Spermatogenesis-associated protein 6

Overview
NameSpermatogenesis-associated protein 6
Smed IDSMED30027674
Length (bp)1207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spermatogenesis-associated protein 6 (SMED30027674) t-SNE clustered cells

Violin plots show distribution of expression levels for Spermatogenesis-associated protein 6 (SMED30027674) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027674

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30027674SMESG000073102.1 dd_Smed_v6_26630_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testis primordiumSMED30027674SMESG000073102.1 Contig1349_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30027674SMESG000073102.1 SMED_06174_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027674SMESG000073102.1 SMED_06174_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 62.7734 bits (151), Expect = 4.089e-11
Identity = 49/149 (32.89%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSN--RRSFKLQNRELLMIRSFSFQGISPKLIFSS 766
            MP  ++V E++++ IS PG  L  +  V++ + L+ +Y  +      FPI I E  +F K      D  A +  LE      EL Q  P  P  D LAY++ N  D       LT +  RR      RE+LM  +  F GI+PK+ FS+
Sbjct:    1 MPL-EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVP--PVWDELAYYEENTRDFLFPEPKLTPSHPRRC-----REVLMKTALGFPGIAPKIEFST 141          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 62.7734 bits (151), Expect = 4.089e-11
Identity = 49/149 (32.89%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSN--RRSFKLQNRELLMIRSFSFQGISPKLIFSS 766
            MP  ++V E++++ IS PG  L  +  V++ + L+ +Y  +      FPI I E  +F K      D  A +  LE      EL Q  P  P  D LAY++ N  D       LT +  RR      RE+LM  +  F GI+PK+ FS+
Sbjct:    1 MPL-EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVP--PVWDELAYYEENTRDFLFPEPKLTPSHPRRC-----REVLMKTALGFPGIAPKIEFST 141          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 63.929 bits (154), Expect = 9.016e-11
Identity = 48/147 (32.65%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSS 766
            MP  ++V E++++ IS PG  L  +  V++ + L+ +Y  +      FPI I E  +F K      D  A +  LE      EL Q  P  P  D LAY++ N  D       LT    S   + RE+LM  +  F GI+PK+ FS+
Sbjct:    1 MPL-EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVP--PVWDELAYYEENTRDFLFPEPKLTP---SHPRRCREVLMKTALGFPGIAPKIEFST 141          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 54.299 bits (129), Expect = 5.480e-8
Identity = 44/149 (29.53%), Postives = 67/149 (44.97%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSN--RRSFKLQNRELLMIRSFSFQGISPKLIFSS 766
            MP  ++V E++++ IS PG  L  +  V++ + L+ +Y  +      FPI I E  +F K      D  A +  LE                  D LAY++ N  D       LT +  RR      RE+LM  +  F GI+PK+ FS+
Sbjct:    1 MP-LEVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLEMW----------------DELAYYEENTRDFLFPEPKLTPSHPRRC-----REVLMKTALGFPGIAPKIEFST 127          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 55.4546 bits (132), Expect = 8.610e-8
Identity = 43/147 (29.25%), Postives = 66/147 (44.90%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSS 766
            MP  ++V E++++ IS PG  L  +  V++ + L+ +Y  +      FPI I E  +F K      D  A +  LE                  D LAY++ N  D       LT    S   + RE+LM  +  F GI+PK+ FS+
Sbjct:    1 MPL-EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLEMW----------------DELAYYEENTRDFLFPEPKLTP---SHPRRCREVLMKTALGFPGIAPKIEFST 127          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 79.337 bits (194), Expect = 6.686e-16
Identity = 53/154 (34.42%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  344 CFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRR-SFKLQNRELLMIRSFSFQGISPKLIFS--SCVEVISSNPG 796
               ++ E+ L+ I+ PG  L  ++ V++ + L+ RYR S C    FPI I E  +F K L   +D  A   +L+     IEL Q  P  P G++LA F+ +             SF    RE+LM R  +F GISP+L FS  + +  ISS+ G
Sbjct:    5 AVKVIVELHLRAITCPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKILNYATDPEAIAEFLQYEAVKIELIQLIP--PAGEILASFEEDARSFLFPEPKLVPSFSGVEREVLMTRHPTFPGISPRLEFSTKTTISEISSDNG 156          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 72.7886 bits (177), Expect = 2.531e-14
Identity = 51/145 (35.17%), Postives = 73/145 (50.34%), Query Frame = 2
Query:  371 LKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRR-SFKLQNRELLMIRSFSFQGISPKLIFS--SCVEVISSNPG 796
             + I+ PG  L  ++ V++ + L+ RYR S C    FPI I E  +F K L   +D  A   +L+     IEL Q  P  P G++LA F+ +             SF    RE+LM R  +F GISP+L FS  + +  ISS+ G
Sbjct:    4 FETITCPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKILNYATDPEAIAEFLQYEAVKIELIQLIP--PAGEILASFEEDARSFLFPEPKLVPSFSGVEREVLMTRHPTFPGISPRLEFSTKTTISEISSDNG 146          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Zebrafish
Match: spata6 (spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-GENE-050417-351])

HSP 1 Score: 75.0998 bits (183), Expect = 2.812e-14
Identity = 48/138 (34.78%), Postives = 77/138 (55.80%), Query Frame = 2
Query:  362 EIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT--GLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSC 769
            E+K++ I+ PG  L  +  +++ + ++G+Y+ S C  P FP+ + E   F KT     D  A   +LE    S+EL Q  P  P+G++LA F+++  +    G     RS   + RE+LM RS SF GISP++ FS+ 
Sbjct:   11 ELKVQAITCPGVMLPSQEDIYLSVRIMGQYQKSKCVPPVFPLLLHEKMVFVKTFVGMLDPAAVAEHLENDTTSLELIQLVP--PEGEILATFEADTREFLYPGPRLTPRSPGPE-REILMKRSISFPGISPRVEFSTT 145          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Xenopus
Match: spata6l (spermatogenesis associated 6-like [Source:NCBI gene;Acc:779679])

HSP 1 Score: 55.0694 bits (131), Expect = 1.079e-7
Identity = 42/147 (28.57%), Postives = 69/147 (46.94%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSS 766
            MP   IV E+++  ++ PG  L  ++ + + + +LG+++ + C    FP+   E  +F K      D  A  + LE      EL Q   L    D+LA F+ N          LT    ++   +RE+LM     F GI+PK+ FS+
Sbjct:    1 MP-LKIVIELQIHAVTCPGVFLPEKDDILLNVSILGQHKETGCLPSVFPLLFHEKMRFEKVFLKAVDPAALAQSLENHITRFELIQ---LTHSADILAVFEENTRQFLFPEPKLTP---AYPGVDREVLMKTVNGFPGIAPKIEFST 140          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Mouse
Match: 4430402I18Rik (RIKEN cDNA 4430402I18 gene [Source:MGI Symbol;Acc:MGI:1918036])

HSP 1 Score: 68.5514 bits (166), Expect = 3.562e-12
Identity = 46/149 (30.87%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKL-QNRELLMIRSFSFQGISPKLIFSSCVEVI 781
            MP  ++V E++++ IS PG  L  +  V++ + LL +Y  + C  P FP+ I +  +F K      D  A    LE      EL Q   + P  + LAY++ N  D         S  L   RE+LM  +  F GI+PK+ FS+   ++
Sbjct:    1 MP-MEVVVELQIRAISCPGVFLPDKEAVYLGVYLLNQYLETDCFPPVFPVVIQQSMRFVKVFEEAIDPGAVAELLESFLTRFELVQL--VSPAWEELAYYEKNTRDFLFPEPRLASSHLGMQREVLMKTAIWFPGIAPKIEFSTRTAIL 146          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 58.5362 bits (140), Expect = 8.409e-10
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            ++++ ++ PG  L+ +  +++ I + G+Y+ + C    FP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +GI+PKL FS+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 60.077 bits (144), Expect = 2.596e-9
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            ++++ ++ PG  L+ +  +++ I + G+Y+ + C    FP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +GI+PKL FS+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 59.6918 bits (143), Expect = 2.863e-9
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            ++++ ++ PG  L+ +  +++ I + G+Y+ + C    FP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +GI+PKL FS+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. UniProt/SwissProt
Match: sp|Q6AYJ3|SPA6L_RAT (Spermatogenesis associated 6-like protein OS=Rattus norvegicus OX=10116 GN=Spata6l PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.297e-11
Identity = 48/153 (31.37%), Postives = 75/153 (49.02%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDIT----GLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVIS 784
            MP  ++V E++++ IS PG  L  + +V++ + LL +Y  + C    FPI I +  +F K      D  A    LE      EL Q   + P  + LAY++ N  D       LTS+    +   RE+LM  +  F GI+PKL FS+   ++ 
Sbjct:    1 MP-LEVVVELQIRAISCPGVFLPDKEVVYLGVYLLNQYLETDCFPSVFPIVIQQSMRFEKVFEEAMDPGAVAELLESFLTRFELVQL--VSPAWEELAYYEKNTRDFLFPEPKLTSSHLGMQ---REVLMKTAIWFPGIAPKLEFSTRTAILE 147          
BLAST of Spermatogenesis-associated protein 6 vs. UniProt/SwissProt
Match: sp|Q2KJG1|SPAT6_BOVIN (Spermatogenesis-associated protein 6 OS=Bos taurus OX=9913 GN=SPATA6 PE=2 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 7.881e-9
Identity = 39/135 (28.89%), Postives = 65/135 (48.15%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            ++++ ++ PG  L+ +  +++ I + G+Y+ + C   NFP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +GI+PKL FS+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPANFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTALFELIQLVP--PVGETLSTYDENTRDFMFPGPNQISGHHDSNRQVTMRRISGLRGIAPKLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. UniProt/SwissProt
Match: sp|Q3U6K5|SPAT6_MOUSE (Spermatogenesis-associated protein 6 OS=Mus musculus OX=10090 GN=Spata6 PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 1.816e-8
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            ++++ ++ PG  L+ +  +++ I + G+Y+ + C    FP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +GI+PKL FS+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. UniProt/SwissProt
Match: sp|Q99MU5|SPAT6_RAT (Spermatogenesis-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Spata6 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 3.145e-8
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            ++++ ++ PG  L+ +  +++ I + G+Y+ + C    FP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +GI+PKL FS+
Sbjct:   13 LEIRSVTCPGVLLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQISGHHDSNRQVTMRRISGLRGIAPKLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. UniProt/SwissProt
Match: sp|Q9NWH7|SPAT6_HUMAN (Spermatogenesis-associated protein 6 OS=Homo sapiens OX=9606 GN=SPATA6 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 6.811e-7
Identity = 36/135 (26.67%), Postives = 62/135 (45.93%), Query Frame = 2
Query:  365 IKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRS-FKLQNRELLMIRSFSFQGISPKLIFSS 766
            +++  ++ PG  L+ +  +++ I + G+Y+ + C    FP+       F K  P   D    +  LE      EL Q  P  P G+ L+ +D N  D      N+ S     NR++ M R    +G +P+L FS+
Sbjct:   13 LEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPRLEFST 145          
BLAST of Spermatogenesis-associated protein 6 vs. TrEMBL
Match: A0A267F5W2 (SPATA6 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022756g1 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.697e-16
Identity = 53/139 (38.13%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  347 FDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTS-NRRSFKLQNRELLMIRSFSFQGISPKLIF 760
            F    EI ++ + SPGT L  R+ V++ ID L + + S   +P FP+ + E F+F K   P SD    +  LE+LP +IELRQ    F    LLAYFDS+  +    ++   +      RE LM R+  F G+SPKL F
Sbjct:   11 FRCTAEITIELVVSPGTWLPHRDDVYLTIDFLNQVKRSRLVAPVFPLRVHERFRFEKNFWPASDPRDVVDRLEELPIAIELRQATDAFRGSRLLAYFDSDGREFLFPSAPTSKPACHTGREALMARTVDFSGVSPKLEF 149          
BLAST of Spermatogenesis-associated protein 6 vs. TrEMBL
Match: A0A1I8IJV1 (SPATA6 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.845e-16
Identity = 53/139 (38.13%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  347 FDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTS-NRRSFKLQNRELLMIRSFSFQGISPKLIF 760
            F    EI ++ + SPGT L  R+ V++ ID L + + S   +P FP+ + E F+F K   P SD    +  LE+LP +IELRQ    F    LLAYFDS+  +    ++   +      RE LM R+  F G+SPKL F
Sbjct:    6 FRCTAEITIELVVSPGTWLPHRDDVYLTIDFLNQVKRSRLVAPVFPLRVHERFRFEKNFWPASDPRDVVDRLEELPIAIELRQATDAFRGSRLLAYFDSDGREFLFPSAPTSKPACHTGREALMARTVDFSGVSPKLEF 144          
BLAST of Spermatogenesis-associated protein 6 vs. TrEMBL
Match: W6U7Z3 (SPATA6 domain-containing protein OS=Echinococcus granulosus OX=6210 GN=EGR_07821 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.574e-16
Identity = 54/154 (35.06%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISSNPGS 799
            MP +   G + L+ + SPGT L  R+ +F+ I++      +    PNFP+ + E F F K            R LE +P +IELRQ    F  G LLAYFD N  D         S    +RELLMIR+  F G+SP++ F++  ++   +PG+
Sbjct:    1 MPTYLFEGTLVLRKVHSPGTYLHNRDDIFLYINIFDSIHFTKLSLPNFPLEVQESFSFEKRFFDTFSPYELCRKLEDIPVTIELRQMTEYFNSGKLLAYFDGNARDFFMPCPTLCSTIGNDRELLMIRTVDFPGVSPRVEFTTTTKI---SPGA 151          
BLAST of Spermatogenesis-associated protein 6 vs. TrEMBL
Match: A0A267DW44 (SPATA6 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022756g2 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.120e-15
Identity = 51/136 (37.50%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  356 VGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTS-NRRSFKLQNRELLMIRSFSFQGISPKLIF 760
              EI ++ + SPGT L  R+ V++ ID L + + S   +P FP+ + E F+F K   P SD    +  LE+LP +IELRQ    F    LLAYFDS+  +    ++   +      RE LM R+  F  +SPKL F
Sbjct:   14 TAEITIELVVSPGTWLPHRDDVYLTIDFLNQVKRSRLVAPVFPLRVHERFRFEKNFWPASDPRDVVDRLEELPIAIELRQATDAFRGSRLLAYFDSDGREFLFPSAPTSKPACHTGREALMARTVDFSSVSPKLEF 149          
BLAST of Spermatogenesis-associated protein 6 vs. TrEMBL
Match: A0A4S2LT73 (SPATA6 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005283 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.280e-15
Identity = 47/147 (31.97%), Postives = 76/147 (51.70%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEV 778
            MP +    E+ L C+ SPGT L  R+ ++I +D+    R +    P FP+ I E F FHK        C  +  L+     IELRQ   ++  G LLAYF++   ++    ++  +  L   E+ ++R+  F GISP+L +S+  E+
Sbjct:    1 MPTYKFEAELTLHCVHSPGTWLANRDNLYIILDVFNSCRRTRLVEPIFPLLIHEKFVFHKIFYSALSACNVIDRLDDERIRIELRQITDVYCGGTLLAYFETTARELFCPCAHMCTRTLPKNEITLLRTIDFPGISPRLEYSASSEI 147          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Cavefish
Match: spata6 (spermatogenesis associated 6 [Source:NCBI gene;Acc:103025219])

HSP 1 Score: 62.003 bits (149), Expect = 4.543e-10
Identity = 43/145 (29.66%), Postives = 65/145 (44.83%), Query Frame = 2
Query:  344 CFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRR---SFKLQNRELLMIRSFSFQGISPKLIFSSC 769
               +  ++KL  ++ PG  L     V++ + ++GRY  + C    FP+ + E   F K      D      +LE      EL Q  P  P+G++LA    N  D   L    R         RE+LM +S SF GISP++ FS+ 
Sbjct:   12 ALQVTVQLKLHAVTCPGVLLPSHEDVYLSVRMMGRYHKTKCVPSVFPLLLHEKMVFTKIFSGAVDPGDIADHLENDTTCFELIQLVP--PEGEILATLQENTRDF--LYPGPRLTPPAPGSEREILMKKSVSFPGISPRVEFSTT 152          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Cavefish
Match: spata6l (spermatogenesis associated 6-like protein [Source:NCBI gene;Acc:103039467])

HSP 1 Score: 60.4622 bits (145), Expect = 9.158e-10
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  344 CFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRR---SFKLQNRELLMIRSFSFQGISPKLIFSS 766
               +  E+ ++ I+ PG  L  ++ +++   LL +YR S C    FP+      +F K      D  A    L+     IEL Q   + P G++LA ++ N      L    +   SF   +RE+LM R  +F GISP+L FS+
Sbjct:    5 SLKVFVELHIRAITCPGVHLTAKDDIYLSACLLNQYRKSDCLPAVFPLLFRTKMRFEKIFKYAIDPAAIAEILQCETVKIELIQL--IRPAGEILATYEENARSF--LFPEPKLVPSFSGGDREVLMTRDPNFSGISPRLEFST 144          
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Nematostella
Match: EDO34010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL7])

HSP 1 Score: 47.7506 bits (112), Expect = 5.931e-6
Identity = 26/116 (22.41%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  308 CLNK*YLLLIMPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTD 655
             L+K ++ +      ++ E+ +  I+ PGT LR    V++ ++ +G   ++    P FP+   E  +F +    C D      +L+     +ELRQ +     G ++ ++ +N  D
Sbjct:  180 LLDKPFIKMPRKAMKVIVELDVHTITCPGTFLRDYGYVYLKVNCMGLEVNTKSVPPTFPVFFHERLRFERVFKSCQDPAYVSIHLKGEDVLVELRQHDDYISDGYVIGHYANNARD 295          
BLAST of Spermatogenesis-associated protein 6 vs. Planmine SMEST
Match: SMESG000073102.1 (SMESG000073102.1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISSNPGSRPRGRNCIRPQKCLPVCRPRLPLCRDGVTPDMRKFLRHRYSASLSPSRSIICKKKGYSNRESCRSKSERRPSGKQNMKEHWKQEIIRISQNLNKANQHINRLIGLQC 1120
            MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISSNPGSRPRGRNCIRPQKCLPVCRPRLPLCRDGVTPDMRKFLRHRYSASLSPSRSIICKKKGYSNRESCRSKSERRPSGKQNMKEHWKQEIIRISQNLNKANQHINRLIGLQC
Sbjct:    1 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISSNPGSRPRGRNCIRPQKCLPVCRPRLPLCRDGVTPDMRKFLRHRYSASLSPSRSIICKKKGYSNRESCRSKSERRPSGKQNMKEHWKQEIIRISQNLNKANQHINRLIGLQC 261          
BLAST of Spermatogenesis-associated protein 6 vs. Planmine SMEST
Match: SMESG000053714.1 (SMESG000053714.1)

HSP 1 Score: 102.064 bits (253), Expect = 4.974e-24
Identity = 67/183 (36.61%), Postives = 95/183 (51.91%), Query Frame = 2
Query:  347 FDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISSNPGSRPRGRNCIRPQKCLPVCRPRLPLCRDGVTPDM 895
            + I  EI +  I+SPGT L  R+ +++ ID   + + +   SPNFP+   E F F K    C+D    +  +E +P ++ELRQ   ++  G LL+YFD+N  D     SN     + NRELLMIR+  F GISPK+ FSS   V+   P       + +   KC   CR R P   D V P +
Sbjct:    2 YKIHCEITIHHITSPGTWLPNRDDLYLTIDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYC-VMDKMPKCTVNQGDVV---KCSKSCRSRRPA--DKVYPSI 178          
BLAST of Spermatogenesis-associated protein 6 vs. Planmine SMEST
Match: SMESG000013811.1 (SMESG000013811.1)

HSP 1 Score: 63.5438 bits (153), Expect = 9.070e-11
Identity = 41/145 (28.28%), Postives = 68/145 (46.90%), Query Frame = 2
Query:  362 EIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKL---IFSSCVEVISS 787
            E+ L  +SS G       +V++ +++ G    +      +P+   E+  F KT    S+    L  LE     IELR+ +P F  G LL+YFD N  +      +R    +  +E+ + R+  F G +P+L   IF+   +V SS
Sbjct:   11 ELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASS 155          
BLAST of Spermatogenesis-associated protein 6 vs. Planmine SMEST
Match: SMESG000002798.1 (SMESG000002798.1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.228e-6
Identity = 72/282 (25.53%), Postives = 117/282 (41.49%), Query Frame = 2
Query:  338 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMI-RSFSFQGISPKLIFSSCVEV-----ISSNPGSRPR--GRNCIRPQKCLPV---CRPRLPLCRDGVTPDMRKFLRHRYSASLSPSRSIICKKKGYSNRE---------SCRSKS--ERRPSGKQNMKEHWKQEIIRISQNLNKANQHINRLIGLQ 1117
            MP F +  +++++ I+  G+++ CR  V + I++  + + S      FPI + E F F +    C +    L+ L   P +IEL +      +   +AYFD N+ DIT L  +    +  +R + MI ++F     SP + +S    V      SS  G  P   G    R   C P+   C PR    R      MR             S SI C  +   +           SC  +    RRP      K+ W  EI R+++NL + +  I +L  ++
Sbjct:    1 MPNFKVEIDLEIEKINYCGSKIDCRTEVSLRIEIFNKIKYSKYRQAQFPIRLCEHFCFKELFFDCPNSMTVLQRLNDCPVTIELIEVGSSC-QDSSVAYFDGNVYDITELC-DMGPARCYSRTINMINKNFIKSYTSPSICYSCTSSVSNLLSCSSETGFYPTTCGSKPKRTSYCPPLPRSCSPRRSCERSPCYSTMRP-----------TSPSITCCPRRPRSSLSRRCSPIPISCNPECIPNRRP------KQKWDLEISRLTKNLREVSDQIRQLTCME 263          
The following BLAST results are available for this feature:
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPATA6L4.089e-1132.89spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L4.089e-1132.89spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L9.016e-1132.65spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L5.480e-829.53spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L8.610e-829.25spermatogenesis associated 6 like [Source:HGNC Sym... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spata6l6.686e-1634.42spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
spata6l2.531e-1435.17spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
spata62.812e-1434.78spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spata6l1.079e-728.57spermatogenesis associated 6-like [Source:NCBI gen... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
4430402I18Rik3.562e-1230.87RIKEN cDNA 4430402I18 gene [Source:MGI Symbol;Acc:... [more]
Spata68.409e-1028.15spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
Spata62.596e-928.15spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
Spata62.863e-928.15spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYJ3|SPA6L_RAT1.297e-1131.37Spermatogenesis associated 6-like protein OS=Rattu... [more]
sp|Q2KJG1|SPAT6_BOVIN7.881e-928.89Spermatogenesis-associated protein 6 OS=Bos taurus... [more]
sp|Q3U6K5|SPAT6_MOUSE1.816e-828.15Spermatogenesis-associated protein 6 OS=Mus muscul... [more]
sp|Q99MU5|SPAT6_RAT3.145e-828.15Spermatogenesis-associated protein 6 OS=Rattus nor... [more]
sp|Q9NWH7|SPAT6_HUMAN6.811e-726.67Spermatogenesis-associated protein 6 OS=Homo sapie... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F5W23.697e-1638.13SPATA6 domain-containing protein (Fragment) OS=Mac... [more]
A0A1I8IJV13.845e-1638.13SPATA6 domain-containing protein OS=Macrostomum li... [more]
W6U7Z35.574e-1635.06SPATA6 domain-containing protein OS=Echinococcus g... [more]
A0A267DW444.120e-1537.50SPATA6 domain-containing protein (Fragment) OS=Mac... [more]
A0A4S2LT736.280e-1531.97SPATA6 domain-containing protein OS=Opisthorchis f... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata64.543e-1029.66spermatogenesis associated 6 [Source:NCBI gene;Acc... [more]
spata6l9.158e-1029.86spermatogenesis associated 6-like protein [Source:... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO340105.931e-622.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spermatogenesis-associated protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000073102.10.000e+0100.00SMESG000073102.1[more]
SMESG000053714.14.974e-2436.61SMESG000053714.1[more]
SMESG000013811.19.070e-1128.28SMESG000013811.1[more]
SMESG000002798.11.228e-625.53SMESG000002798.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027674 ID=SMED30027674|Name=Spermatogenesis-associated protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1207bp
TTTTTTTATAATTTATTTTTTGCTCAACAATAAAAAATCAAGATCGGTTA
TTTTTTCAGAAATACACTGAACCCATGAAACGAAATGATTTTCAATCCGT
AACATACACAGCGTCAATTTTTCCTTGTTTTGAATGCATATAATTTCATT
TAATTAAAACTAAATATAACCAAAAATGAATTTCTTACAAATAAAATGTT
AATAATTCAAAAATGATAATTATGTATATTAAACTACTTGTTTATATTTA
TCATTAAATTAAAATTTCTAAAATTTCTTTACAGTTAATTTGTCATTTTT
TATATGTTGCCTAAATAAATAATATTTGCTTTTGATTATGCCATGTTTCG
ATATAGTAGGAGAAATAAAACTTAAATGTATCAGTTCACCTGGCACAAGA
TTGAGATGCCGTAACATGGTATTCATCTGCATTGACCTGCTTGGCAGATA
TCGCTCTTCATATTGCCATTCTCCGAATTTTCCTATTTGTATTGGAGAAA
TTTTCAAGTTTCATAAAACATTGCCTCCATGTTCGGATTTTTGTGCATGT
CTTAGATATCTTGAAAAGCTTCCTTTCTCGATAGAATTAAGACAAGATAA
TCCCCTCTTTCCTAAAGGAGACTTATTAGCATATTTTGATTCCAACTTGA
CTGACATTACTGGTTTGACAAGCAATAGAAGAAGTTTCAAACTTCAGAAT
CGTGAATTGTTGATGATTCGTTCTTTTAGTTTTCAGGGCATTTCTCCGAA
ACTTATATTTTCTTCATGCGTAGAAGTGATTTCTTCAAATCCAGGCTCCA
GGCCAAGAGGGAGAAACTGTATACGACCTCAAAAATGTTTACCAGTATGC
AGGCCGAGACTCCCGCTTTGTCGGGATGGAGTAACTCCTGACATGCGTAA
ATTCTTAAGGCATAGATACAGTGCGTCGCTGTCACCAAGTCGAAGTATTA
TATGTAAGAAAAAAGGTTATAGCAACCGTGAAAGCTGTAGATCAAAATCA
GAACGTCGGCCATCTGGAAAACAAAATATGAAAGAACATTGGAAACAAGA
AATTATTCGAATTAGTCAAAATTTAAACAAAGCCAACCAACATATAAATC
GTTTAATTGGATTGCAATGTTGAAATAATCTATCAATTCTTAATTTTATT
TATCAAGAGTTAGAAATTATTTAGAGTAGAATTGAAATTATATTGAGAAT
CTACCAC
back to top

protein sequence of SMED30027674-orf-1

>SMED30027674-orf-1 ID=SMED30027674-orf-1|Name=SMED30027674-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPI
CIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYF
DSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISS
NPGSRPRGRNCIRPQKCLPVCRPRLPLCRDGVTPDMRKFLRHRYSASLSP
SRSIICKKKGYSNRESCRSKSERRPSGKQNMKEHWKQEIIRISQNLNKAN
QHINRLIGLQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
GO:0008150biological_process
Vocabulary: molecular function
TermDefinition
GO:0032027myosin light chain binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0097224sperm connecting piece
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR042769SPATA6_fam
IPR032732SPATA6_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 232..252
IPR032732Spermatogenesis-associated protein 6, N-terminalPFAMPF14909SPATA6coord: 9..144
e-value: 3.9E-24
score: 85.4
IPR042769SPATA6 familyPANTHERPTHR16435SPERMATOGENESIS-ASSOCIATED PROTEIN 6 SPATA6coord: 1..237