NAD(P)H-dependent FMN reductase

Overview
NameNAD(P)H-dependent FMN reductase
Smed IDSMED30027682
Length (bp)1045
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NAD(P)H-dependent FMN reductase (SMED30027682) t-SNE clustered cells

Violin plots show distribution of expression levels for NAD(P)H-dependent FMN reductase (SMED30027682) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NAD(P)H-dependent FMN reductase (SMED30027682) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NAD(P)H-dependent FMN reductase (SMED30027682) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027682

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027682h1SMcG0000934 Contig3408newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30027682h1SMcG0000934 Contig3408uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30027682h1SMcG0000934 Contig3408newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30027682h1SMcG0000934 Contig3408uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30027682h1SMcG0000934 Contig3408newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027682h1SMcG0000934 Contig3408uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30027682h1SMcG0004935 Contig3408newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30027682h1SMcG0004935 Contig3408uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30027682h1SMcG0004935 Contig3408newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30027682h1SMcG0004935 Contig3408uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30027682h1SMcG0004935 Contig3408newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027682h1SMcG0004935 Contig3408uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30027682h1SMcG0004935 SmedASXL_010039SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30027682h1SMcG0004935 dd_Smed_v4_21902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027682h1SMcG0004935 dd_Smed_v4_21902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027682h1SMcG0004935 dd_Smed_v4_21902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027682h1SMcG0004935 dd_Smed_v6_21902_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027682h1SMcG0004935 OX_Smed_1.0.01007ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NAD(P)H-dependent FMN reductase vs. UniProt/SwissProt
Match: sp|Q9USJ6|FMNR_SCHPO (NAD(P)H-dependent FMN reductase C4B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4B3.06c PE=3 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 7.052e-6
Identity = 29/104 (27.88%), Postives = 47/104 (45.19%), Query Frame = 3
Query:  276 NKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDP 587
               I  +D  +F+T +YN   P  L N +D + +  +  KP  I++Y             G GGG    QL+ +  +L   + P  P++T   +KI   G +DP
Sbjct:   81 GSKIAGADGFVFVTPQYNGGYPAILKNALDHL-YHEWNGKPLLIVSYG------------GHGGGDCASQLKHVAGFLKMRVAPTMPALTLPRDKIV-QGVVDP 170          
BLAST of NAD(P)H-dependent FMN reductase vs. TrEMBL
Match: A0A1S3KEC4 (uncharacterized protein LOC106181203 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106181203 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 5.785e-27
Identity = 72/203 (35.47%), Postives = 111/203 (54.68%), Query Frame = 3
Query:   75 ISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSP 683
            + + + L +VR +R  +R+   MK +L   +  VEV+DP  I  PLL   +H+Y D +D P++L + N  IQE+DA + ++ EYN ++PP L N++D    S Y YKP+ I++YS               G  A  QLRS L  LGC+  P    I ++ E I ++GE   K + + +L  M Q+L +  HA+R+ R K   P
Sbjct:    6 LKVIMFLGTVRENRIGERVGIFMKKILEETDHEVEVMDPKEIDFPLLKKAFHHYDDPSDAPQFLQDCNAKIQEADAFVVVSAEYNHSIPPALSNMMDHFSPSVYAYKPSGIVSYSPGQ----------TAGVRAAMQLRSFLGVLGCMSVPSIFGIPQVHEAIDADGEPLNKRMREGAL-EMVQELDWHAHAMRNHRMKVGVP 197          
BLAST of NAD(P)H-dependent FMN reductase vs. TrEMBL
Match: A0A1S3KEU9 (uncharacterized protein LOC106181203 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106181203 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 6.837e-27
Identity = 72/203 (35.47%), Postives = 111/203 (54.68%), Query Frame = 3
Query:   75 ISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSP 683
            + + + L +VR +R  +R+   MK +L   +  VEV+DP  I  PLL   +H+Y D +D P++L + N  IQE+DA + ++ EYN ++PP L N++D    S Y YKP+ I++YS               G  A  QLRS L  LGC+  P    I ++ E I ++GE   K + + +L  M Q+L +  HA+R+ R K   P
Sbjct:    6 LKVIMFLGTVRENRIGERVGIFMKKILEETDHEVEVMDPKEIDFPLLKKAFHHYDDPSDAPQFLQDCNAKIQEADAFVVVSAEYNHSIPPALSNMMDHFSPSVYAYKPSGIVSYSPGQ----------TAGVRAAIQLRSFLGVLGCMSVPSIFGIPQVHEAIDADGEPLNKRMREGAL-EMVQELDWHAHAMRNHRMKVGVP 197          
BLAST of NAD(P)H-dependent FMN reductase vs. TrEMBL
Match: A0A1S3KEB9 (uncharacterized protein LOC106181199 OS=Lingula unguis OX=7574 GN=LOC106181199 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.665e-25
Identity = 72/203 (35.47%), Postives = 110/203 (54.19%), Query Frame = 3
Query:   75 ISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSP 683
            + + L L SVR +R  +R+   MK++L   N  VE++DP+    P+L  P H+Y DK+  P++L + N  IQ +DA + +T EYN ++PP L N++D    S Y YKP+ I+ YS   +Y         GG  A  QLRS L  LGC+       I ++ E I+  GE   + + K +L L+  QL +   A+++ R K   P
Sbjct:    6 LKVVLFLGSVRDNRLGERVATFMKNILVETNHEVEIMDPMKTEFPMLKKPLHHYQDKSKAPQFLQDCNAKIQAADAFVVVTAEYNHSIPPALSNMMDHFGSSGYSYKPSGIVCYS-PGQY---------GGMRAAMQLRSFLGELGCLSVSNIFGIPQVMEAISPEGEPQNEHMRKGALRLLA-QLDWHAQAMKNHREKVGVP 197          
BLAST of NAD(P)H-dependent FMN reductase vs. TrEMBL
Match: A0A5J4N8B1 (FMN_red domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0011101 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 8.241e-25
Identity = 76/204 (37.25%), Postives = 113/204 (55.39%), Query Frame = 3
Query:   87 LILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPD-KNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSPPIKL 695
            L  SSVRP R  DR+  + +  L      V V+DPL   +PL+  P+H+Y +     P+ L +L + +  +D LIF T EYNR++PP L NLID +P S+Y +KP  II YSV           G+GG  +  QLR +LS LGC++ P    I+ +D  I+++GE   +      + LM  Q++YI +AI+  R    + P K+
Sbjct:   12 LFASSVRPGRMNDRVLKLAERRLELKGHSVTVVDPLHWTLPLIVNPWHFYANPAEQAPKQLKDLFELVSSADRLIFTTAEYNRSIPPALSNLIDHLPHSAYAFKPTGIIAYSV-----------GSGGQLSAAQLRLMLSDLGCLVVPHHVVISNVDRTISADGEPSGRKTIIGEVDLMIDQVEYIGNAIKCNRTSTCAEPPKV 204          
BLAST of NAD(P)H-dependent FMN reductase vs. TrEMBL
Match: A0A504YM88 (FMN_red domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_03725 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.611e-21
Identity = 68/213 (31.92%), Postives = 119/213 (55.87%), Query Frame = 3
Query:   75 ISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGS-ALDQLRSILSYLGCIITPLCPSITRMDEKITSNG-----EIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSPPIKL 695
            + + L  SSVRPHR  DR+  +++  L+     V +IDP  + +P+LD     Y D+  +P+ L   N+ ++ +D L F T EYNR VPP L N++ ++P  +  YK A +I Y+            G  GG  A  QLR  L+ LGC++ P    +  + ++++++G     E+D + + +  + L+ +Q++Y+++AIRS    ++SPP K+
Sbjct:    4 LRVLLFASSVRPHRMNDRVLKLVEKRLKLKGYSVRLIDPKELQLPILDKSISEYTDEAAVPDALKQFNEQVKNADMLFFTTCEYNRCVPPALSNMLSYLPHKTMAYKTAGLIAYTT-----------GLDGGQLAASQLRLCLTELGCLLAPHSAILYNVGDRVSADGEPIGSELDCEAVVEE-IDLIIEQVEYLSNAIRSI--ASQSPPPKV 202          
BLAST of NAD(P)H-dependent FMN reductase vs. Planmine SMEST
Match: SMESG000060640.1 (SMESG000060640.1)

HSP 1 Score: 381.719 bits (979), Expect = 1.674e-134
Identity = 208/221 (94.12%), Postives = 209/221 (94.57%), Query Frame = 3
Query:   39 MYSRYLKSQQECISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSPPIKLLV 701
            MYSRYLKSQQECISITLILSSVRPHRNADRICAMMKSLL+SFNCRVEVIDPLIIGIPLLDVPYHYYPDK DIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSV           GAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSPPIKLLV
Sbjct:    1 MYSRYLKSQQECISITLILSSVRPHRNADRICAMMKSLLQSFNCRVEVIDPLIIGIPLLDVPYHYYPDKKDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSV-----------GAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNKSPPIKLLV 210          
BLAST of NAD(P)H-dependent FMN reductase vs. Planmine SMEST
Match: SMESG000023871.1 (SMESG000023871.1)

HSP 1 Score: 106.301 bits (264), Expect = 4.762e-27
Identity = 66/201 (32.84%), Postives = 110/201 (54.73%), Query Frame = 3
Query:   75 ISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEXXXXXXXXXXXXXXXYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNK 677
            + + + LSSVR  RNA+R+  M   L       V+V+DPL   +PLL  P H+YPD++  P+ L+ LN+ +  +D  + +T EYN  VPP L+NLID  P  S+ +KPA I++YS            G GG  +   L   L+ +GC++ P   +I+ + + +T+ G+      E    IL+  Q++++  A++  ++  K
Sbjct:    4 LKLLIFLSSVRDSRNAERVYKMALRLATEKGFSVDVMDPLKENLPLLKNPLHFYPDQSKAPQQLHVLNQKVMFADCYLMITGEYNYGVPPALLNLIDHFPPPSFAFKPAGILSYSA-----------GQGGRHSSSHLEHTLTGIGCLVQPFIVNISVVQDTVTAEGDAHGGHTEDNIKILL-DQIEFVGLALKQQKQSGK 192          
BLAST of NAD(P)H-dependent FMN reductase vs. Planmine SMEST
Match: SMESG000023871.1 (SMESG000023871.1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.581e-23
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  228 HYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAVPPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQLRSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQYITHAIRSWRRKNK 677
            H+YPD++  P+ L+ LN+ +  +D  + +T EYN  VPP L+NLID  P  S+ +KPA I++YS            G GG  +   L   L+ +GC++ P   +I+ + + +T+ G+      E    IL+  Q++++  A++  ++  K
Sbjct:   31 HFYPDQSKAPQQLHVLNQKVMFADCYLMITGEYNYGVPPALLNLIDHFPPPSFAFKPAGILSYSA-----------GQGGRHSSSHLEHTLTGIGCLVQPFIVNISVVQDTVTAEGDAHGGHTEDNIKILL-DQIEFVGLALKQQKQSGK 168          
The following BLAST results are available for this feature:
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9USJ6|FMNR_SCHPO7.052e-627.88NAD(P)H-dependent FMN reductase C4B3.06c OS=Schizo... [more]
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KEC45.785e-2735.47uncharacterized protein LOC106181203 isoform X2 OS... [more]
A0A1S3KEU96.837e-2735.47uncharacterized protein LOC106181203 isoform X1 OS... [more]
A0A1S3KEB91.665e-2535.47uncharacterized protein LOC106181199 OS=Lingula un... [more]
A0A5J4N8B18.241e-2537.25FMN_red domain-containing protein OS=Paragonimus w... [more]
A0A504YM881.611e-2131.92FMN_red domain-containing protein OS=Fasciola giga... [more]
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD(P)H-dependent FMN reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000060640.11.674e-13494.12SMESG000060640.1[more]
SMESG000023871.14.762e-2732.84SMESG000023871.1[more]
SMESG000023871.15.581e-2330.67SMESG000023871.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027682 ID=SMED30027682|Name=NAD(P)H-dependent FMN reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1045bp
ATTGAGATGAATTTCAATCAGTGTTGGATATCAAGGAAATGTATTCTCGA
TATTTGAAGAGTCAACAAGAATGTATTTCAATAACGCTCATTCTGAGCTC
TGTTCGACCGCATCGAAATGCCGACCGAATATGCGCAATGATGAAGTCTT
TGCTTCGATCTTTCAACTGTCGAGTAGAAGTTATTGATCCTCTCATAATT
GGAATTCCTTTGTTGGATGTCCCATACCATTATTATCCTGATAAGAACGA
TATCCCTGAATGGTTGAACAATCTAAACAAATCTATTCAGGAGTCTGATG
CGTTGATATTCCTCACTACCGAATACAACCGAGCCGTTCCACCTCCTCTG
ATAAATCTTATAGACTTTATTCCATTCTCAAGTTATGAATATAAACCGGC
ATCCATAATCACTTATTCTGTCGTGAGCAAATACCGGACACCGGAAGTGC
AATTAGGTGCTGGAGGAGGTAGTGCCCTTGATCAATTGCGTTCTATATTG
AGCTATTTGGGCTGCATTATAACTCCTCTATGCCCGTCAATAACGAGAAT
GGATGAAAAAATTACGTCAAACGGAGAGATTGATCCAAAATGCATAGAGA
AACGAAGCCTCATTTTGATGTGTCAGCAGCTACAATATATAACCCATGCG
ATCCGTTCATGGCGCAGAAAGAATAAAAGTCCCCCGATCAAATTATTGGT
GTAGTAAAACCGTGAATCATATGCAAAACATAGACGATAGACAAAAGATA
GATATTGAGATCAAGATAACATGGTTGATCTTTTGACGATTGTTGTTTGC
ATTTATTTTGATCATTTCAGTAGAGTCCATTACATTAGATATTGTGAAAT
TTTATTGGTTATTGACTTGCTTATTGTTTTAATACCTTCACATTTTCATG
AGAACTGATATTGACGGTATAAGTTTAGCAAGAATATCATTTAGCAGACA
GAGTCCATTAAAATTTGGTATGTAGGAGTATTTTGTAGGTATCTACAACA
TTGGAATGTTTGGAAGCTGAGAGCTTTACTAAAAGAATGTACTTG
back to top

protein sequence of SMED30027682-orf-1

>SMED30027682-orf-1 ID=SMED30027682-orf-1|Name=SMED30027682-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=222bp
MYSRYLKSQQECISITLILSSVRPHRNADRICAMMKSLLRSFNCRVEVID
PLIIGIPLLDVPYHYYPDKNDIPEWLNNLNKSIQESDALIFLTTEYNRAV
PPPLINLIDFIPFSSYEYKPASIITYSVVSKYRTPEVQLGAGGGSALDQL
RSILSYLGCIITPLCPSITRMDEKITSNGEIDPKCIEKRSLILMCQQLQY
ITHAIRSWRRKNKSPPIKLLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005025FMN_Rdtase-like
IPR029039Flavoprotein-like_sf
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005025NADPH-dependent FMN reductase-likePFAMPF03358FMN_redcoord: 15..162
e-value: 9.1E-17
score: 61.2
IPR029039Flavoprotein-like superfamilyGENE3DG3DSA:3.40.50.360coord: 2..218
e-value: 1.2E-26
score: 95.4
IPR029039Flavoprotein-like superfamilySUPERFAMILYSSF52218Flavoproteinscoord: 15..181
NoneNo IPR availablePANTHERPTHR30543CHROMATE REDUCTASEcoord: 14..209
NoneNo IPR availablePANTHERPTHR30543:SF1NAD(P)H-DEPENDENT FMN REDUCTASE LOT6coord: 14..209