sp|Q9VQ93|GOLP3_DROME (Golgi phosphoprotein 3 homolog sauron OS=Drosophila melanogaster OX=7227 GN=sau PE=1 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 5.554e-103
Identity = 152/221 (68.78%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIEL LR R+ +E +GMR+R +  RK+I      TGDVLLDEAL+HIKE +  E +++WIEYLSGETWNPLKL+ QL+NVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL + VVK +L+KK+QDSVL +W ND Q+M+KR L+LI LA+ASDV+ENAF PL+DD+YE++MKRVRE+LD DF+ ES K  A EI+W VF +F
Sbjct:   72 GYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAF 292          
BLAST of Golgi phosphoprotein 3 vs. UniProt/SwissProt
Match: sp|Q9ERE4|GOLP3_RAT (Golgi phosphoprotein 3 OS=Rattus norvegicus OX=10116 GN=Golph3 PE=1 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 4.740e-101
Identity = 149/221 (67.42%), Postives = 179/221 (81.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+H+KE +  E ++ WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M+KR L+LI LA+ASDVLENAF PL D++Y+L+ KRVR++LD D + E LK    E++W V  +F
Sbjct:   76 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDKRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAF 296          
BLAST of Golgi phosphoprotein 3 vs. UniProt/SwissProt
Match: sp|Q9CRA5|GOLP3_MOUSE (Golgi phosphoprotein 3 OS=Mus musculus OX=10090 GN=Golph3 PE=1 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 4.740e-101
Identity = 149/221 (67.42%), Postives = 179/221 (81.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+H+KE +  E ++ WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M+KR L+LI LA+ASDVLENAF PL D++Y+L+ KRVR++LD D + E LK    E++W V  +F
Sbjct:   76 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDKRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAF 296          
BLAST of Golgi phosphoprotein 3 vs. UniProt/SwissProt
Match: sp|Q9H4A6|GOLP3_HUMAN (Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 2.601e-100
Identity = 148/221 (66.97%), Postives = 179/221 (81.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+H+KE +  E ++ WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M++R L+LI LA+ASDVLENAF PL D++Y+L+ KRVR++LD D + E LK    E++W V  +F
Sbjct:   76 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAF 296          
BLAST of Golgi phosphoprotein 3 vs. UniProt/SwissProt
Match: sp|A6H7F6|GLP3L_BOVIN (Golgi phosphoprotein 3-like OS=Bos taurus OX=9913 GN=GOLPH3L PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 3.716e-93
Identity = 137/221 (61.99%), Postives = 175/221 (79.19%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRG ILIELA+R RI LE   MRK+ +L RKV+    +PTGDVLLDE L+HIK  E  E ++TWIE L+GETWNP KL+ QLRNVRER+AKNLVEKG+ TTEKQNF+LFDMTTHP+  T  KQ+L+KK+QDSVL RW ND Q+M+KRTL+L++LA++SDVLEN F  L+DD+Y+++M R +++++ D + E  K  A E++W V  +F
Sbjct:   62 GYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDMAMNRAKDLVELDPEVEGTKHSATEMIWAVLAAF 282          
BLAST of Golgi phosphoprotein 3 vs. TrEMBL
Match: V4AHA1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215563 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.080e-114
Identity = 166/221 (75.11%), Postives = 190/221 (85.97%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIELALR RI LE AGMR+RS++ RKVIC   TPTGDVLLDEAL+HIKE +  E ++ WIEYLSGETWNPLKL+ QLRNVRERLAKNLVEKGVCTTEKQNF+LFDMTTHPL ++  KQ+LIKKVQDSVL RW ND  +M+KR LSLI LA+ASDVLENAF PLSDD+YE++MKRVRE+LD +FDNE++KDG  E+MW V  + 
Sbjct:   65 GYTSFWNDCISSGLRGCILIELALRGRIELEKAGMRRRSLVNRKVICKSDTPTGDVLLDEALKHIKETQPPETVQCWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVCTTEKQNFLLFDMTTHPLTDSTFKQRLIKKVQDSVLTRWTNDAHRMDKRILSLIYLAHASDVLENAFAPLSDDDYEVAMKRVRELLDLEFDNETMKDGTNELMWAVISTI 285          
BLAST of Golgi phosphoprotein 3 vs. TrEMBL
Match: A0A0L8FPW0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22011541mg PE=4 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 6.622e-114
Identity = 167/221 (75.57%), Postives = 194/221 (87.78%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIEL LR RI LE AGMR+RS+L RK+IC   TPTGDVLLDEAL+HIKE E  E+I+TWIEYLSGETWNPLKL+ QLRNVRERLAKNLVEKGVCTTEKQNF+LFDMTTHPL +T VKQK+IK+VQD+VL RW N+ Q+M+KR L+LI LA+ASDVLENAF PLSDD+YE++MKRVRE+LD +FD ES+K+G+ E+MW V  +F
Sbjct:   69 GYTSFWNDCISSGLRGCILIELGLRGRIELEKAGMRRRSLLTRKIICKSDTPTGDVLLDEALKHIKETEPSESIQTWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVCTTEKQNFLLFDMTTHPLTDTGVKQKVIKRVQDAVLSRWTNNPQRMDKRLLALIYLAHASDVLENAFAPLSDDDYEVAMKRVRELLDLEFDVESMKEGSNEMMWAVIAAF 289          
BLAST of Golgi phosphoprotein 3 vs. TrEMBL
Match: A0A210QX42 (Golgi phosphoprotein 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00476 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 7.539e-113
Identity = 163/221 (73.76%), Postives = 193/221 (87.33%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIELALR R+ LE AGMR+RS+L RK++C  S PTGDVLLDEAL+H+KE E  E +++WIEYLSGETWNPLKL+ QLRNVRERLAKNLVEKGVC+TEKQNF+LFDMTTHPL ++ VKQKLIKKVQD+VL RW ND  +M++R LSLI LA+ASDVLENAF PLSDD+YE++MKRVRE+LD DF+NES+K+G  E++W V  +F
Sbjct:   62 GYTSFWNDCISSGLRGCILIELALRGRVELEKAGMRRRSLLNRKILCRNSNPTGDVLLDEALKHVKETEPPETVQSWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVCSTEKQNFLLFDMTTHPLTDSGVKQKLIKKVQDAVLSRWTNDAHRMDRRLLSLIYLAHASDVLENAFAPLSDDDYEIAMKRVRELLDLDFENESMKEGTNELVWAVIAAF 282          
BLAST of Golgi phosphoprotein 3 vs. TrEMBL
Match: A0A1S3HAG7 (Golgi phosphoprotein 3 OS=Lingula unguis OX=7574 GN=LOC106153574 PE=4 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 1.231e-112
Identity = 165/221 (74.66%), Postives = 191/221 (86.43%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKE-NEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIELALR RI LE  GMR+RS+  RKVI    TPTGDVLLDEAL+HIKE N  EN+++WIEYLSGETWNPLKLK QLRNVRERLAKNLVEKGVC+TEKQNF+LFDMTTHPL ++V+KQKLIK+VQDSVL RW ND Q+M+KR LSLI LA++SDVLENAF PLSDD+YE++MKRVR++LD DF+ ES+ +G  E+MW V  +F
Sbjct:   69 GYTSFWNDCISSGLRGCILIELALRGRIQLEQTGMRRRSLGTRKVIYKSDTPTGDVLLDEALKHIKETNPPENVQSWIEYLSGETWNPLKLKYQLRNVRERLAKNLVEKGVCSTEKQNFLLFDMTTHPLTDSVIKQKLIKRVQDSVLSRWTNDPQRMDKRVLSLIYLAHSSDVLENAFAPLSDDDYEVAMKRVRDLLDLDFEKESMNEGTNELMWAVISAF 289          
BLAST of Golgi phosphoprotein 3 vs. TrEMBL
Match: A0A0B7AF67 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF116748 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 2.163e-112
Identity = 164/221 (74.21%), Postives = 190/221 (85.97%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGCILIEL+LR R+ LE AGMR+RS+  RKVIC   TPTGDVLLDEALRHIKE +  E ++TWIEYLSGETWNPLKL+ QLRNVRERLAKNLVEKGVCTTEKQNF+LFDMTTHPL + VVKQKLIK+VQDSVL RW ND  +M++R LSLI LA++SDVLENAF PLSD++YE++MKRVRE+LD DFD ES+K+G  E++W V  + 
Sbjct:  102 GYTSFWNDCISSGLRGCILIELSLRGRVELEKAGMRRRSLANRKVICKSDTPTGDVLLDEALRHIKETQPPETVQTWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVCTTEKQNFLLFDMTTHPLTDNVVKQKLIKRVQDSVLSRWTNDAHRMDRRMLSLIYLAHSSDVLENAFAPLSDEDYEVAMKRVRELLDLDFDTESMKEGTNELLWAVLSAI 322          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Cavefish
Match: golph3 (golgi phosphoprotein 3 [Source:NCBI gene;Acc:103022463])

HSP 1 Score: 317.775 bits (813), Expect = 1.430e-104
Identity = 151/221 (68.33%), Postives = 184/221 (83.26%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++S+L RKVIC    PTGDVLLDEAL+HIKE +  E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M+KR L+LI LA++SDVLENAF PL DD+Y+L+MKRVR++LD + + ES+K+ A E++W V  +F
Sbjct:   68 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLARKVICKSDAPTGDVLLDEALKHIKETQPPETVQSWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLEKWVNDPHRMDKRLLALIFLAHSSDVLENAFAPLLDDQYDLAMKRVRQLLDLEPEGESMKNNANELLWAVVAAF 288          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Cavefish
Match: si:dkey-27b3.2 (Golgi phosphoprotein 3-like [Source:NCBI gene;Acc:103021521])

HSP 1 Score: 310.842 bits (795), Expect = 8.054e-102
Identity = 147/221 (66.52%), Postives = 181/221 (81.90%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LE  GMR++S+L RKVIC    PTGD+LLDEAL+H+KE +  E ++ WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL  + VKQ+L+KKVQ+ VL RW N+ Q+M+KR L+L+ LA++SDVLENAF PL DD+Y+L+MKRVR +LD D + E+ + G+ E++W V  +F
Sbjct:   71 GYTSFWNDCISSGLRGCMLIELALRGRLQLEPCGMRRKSLLTRKVICKSEAPTGDMLLDEALKHVKETQPPETVQGWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNSPVKQRLVKKVQEGVLERWVNEPQRMDKRLLALLFLAHSSDVLENAFAPLLDDQYDLAMKRVRLLLDLDPEFEASRSGSNELLWAVVAAF 291          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Cavefish
Match: golph3l (Golgi phosphoprotein 3-like [Source:NCBI gene;Acc:103045716])

HSP 1 Score: 243.432 bits (620), Expect = 2.983e-76
Identity = 116/222 (52.25%), Postives = 157/222 (70.72%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLK--DGACEIMWGVFES 931
            GYTSFWND ISS LRG +L+ELALR RI L+   MR++ +L RKV+     PTGD LLDEAL+HIK  +  E + +WI+ L+GETWNP+K+  QL  VRERLAK+LVEKGV TT+KQNF LFDMTTHPL     K++L++K+Q S+L RW ND  ++ +RTL+L++LA+  DVLE A   L D +Y  + +R R++L+ + +  S K  +   EI+W V  +
Sbjct:   30 GYTSFWNDCISSALRGAMLVELALRGRIHLQPQSMRRKPLLERKVMVKSDAPTGDTLLDEALKHIKNTQPAETVSSWIDLLTGETWNPMKMHFQLPQVRERLAKSLVEKGVLTTDKQNFFLFDMTTHPLANEKEKERLLQKLQASLLDRWTNDPHRLPRRTLALLVLAHGGDVLEKALAALPDAQYVTAGQRARDMLETNANQHSGKATNPTEEIIWAVLAA 251          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Cavefish
Match: golph3l (Golgi phosphoprotein 3-like [Source:NCBI gene;Acc:103045716])

HSP 1 Score: 241.121 bits (614), Expect = 1.050e-75
Identity = 116/222 (52.25%), Postives = 157/222 (70.72%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLK--DGACEIMWGVFES 931
            GYTSFWND ISS LRG +L+ELALR RI L+   MR++ +L RKV+     PTGD LLDEAL+HIK  +  E + +WI+ L+GETWNP+K+  QL  VRERLAK+LVEKGV TT+KQNF LFDMTTHPL     K++L++K+Q S+L RW ND  ++ +RTL+L++LA+  DVLE A   L D +Y  + +R R++L+ + +  S K  +   EI+W V  +
Sbjct:   10 GYTSFWNDCISSALRGAMLVELALRGRIHLQPQSMRRKPLLERKVMVKSDAPTGDTLLDEALKHIKNTQPAETVSSWIDLLTGETWNPMKMHFQLPQVRERLAKSLVEKGVLTTDKQNFFLFDMTTHPLANEKEKERLLQKLQASLLDRWTNDPHRLPRRTLALLVLAHGGDVLEKALAALPDAQYVTAGQRARDMLETNANQHSGKATNPTEEIIWAVLAA 231          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Cavefish
Match: ing5a (inhibitor of growth family member 5 [Source:NCBI gene;Acc:103024432])

HSP 1 Score: 160.229 bits (404), Expect = 5.631e-45
Identity = 88/229 (38.43%), Postives = 119/229 (51.97%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQY---------------------KKKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTD---------NKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F +M ELD +  E   +I  L      N  N +       + KI+  +   ++  +DKV LA   YEM+DK IR LD DL ++                     KK   + +K     K  G+   D  S     M  ++         +  ++LDMPVDPNEP YCLCHQVS+GEM+ CDN +C IEWFHF+CV LT+KPKG WFCP C
Sbjct:    6 YLEHYLDSIENLPCELQRNFTLMRELDNRTEEKKGEIDKLAEEYIKNVRNLASEQRVEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLDVGGYESPDTRALKKGGGRGLKEKRGPKGRGRKCSDDDSPRKKKMKNSNEFSDSLLPVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRC 234          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006357.1 (pep scaffold:Pmarinus_7.0:GL481472:15732:17990:1 gene:ENSPMAG00000005747.1 transcript:ENSPMAT00000006357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 1.202e-33
Identity = 57/83 (68.67%), Postives = 67/83 (80.72%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKE-NEGENIKTWIEYLSG 520
            GYTSFWND ISSGLRGC+L+ELALR RI LE  GMR++S+L RKV+C    PTGDVLLDEAL+HIKE    E ++TW+E LSG
Sbjct:   20 GYTSFWNDCISSGLRGCMLVELALRGRITLEPCGMRRKSLLSRKVMCKSDAPTGDVLLDEALKHIKETTPQETVQTWVELLSG 102          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008794.1 (pep scaffold:Pmarinus_7.0:GL476329:1735629:1740570:1 gene:ENSPMAG00000007965.1 transcript:ENSPMAT00000008794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 1.237e-25
Identity = 38/54 (70.37%), Postives = 46/54 (85.19%), Query Frame = 3
Query: 1554 VDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRG 1715
            VDP+EP YCLC+QVS+G+M+ CDN+ C+IEWFHF CV L+ KPKG WFCP CRG
Sbjct:   54 VDPDEPTYCLCNQVSYGDMIGCDNEACAIEWFHFGCVGLSHKPKGKWFCPRCRG 107          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000234.1 (pep scaffold:Pmarinus_7.0:GL482739:14:2848:1 gene:ENSPMAG00000000213.1 transcript:ENSPMAT00000000234.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.815e-24
Identity = 40/73 (54.79%), Postives = 49/73 (67.12%), Query Frame = 3
Query: 1491 PSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            P MV     L+D     +D   DPNEP YC+C+QVS+GEMV CDN++C IEWFH+ CV L   PKG W+CP C
Sbjct:   62 PDMVIADAELSDQ----VDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLKEAPKGKWYCPQC 130          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Yeast
Match: VPS74 (Golgi phosphatidylinositol-4-kinase effector and PtdIns4P sensor; interacts with the cytosolic domains of cis and medial glycosyltransferases, and in the PtdIns4P-bound state mediates the targeting of these enzymes to the Golgi; interacts with the catalytic domain of Sac1p, the major cellular PtdIns4P phosphatase, to direct dephosphosphorylation of the Golgi pool of PtdIns4P; tetramerization required for function; ortholog of human GOLPH3/GPP34/GMx33 [Source:SGD;Acc:S000002780])

HSP 1 Score: 167.162 bits (422), Expect = 3.163e-47
Identity = 101/256 (39.45%), Postives = 143/256 (55.86%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVI-CIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHR-----WNNDVQKMNK----RTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDK--------------------------DFDNESLKDGACEIMWGVFESF 934
            GY SFWNDSIS  LRGCI+IELALR +I +     RKR  L  ++I  I S+ TG+VLLDE L+ +K +E  +I  WI+ LSGETWN LK+  QL+ VRERLAK LV+KGV  TE +NF LFDM THP+ +   K+ + ++V   ++ R     +N    +       RTL+LI  +Y ++VLEN    L  ++ + ++ R  E++ +                          + +N    D   E++ GVFE F
Sbjct:   83 GYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVF 338          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Yeast
Match: YNG2 (Subunit of NuA4, an essential histone acetyltransferase complex; positions Piccolo NuA4 for efficient acetylation of histone H4 or histone H2A; relocalizes to the cytosol in response to hypoxia; similar to human tumor suppressor ING1 and its isoforms ING4 and ING5 [Source:SGD;Acc:S000001132])

HSP 1 Score: 83.1889 bits (204), Expect = 4.142e-18
Identity = 29/47 (61.70%), Postives = 35/47 (74.47%), Query Frame = 3
Query: 1572 VYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCR 1712
            +YC C +VSFGEMVACD  NC  EWFH+ CV+L   PKG W+CP C+
Sbjct:  223 LYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECK 269          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Yeast
Match: PHO23 (Component of the Rpd3L histone deacetylase complex; involved in transcriptional regulation of PHO5; affects termination of snoRNAs and cryptic unstable transcripts (CUTs); C-terminus shares significant sequence identity with the human candidate tumor suppressor p33-ING1 and its isoform ING3 [Source:SGD;Acc:S000005041])

HSP 1 Score: 81.6481 bits (200), Expect = 1.971e-17
Identity = 31/84 (36.90%), Postives = 49/84 (58.33%), Query Frame = 3
Query: 1467 SGKVAEDIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRGK 1718
            +G++     S    ++  ++N         D  EP+YC C+QV++GEMV CD  +C +EWFH  C+ L + PKG W+C +C+ K
Sbjct:  246 NGRIGTSTASRGVSSVGNSNNSRISRPKTNDYGEPLYCYCNQVAYGEMVGCDGADCELEWFHLPCIGLETLPKGKWYCDDCKKK 329          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Yeast
Match: YNG1 (Subunit of the NuA3 histone acetyltransferase complex; this complex acetylates histone H3; contains PHD finger domain that interacts with methylated histone H3; shares significant sequence identity with the human candidate tumor suppressor p33-ING1 in C-terminal region [Source:SGD;Acc:S000005590])

HSP 1 Score: 73.9442 bits (180), Expect = 1.991e-15
Identity = 27/45 (60.00%), Postives = 30/45 (66.67%), Query Frame = 3
Query: 1566 EPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFC 1700
            E VYC C  VS+G MVACDN  C  EWFH+ CV L   PKG W+C
Sbjct:  154 EEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYC 198          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Nematostella
Match: EDO45623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE7])

HSP 1 Score: 322.398 bits (825), Expect = 6.544e-107
Identity = 152/221 (68.78%), Postives = 187/221 (84.62%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC++IEL LR RI LE  GMR+RS+L RKV+C    PTGDVLLDEALRH+KE++  + ++ WIE LSGETWNPLKL+ QLRNVRERLAKNLVEKG+ TTEKQNF+LFDMTTHP+V++ +KQK+++KVQD+VL +W ND Q+++KRTLSLI LA++SDVLENAF PLSDD+YEL+MKRVRE+LD D + E+ K G  E+MW V  +F
Sbjct:   62 GYTSFWNDCISSGLRGCMVIELGLRGRIELEKTGMRRRSLLNRKVVCKSDNPTGDVLLDEALRHMKESDPPDTVQNWIELLSGETWNPLKLRYQLRNVRERLAKNLVEKGILTTEKQNFLLFDMTTHPVVDSTMKQKVVRKVQDAVLSKWVNDTQRIDKRTLSLIYLAHSSDVLENAFAPLSDDDYELAMKRVRELLDVDPEIEAQKPGTNEVMWCVVAAF 282          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Nematostella
Match: EDO37532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFP0])

HSP 1 Score: 123.25 bits (308), Expect = 1.105e-32
Identity = 67/199 (33.67%), Postives = 98/199 (49.25%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YL+ +LDG++ +P  LQ+ F +M ELD++  ++ K+I  +++               + + KIE  F   ++  +DKV LA   YEM+DK IR LD DL                +++   + E+      L+           D   DP  P       VS+GEM+ CDN  C IEWFHF CV L +KPKG W+CP C
Sbjct:    6 YLDHYLDGIETLPFELQRNFTLMKELDQRAQDLLKEIDNMSDKYVAEVRKMDALQRTDHLKKIENAFSKSKEYVDDKVQLAMQTYEMVDKHIRKLDHDL----------------ARFEADLKEERAKEAGLSS----------DYENDPTPP-----KNVSYGEMIGCDNMECPIEWFHFPCVGLVAKPKGKWYCPKC 173          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Nematostella
Match: EDO43857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXJ4])

HSP 1 Score: 111.694 bits (278), Expect = 9.451e-28
Identity = 65/243 (26.75%), Postives = 122/243 (50.21%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQ----------QYKKKI-----------------SKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDEIL-----------------DMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            Y+E +L+ ++ +P  +Q+    M ELD    +  K+I+ L ++   +    S+      + +I++  +  ++  ++K+ L  ++ ++ID + R ++ D++          Q+ + +                 S++ K N   + + K   D+ ++ +++    D +  +                  ++P+DPNEP YCLC+QVSFGEM+ CDN+ C IEWFHF CV L+ KPKG W+CP C
Sbjct:   12 YVEGYLEYIESLPDDMQRSLSQMRELDLHYQDRLKEIERLLHSYNRDKDPISR---RKWLIQIQRRLVKSQEYGDEKLQLVAHMVDVIDNKSRQIEVDMENLDTFRNDDTQFAQLVKQESSSMPTDEIVPPTKSEKTKRNRRQRNNDKA--DLDTVGSVSTGGGDQQKPVKKKAKTSRKKKTQDSPTHNIPIDPNEPTYCLCNQVSFGEMIGCDNEECQIEWFHFQCVGLSHKPKGKWYCPRC 249          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Nematostella
Match: EDO40594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6P9])

HSP 1 Score: 92.4337 bits (228), Expect = 3.605e-23
Identity = 37/55 (67.27%), Postives = 42/55 (76.36%), Query Frame = 3
Query: 1545 DMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            D   DPNEP YCLC+QVS+GEMV CDN +C IEWFH+ CV LT  PKG W+CP C
Sbjct:    3 DWVYDPNEPRYCLCNQVSYGEMVGCDNNDCPIEWFHYGCVGLTDAPKGKWYCPQC 57          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Nematostella
Match: EDO35780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKJ2])

HSP 1 Score: 62.7734 bits (151), Expect = 7.193e-13
Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 1575 YCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRGK 1718
            YCLC Q   GEM+ACD+ +C I WFH  C+ +T+ P G W C   +G+
Sbjct:    1 YCLCGQGESGEMIACDSPSCPIVWFHMDCIGMTTAPDGEWLCRVSKGQ 48          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Medaka
Match: GOLPH3 (Golgi phosphoprotein 3 [Source:NCBI gene;Acc:101166973])

HSP 1 Score: 313.538 bits (802), Expect = 7.156e-103
Identity = 149/221 (67.42%), Postives = 179/221 (81.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEG-ENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+L+ELALR R+ LE  G+R++S+L RKVIC    PTGDVLLDEAL+HIKE +  E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL  + +KQ+LIKKVQDSVL +W ND  +M+KR LSLI+LA++SDVLENAF PL DD+Y+L MKRV  +L+ + + ES K    E+MW V  +F
Sbjct:   71 GYTSFWNDCISSGLRGCMLVELALRGRLHLEPCGVRRKSLLARKVICKSDAPTGDVLLDEALKHIKETQPPETVQSWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNSTIKQRLIKKVQDSVLDKWVNDPHRMDKRVLSLILLAHSSDVLENAFAPLQDDQYDLCMKRVHSLLELEPEKESTKPNVNELMWAVVAAF 291          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Medaka
Match: golph3 (golgi phosphoprotein 3 [Source:NCBI gene;Acc:101173713])

HSP 1 Score: 312.383 bits (799), Expect = 2.220e-102
Identity = 149/221 (67.42%), Postives = 180/221 (81.45%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++ +L RKVIC    PTGDVLLDEAL+HIK+ +  E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M+KR L+LI LA++SDVLENAF PL DD+YEL+MKRVR++L+   + ES K  A E++W V  +F
Sbjct:   70 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKGLLARKVICKSDAPTGDVLLDEALKHIKDTQPAETVQSWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNGNIKQRLIKKVQEAVLDKWVNDPNRMDKRLLALIFLAHSSDVLENAFAPLLDDQYELAMKRVRQLLELQPEGESAKPNANELLWAVIAAF 290          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Medaka
Match: golph3 (golgi phosphoprotein 3 [Source:NCBI gene;Acc:101173713])

HSP 1 Score: 311.997 bits (798), Expect = 8.235e-102
Identity = 149/221 (67.42%), Postives = 180/221 (81.45%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENE-GENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESF 934
            GYTSFWND ISSGLRGC+LIELALR R+ LEA GMR++ +L RKVIC    PTGDVLLDEAL+HIK+ +  E +++WIE LSGETWNPLKL  QLRNVRERLAKNLVEKGV TTEKQNF+LFDMTTHPL    +KQ+LIKKVQ++VL +W ND  +M+KR L+LI LA++SDVLENAF PL DD+YEL+MKRVR++L+   + ES K  A E++W V  +F
Sbjct:  101 GYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKGLLARKVICKSDAPTGDVLLDEALKHIKDTQPAETVQSWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNGNIKQRLIKKVQEAVLDKWVNDPNRMDKRLLALIFLAHSSDVLENAFAPLLDDQYELAMKRVRQLLELQPEGESAKPNANELLWAVIAAF 321          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Medaka
Match: ing5a (inhibitor of growth family member 5 [Source:NCBI gene;Acc:101171565])

HSP 1 Score: 161.77 bits (408), Expect = 1.263e-45
Identity = 88/229 (38.43%), Postives = 126/229 (55.02%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRI--------------KGNS-------DSKYSGKVAEDIPS----MVALTMALTD-----NKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F +M +LD +  E   +I  L      N  N +       + KI+  +   ++  +DKV LA   YEM+DK IR LD DL +++ ++ +++              KG+S        S+  GK   D  S     + ++  L+D        ++LDMPVDPNEP YCLCHQVS+GEM+ CDN +C IEWFHF+CV L +KPKG WFCP C
Sbjct:    6 YLEHYLDSIENLPCELQRNFTLMRDLDSRTEEKKGEIDRLAEEYISNVKNLASEQRVEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLELTGYDSTDSRTLKKGDSRGQRDKRGSRGRGKKGSDDDSPKKKKMKISQDLSDALLPMQPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLATKPKGKWFCPRC 234          
BLAST of Golgi phosphoprotein 3 vs. Ensembl Medaka
Match: ing4 (inhibitor of growth family member 4 [Source:NCBI gene;Acc:105355951])

HSP 1 Score: 157.532 bits (397), Expect = 6.610e-44
Identity = 86/237 (36.29%), Postives = 123/237 (51.90%), Query Frame = 3
Query: 1113 YLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYK-----KKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDE---------------------------------ILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNC 1709
            YLE +LD ++ +P  LQ+ F +M +LD++  ++  +I  L      N    S     + + +I++ +   ++  +DKV LA   YEM+DK IR LDTDL +++     K+I      ++ SK            VA T +   + DE                                 +LDMPVDPNEP YCLCHQVS+GEM+ CDN  CSIEWFHF+CV LT+KP+G W+CP C
Sbjct:    6 YLEHYLDSIENLPFELQRNFNLMRDLDQRTEDLKGQIDSLAKEYTANARTLSSEQKLSILRQIQQSYSKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESTDYDSTSSKGKKGDTRQKEKKVAKTRSKVKSSDEDGSPKSAQKKVKLLQPGEFNSPSSNFGNVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNTECSIEWFHFACVGLTTKPRGKWYCPRC 242          
BLAST of Golgi phosphoprotein 3 vs. Planmine SMEST
Match: SMESG000073542.1 (SMESG000073542.1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.019e-159
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESFRN 940
            GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESFRN
Sbjct:   60 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVKQKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDEYELSMKRVREVLDKDFDNESLKDGACEIMWGVFESFRN 281          

HSP 2 Score: 91.6633 bits (226), Expect = 2.938e-20
Identity = 59/65 (90.77%), Postives = 61/65 (93.85%), Query Frame = 1
Query:   55 MEEGVVQRRKINISEEKSISETENKTCDDYSNDMDENDSKDTRXXXXXXXXXXXXKDREVFNCIF 249
            MEEGVVQRRKINISEEKSISETENKTCDDYSNDMDENDSKDTRLTLMEEILLLGLKDRE +   +
Sbjct:    1 MEEGVVQRRKINISEEKSISETENKTCDDYSNDMDENDSKDTRLTLMEEILLLGLKDREGYTSFW 65          
BLAST of Golgi phosphoprotein 3 vs. Planmine SMEST
Match: SMESG000073543.1 (SMESG000073543.1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.098e-134
Identity = 204/204 (100.00%), Postives = 204/204 (100.00%), Query Frame = 3
Query: 1107 MEYLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRGK 1718
            MEYLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQILTNNLFINNLNFSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRGK
Sbjct:    1 MEYLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQILTNNLFINNLNFSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRGK 204          
BLAST of Golgi phosphoprotein 3 vs. Planmine SMEST
Match: SMESG000073542.1 (SMESG000073542.1)

HSP 1 Score: 225.713 bits (574), Expect = 9.751e-80
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 2
Query:  275 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKG 601
            GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKG
Sbjct:   60 GYTSFWNDSISSGLRGCILIELALRNRIGLEAAGMRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGETWNPLKLKLQLRNVRERLAKNLVEKG 168          

HSP 2 Score: 91.6633 bits (226), Expect = 9.751e-80
Identity = 59/65 (90.77%), Postives = 61/65 (93.85%), Query Frame = 1
Query:   55 MEEGVVQRRKINISEEKSISETENKTCDDYSNDMDENDSKDTRXXXXXXXXXXXXKDREVFNCIF 249
            MEEGVVQRRKINISEEKSISETENKTCDDYSNDMDENDSKDTRLTLMEEILLLGLKDRE +   +
Sbjct:    1 MEEGVVQRRKINISEEKSISETENKTCDDYSNDMDENDSKDTRLTLMEEILLLGLKDREGYTSFW 65          
BLAST of Golgi phosphoprotein 3 vs. Planmine SMEST
Match: SMESG000007903.1 (SMESG000007903.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.862e-35
Identity = 77/265 (29.06%), Postives = 123/265 (46.42%), Query Frame = 3
Query: 1095 LNSKMEYLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQXXXXXXXXXXXXXSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTDLQQYKKKISKRIKGNSDS---------------------------------------------------KYSGKVAEDIPSMVAL------TMALTDNKDEILDMPVDPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCRGK 1718
            +N    YLE FL+ L  +P  L ++F  + +LD+K+    KKIQ        + ++       ++  +I      G+  C++K  +   IY+ +D  IR LD+D  +++ ++   +   S++                                                   KY  K+     S + +       + LT+N +E+L+MP DP EPVYC CH VS+G+M+ CDN +C IEWFHF+CV +T KPKG+W+CP CR K
Sbjct:    2 INVSETYLELFLENLGNLPDDLHEQFTKIKDLDEKVSSTCKKIQQQQREYLHSVVSK----RPDKSKQIRNQMKQGKSDCDEKFRIINEIYDSVDNCIRRLDSDFSRFESELKGGLDNISENECLSKIKSPKIIQKKKANKKKSNPTRNIHVKKPSLLHLKSTSNLKLIRPQKKYRKKIKLGAESHIGIPASASLVLTLTNNPNEVLEMPTDPYEPVYCDCHDVSYGDMIGCDNIDCPIEWFHFACVGITDKPKGLWYCPRCRPK 262          
BLAST of Golgi phosphoprotein 3 vs. Planmine SMEST
Match: SMESG000015211.1 (SMESG000015211.1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.045e-15
Identity = 27/47 (57.45%), Postives = 38/47 (80.85%), Query Frame = 3
Query: 1572 VYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCR 1712
            VYC+C++ S+G+M+ACD+  C IEWFH+ CV +T+ PKG WFCP C+
Sbjct:  256 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 302          
The following BLAST results are available for this feature:
BLAST of Golgi phosphoprotein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GOLPH35.417e-10166.97golgi phosphoprotein 3 [Source:HGNC Symbol;Acc:HGN... [more]
GOLPH3L1.080e-9361.99golgi phosphoprotein 3 like [Source:HGNC Symbol;Ac... [more]
GOLPH3L2.698e-8468.28golgi phosphoprotein 3 like [Source:HGNC Symbol;Ac... [more]
ING41.679e-4637.13inhibitor of growth family member 4 [Source:HGNC S... [more]
ING41.996e-4636.97inhibitor of growth family member 4 [Source:HGNC S... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y47G6A.183.802e-10267.42pep chromosome:WBcel235:I:3509698:3512735:-1 gene:... [more]
Y47G6A.183.802e-10267.42pep chromosome:WBcel235:I:3508397:3512733:-1 gene:... [more]
ing-34.131e-1344.44Inhibitor of growth protein [Source:UniProtKB/TrE... [more]
Y43H11AL.11.859e-932.97pep chromosome:WBcel235:II:222704:230070:-1 gene:W... [more]
Y43H11AL.11.943e-946.81pep chromosome:WBcel235:II:222704:223799:-1 gene:W... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sau5.541e-10468.78gene:FBgn0267378 transcript:FBtr0100674[more]
sau5.541e-10468.78gene:FBgn0267378 transcript:FBtr0077840[more]
sau5.541e-10468.78gene:FBgn0267378 transcript:FBtr0100673[more]
Ing56.278e-3074.14gene:FBgn0032516 transcript:FBtr0080525[more]
Ing57.639e-3074.14gene:FBgn0032516 transcript:FBtr0080526[more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
golph34.683e-10468.33golgi phosphoprotein 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
golph34.683e-10468.33golgi phosphoprotein 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
si:dkey-27b3.24.984e-10265.16si:dkey-27b3.2 [Source:ZFIN;Acc:ZDB-GENE-091117-10... [more]
si:dkey-27b3.24.984e-10265.16si:dkey-27b3.2 [Source:ZFIN;Acc:ZDB-GENE-091117-10... [more]
golph3l1.160e-8859.19golgi phosphoprotein 3-like [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
med226.267e-9965.61mediator complex subunit 22 [Source:Xenbase;Acc:XB... [more]
pigw1.526e-9260.63phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigw9.220e-7857.27phosphatidylinositol glycan anchor biosynthesis cl... [more]
lman1l4.524e-4636.89lectin, mannose-binding, 1 like [Source:Xenbase;Ac... [more]
ING44.936e-4032.67inhibitor of growth family member 4 [Source:NCBI g... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Golph36.776e-10267.42golgi phosphoprotein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Golph3l3.385e-9261.54golgi phosphoprotein 3-like [Source:MGI Symbol;Acc... [more]
Golph3l3.728e-9261.54golgi phosphoprotein 3-like [Source:MGI Symbol;Acc... [more]
Golph3l1.631e-9161.54golgi phosphoprotein 3-like [Source:MGI Symbol;Acc... [more]
Golph3l9.949e-6956.38golgi phosphoprotein 3-like [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VQ93|GOLP3_DROME5.554e-10368.78Golgi phosphoprotein 3 homolog sauron OS=Drosophil... [more]
sp|Q9ERE4|GOLP3_RAT4.740e-10167.42Golgi phosphoprotein 3 OS=Rattus norvegicus OX=101... [more]
sp|Q9CRA5|GOLP3_MOUSE4.740e-10167.42Golgi phosphoprotein 3 OS=Mus musculus OX=10090 GN... [more]
sp|Q9H4A6|GOLP3_HUMAN2.601e-10066.97Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=... [more]
sp|A6H7F6|GLP3L_BOVIN3.716e-9361.99Golgi phosphoprotein 3-like OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AHA14.080e-11475.11Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0L8FPW06.622e-11475.57Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A210QX427.539e-11373.76Golgi phosphoprotein 3 OS=Mizuhopecten yessoensis ... [more]
A0A1S3HAG71.231e-11274.66Golgi phosphoprotein 3 OS=Lingula unguis OX=7574 G... [more]
A0A0B7AF672.163e-11274.21Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
golph31.430e-10468.33golgi phosphoprotein 3 [Source:NCBI gene;Acc:10302... [more]
si:dkey-27b3.28.054e-10266.52Golgi phosphoprotein 3-like [Source:NCBI gene;Acc:... [more]
golph3l2.983e-7652.25Golgi phosphoprotein 3-like [Source:NCBI gene;Acc:... [more]
golph3l1.050e-7552.25Golgi phosphoprotein 3-like [Source:NCBI gene;Acc:... [more]
ing5a5.631e-4538.43inhibitor of growth family member 5 [Source:NCBI g... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006357.11.202e-3368.67pep scaffold:Pmarinus_7.0:GL481472:15732:17990:1 g... [more]
ENSPMAT00000008794.11.237e-2570.37pep scaffold:Pmarinus_7.0:GL476329:1735629:1740570... [more]
ENSPMAT00000000234.12.815e-2454.79pep scaffold:Pmarinus_7.0:GL482739:14:2848:1 gene:... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
VPS743.163e-4739.45Golgi phosphatidylinositol-4-kinase effector and P... [more]
YNG24.142e-1861.70Subunit of NuA4, an essential histone acetyltransf... [more]
PHO231.971e-1736.90Component of the Rpd3L histone deacetylase complex... [more]
YNG11.991e-1560.00Subunit of the NuA3 histone acetyltransferase comp... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456236.544e-10768.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375321.105e-3233.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438579.451e-2826.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405943.605e-2367.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357807.193e-1347.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GOLPH37.156e-10367.42Golgi phosphoprotein 3 [Source:NCBI gene;Acc:10116... [more]
golph32.220e-10267.42golgi phosphoprotein 3 [Source:NCBI gene;Acc:10117... [more]
golph38.235e-10267.42golgi phosphoprotein 3 [Source:NCBI gene;Acc:10117... [more]
ing5a1.263e-4538.43inhibitor of growth family member 5 [Source:NCBI g... [more]
ing46.610e-4436.29inhibitor of growth family member 4 [Source:NCBI g... [more]
back to top
BLAST of Golgi phosphoprotein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073542.11.019e-159100.00SMESG000073542.1[more]
SMESG000073543.11.098e-134100.00SMESG000073543.1[more]
SMESG000073542.19.751e-80100.00SMESG000073542.1[more]
SMESG000007903.11.862e-3529.06SMESG000007903.1[more]
SMESG000015211.17.045e-1557.45SMESG000015211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027683 ID=SMED30027683|Name=Golgi phosphoprotein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1752bp
AAATAAACTATGGTAATTTTAAATTTTTAGTAAATATTTAGTTTTTAAAT
TAGTATGGAGGAAGGTGTAGTTCAAAGAAGAAAAATTAATATTTCAGAGG
AAAAATCTATATCAGAAACTGAAAATAAGACTTGTGATGATTATTCTAAT
GATATGGATGAAAACGATTCTAAAGACACTCGATTAACACTAATGGAAGA
AATTTTACTCTTAGGGTTGAAAGACAGAGAAGTTTTTAATTGTATATTTA
GAACATTTAATTTTTGTGTCCTAGGGTTATACATCATTTTGGAATGATTC
AATAAGCAGCGGATTAAGAGGTTGTATATTAATTGAATTAGCTCTTAGAA
ATAGAATTGGACTTGAAGCCGCTGGAATGCGAAAGCGATCCGTTCTTTTT
CGTAAAGTCATATGCATTAAGTCCACTCCCACAGGTGATGTTTTATTAGA
TGAAGCTTTAAGACACATAAAAGAAAATGAAGGGGAGAATATTAAAACAT
GGATCGAATATCTCAGTGGCGAAACTTGGAATCCTTTAAAGCTCAAGCTG
CAATTACGAAATGTCAGAGAGAGATTGGCAAAAAATTTAGTAGAGAAAGG
AGTATGTACTACCGAGAAACAAAATTTTGTTTTATTTGATATGACCACAC
ATCCTTTAGTAGAAACAGTTGTGAAGCAAAAACTGATAAAAAAAGTGCAG
GATAGCGTTTTACATCGGTGGAATAACGATGTTCAGAAAATGAATAAAAG
AACTTTGTCATTGATTATGTTGGCATATGCTTCAGATGTTTTAGAAAATG
CTTTTGGTCCTCTTTCAGATGATGAATATGAATTATCTATGAAAAGAGTT
CGGGAGGTGTTAGATAAGGATTTTGATAATGAAAGTCTAAAAGATGGAGC
TTGTGAAATAATGTGGGGAGTATTCGAATCTTTTAGAAATTAATGTTGTG
CCTAATAATTCAAAAGTGATAATAATTACGGGTGTAAATGCCATGATTTA
TTTTTACAATAATTTATTAGGTTATGGAGATGTGATTGTAATACAATGAT
TCTTTAATTTTAATTGCATTATTTTGTTTAAATAATATTACAATTTAAAT
TCTAAAATGGAGTATCTTGAGAAATTTCTTGATGGTCTAGATTATGTTCC
ACCGCATCTTCAGCAAAAATTTAAAGTAATGTATGAATTAGATAAAAAAA
TAATCGAAGTTACTAAGAAAATTCAAATTTTAACCAATAATTTATTTATT
AATAACTTAAATTTTTCAAAATTTGACCATGCAAATGAAGTATCTAAAAT
AGAAAAGCTATTTTTAATAGGTAGGGATATATGTAATGATAAAGTGTCCT
TGGCTGAAAATATATATGAAATGATTGATAAACAAATTAGATCTCTTGAT
ACCGATTTACAACAATACAAAAAGAAAATATCAAAAAGAATAAAAGGAAA
TTCTGATTCGAAATATTCTGGAAAAGTAGCTGAGGACATTCCGTCAATGG
TCGCTCTAACTATGGCCTTAACAGATAATAAAGATGAAATTTTGGATATG
CCTGTTGATCCGAATGAACCTGTTTATTGTTTATGTCATCAGGTTTCATT
TGGTGAAATGGTTGCCTGCGACAACAAAAACTGTTCAATAGAATGGTTTC
ATTTTTCATGTGTAAGCTTAACCAGTAAGCCTAAAGGAATGTGGTTCTGT
CCAAATTGTAGGGGAAAATAAATGTATTAATATTTAAATTATTGTAAAAT
TT
back to top

protein sequence of SMED30027683-orf-1

>SMED30027683-orf-1 ID=SMED30027683-orf-1|Name=SMED30027683-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MRKRSVLFRKVICIKSTPTGDVLLDEALRHIKENEGENIKTWIEYLSGET
WNPLKLKLQLRNVRERLAKNLVEKGVCTTEKQNFVLFDMTTHPLVETVVK
QKLIKKVQDSVLHRWNNDVQKMNKRTLSLIMLAYASDVLENAFGPLSDDE
YELSMKRVREVLDKDFDNESLKDGACEIMWGVFESFRN*
back to top

protein sequence of SMED30027683-orf-2

>SMED30027683-orf-2 ID=SMED30027683-orf-2|Name=SMED30027683-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=205bp
MEYLEKFLDGLDYVPPHLQQKFKVMYELDKKIIEVTKKIQILTNNLFINN
LNFSKFDHANEVSKIEKLFLIGRDICNDKVSLAENIYEMIDKQIRSLDTD
LQQYKKKISKRIKGNSDSKYSGKVAEDIPSMVALTMALTDNKDEILDMPV
DPNEPVYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPN
CRGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR028651ING_fam
IPR008628GPP34
IPR024610ING_N_histone-binding
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR019787Znf_PHD-finger
IPR011011Znf_FYVE_PHD
Vocabulary: biological process
TermDefinition
GO:0048193Golgi vesicle transport
Vocabulary: molecular function
TermDefinition
GO:0070273phosphatidylinositol-4-phosphate binding
GO:0005515protein binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 87..107
NoneNo IPR availableCDDcd15505PHD_INGcoord: 157..201
e-value: 1.94462E-27
score: 96.5986
NoneNo IPR availableCDDcd16859ING_ING4_5coord: 11..101
e-value: 9.68922E-16
score: 67.6154
IPR024610Inhibitor of growth protein, N-terminal histone-bindingSMARTSM01408ING_2coord: 3..104
e-value: 1.1E-16
score: 71.4
IPR024610Inhibitor of growth protein, N-terminal histone-bindingPFAMPF12998INGcoord: 3..102
e-value: 5.1E-14
score: 52.7
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 157..202
e-value: 2.1E-11
score: 53.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 148..204
e-value: 9.2E-27
score: 94.7
IPR028651ING familyPANTHERPTHR10333INHIBITOR OF GROWTH PROTEINcoord: 1..115
coord: 144..203
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 158..201
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 155..204
score: 9.205
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 144..202