Plac8 onzin related protein 1

Overview
NamePlac8 onzin related protein 1
Smed IDSMED30027672
Length (bp)967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plac8 onzin related protein 1 (SMED30027672) t-SNE clustered cells

Violin plots show distribution of expression levels for Plac8 onzin related protein 1 (SMED30027672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plac8 onzin related protein 1 (SMED30027672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plac8 onzin related protein 1 (SMED30027672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynx progenitor cellSMED30027672SMESG000050229.1 SMED30027672smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30027672SMESG000050229.1 SmedASXL_008549SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027672SMESG000050229.1 SmedASXL_008549SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027672SMESG000050229.1 SMESG000050221.1 dd_Smed_v4_1219_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027672SMESG000050229.1 Contig41242newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027672SMESG000050229.1 Contig41242uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30027672SMESG000050221.1 SMESG000050229.1 OX_Smed_1.0.13602ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30027672SMESG000050221.1 SMESG000050229.1 dd_Smed_v6_1219_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plac8 onzin related protein 1 vs. Ensembl Human
Match: PLAC8L1 (PLAC8 like 1 [Source:HGNC Symbol;Acc:HGNC:31746])

HSP 1 Score: 66.6254 bits (161), Expect = 1.265e-12
Identity = 47/146 (32.19%), Postives = 67/146 (45.89%), Query Frame = 1
Query:  250 KMSYEKKSFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
             MS E + F +       A+  +++QP       V   S     T I+Q    + GG  WS+G+ S   D   C C + CP C    +   YGEC C    +P + FALRI  R RHKI G++  D      C+  S CQ+ R++ 
Sbjct:   27 HMSSEDEHFISNLRGHVPAS-AVVKQP-------VRGASGRTTITAIVQ----TGGG--WSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPL-LPGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELK 157          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Human
Match: CNFN (cornifelin [Source:HGNC Symbol;Acc:HGNC:30183])

HSP 1 Score: 61.6178 bits (148), Expect = 2.195e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L ++R   R R+ I GS+ +D     FC   + CQM R++
Sbjct:   24 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAP-YLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 108          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Human
Match: CNFN (cornifelin [Source:HGNC Symbol;Acc:HGNC:30183])

HSP 1 Score: 61.6178 bits (148), Expect = 2.195e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L ++R   R R+ I GS+ +D     FC   + CQM R++
Sbjct:   24 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAP-YLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 108          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 53.5286 bits (127), Expect = 1.482e-8
Identity = 33/112 (29.46%), Postives = 52/112 (46.43%), Query Frame = 1
Query:  382 TVIIQQPNISSG----GRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATK 705
             V++ QP +  G       W +G+C CF D   C C   C  C   ++ +   ECC     +     A+R  +R R+ I GSI +D    + C   + CQ+KRD++   A +
Sbjct:    7 VVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECC-----LCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMR 113          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 53.5286 bits (127), Expect = 1.482e-8
Identity = 33/112 (29.46%), Postives = 52/112 (46.43%), Query Frame = 1
Query:  382 TVIIQQPNISSG----GRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATK 705
             V++ QP +  G       W +G+C CF D   C C   C  C   ++ +   ECC     +     A+R  +R R+ I GSI +D    + C   + CQ+KRD++   A +
Sbjct:    7 VVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECC-----LCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMR 113          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Zebrafish
Match: ponzr10 (plac8 onzin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-081107-68])

HSP 1 Score: 64.6994 bits (156), Expect = 3.450e-12
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  385 VIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCC----------------SSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            V++QQ        LW+SGIC CF D+ SCC    C  C+       +GE  C                 + CVP    +LR+  R+++ I GSI ND+  +  C   S CQM R++ 
Sbjct:    4 VVVQQVPSKPQETLWNSGICDCFQDLNSCCYAYWCCPCFACSTAGEFGESTCLPLVDILGPAVMASFGVAFCVPPVTMSLRVAIRHKYNIRGSICNDIAVSCCCVMCSWCQMNREIK 120          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Zebrafish
Match: BX005027.2 (plac8 onzin related protein 10 [Source:NCBI gene;Acc:100001900])

HSP 1 Score: 65.0846 bits (157), Expect = 3.479e-12
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  385 VIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCC----------------SSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            V++QQ        LW+SGIC CF D+ SCC    C  C+       +GE  C                 + CVP    +LR+  R+++ I GSI ND+  +  C   S CQM R++ 
Sbjct:    6 VVVQQVPSKPQETLWNSGICDCFQDLNSCCYAYWCCPCFACSTAGEFGESTCLPLVDILGPAVMASFGVAFCVPPVTMSLRVAIRHKYNIRGSICNDIAVSCCCVMCSWCQMNREIK 122          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Zebrafish
Match: ponzr1 (plac8 onzin related protein 1 [Source:ZFIN;Acc:ZDB-GENE-070727-1])

HSP 1 Score: 62.7734 bits (151), Expect = 7.255e-12
Identity = 42/116 (36.21%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  379 TTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCS---SCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLA 717
            +T ++     SSG   W++GIC C  DM +CCC   C  C   +  S++G C C     CC+  +   LR + R ++ I+GS  +D CT  FCY  + CQM R++    A  GT A
Sbjct:    5 STTVVSTQRTSSG--TWTTGICDCCSDMSTCCCGFWCFPCMQCQTASQFGWCFCMPLLDCCMVVSC-CLRKKMREQYSINGSCCDDFCTLCFCYPCAWCQMSREIK-TRARSGTTA 116          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Zebrafish
Match: ponzr1 (plac8 onzin related protein 1 [Source:ZFIN;Acc:ZDB-GENE-070727-1])

HSP 1 Score: 62.7734 bits (151), Expect = 7.255e-12
Identity = 42/116 (36.21%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  379 TTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCS---SCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLA 717
            +T ++     SSG   W++GIC C  DM +CCC   C  C   +  S++G C C     CC+  +   LR + R ++ I+GS  +D CT  FCY  + CQM R++    A  GT A
Sbjct:    5 STTVVSTQRTSSG--TWTTGICDCCSDMSTCCCGFWCFPCMQCQTASQFGWCFCMPLLDCCMVVSC-CLRKKMREQYSINGSCCDDFCTLCFCYPCAWCQMSREIK-TRARSGTTA 116          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Zebrafish
Match: ponzr1 (plac8 onzin related protein 1 [Source:ZFIN;Acc:ZDB-GENE-070727-1])

HSP 1 Score: 62.7734 bits (151), Expect = 7.255e-12
Identity = 42/116 (36.21%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  379 TTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCS---SCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLA 717
            +T ++     SSG   W++GIC C  DM +CCC   C  C   +  S++G C C     CC+  +   LR + R ++ I+GS  +D CT  FCY  + CQM R++    A  GT A
Sbjct:    5 STTVVSTQRTSSG--TWTTGICDCCSDMSTCCCGFWCFPCMQCQTASQFGWCFCMPLLDCCMVVSC-CLRKKMREQYSINGSCCDDFCTLCFCYPCAWCQMSREIK-TRARSGTTA 116          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Xenopus
Match: abtb1 (ankyrin repeat and BTB (POZ) domain containing 1 [Source:Xenbase;Acc:XB-GENE-976579])

HSP 1 Score: 56.6102 bits (135), Expect = 1.189e-9
Identity = 35/107 (32.71%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  364 SYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            SYP        Q  ++S    W+S +  C +DM  C C    P     ++   +GECCC   C+  ++ A+R   R R+ I GSI ND     FC   + CQM R++
Sbjct:    2 SYPIGAQPQGVQGYVTSNSSQWNSDVFDCCEDMGICLCGTFVPCILACKVSQDFGECCCLP-CLFGSVLAVRTGIRERYHIEGSICNDWVCLSFCGQCTLCQMAREL 107          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000008293.1 (novel protein similar to cornifelin [Source:NCBI gene;Acc:733751])

HSP 1 Score: 55.0694 bits (131), Expect = 4.866e-9
Identity = 35/108 (32.41%), Postives = 48/108 (44.44%), Query Frame = 1
Query:  379 TTVIIQQPNISSGGRL-----WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            T  +I QP    G        W+S    CF D+  C C    P C   ++   YGECCC    +   + ALR   R R+ I G+I  D     FC   + CQM R+++
Sbjct:    7 TQTVIFQPQAVQGYTTSKFGQWNSDTFDCFRDVGICLCGAFFPMCVACKVAQDYGECCCLP-LMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 113          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 55.0694 bits (131), Expect = 6.055e-9
Identity = 36/106 (33.96%), Postives = 49/106 (46.23%), Query Frame = 1
Query:  382 TVIIQ----QPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            TVI Q    Q   +S    W+S    CF D+  C C    P C   ++   YGECCC    +   + ALR   R R+ I G+I  D     FC   + CQM R+++
Sbjct:   19 TVIFQPQAVQGYTTSKFGQWNSDTFDCFRDVGICLCGAFFPMCVACKVAQDYGECCCLP-LMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 123          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Xenopus
Match: myo19 (myosin XIX [Source:Xenbase;Acc:XB-GENE-999897])

HSP 1 Score: 54.299 bits (129), Expect = 7.600e-9
Identity = 36/127 (28.35%), Postives = 55/127 (43.31%), Query Frame = 1
Query:  307 NEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            ++ I  QP A PG +                   +S    W+S +  C  D+  C C    P C   ++   YGECCC    +   + A+R   R R++I G+I ND     FC   + CQM R+++
Sbjct:    2 SQAISSQPQAVPGCT-------------------NSNTNRWNSDVFDCCQDLGICLCGTFLPLCLACKVAQDYGECCCLP-VLNGTIIAMRTGIRERYQIPGTICNDCVCLTFCGPCTLCQMARELN 108          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 53.9138 bits (128), Expect = 1.195e-8
Identity = 39/140 (27.86%), Postives = 58/140 (41.43%), Query Frame = 1
Query:  268 KSFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            +S  N  +   +  + ++ QP A  G +    S  GQ                W+S    CF D+  C C    P C   ++   YGECCC    +   + ALR   R R+ I G+I  D     FC   + CQM R+++
Sbjct:    2 ESMGNYLSIIQNILDNVIFQPQAVQGYTT---SKFGQ----------------WNSDTFDCFRDVGICLCGAFFPMCVACKVAQDYGECCCLP-LMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 121          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Mouse
Match: Cnfn (cornifelin [Source:MGI Symbol;Acc:MGI:1919633])

HSP 1 Score: 62.3882 bits (150), Expect = 7.061e-12
Identity = 31/86 (36.05%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L +LR   R R+ I GS+ +D     FC   + CQM R++
Sbjct:   23 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAP-YLPGGLHSLRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 107          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Mouse
Match: Cnfn (cornifelin [Source:MGI Symbol;Acc:MGI:1919633])

HSP 1 Score: 62.3882 bits (150), Expect = 8.875e-12
Identity = 31/86 (36.05%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L +LR   R R+ I GS+ +D     FC   + CQM R++
Sbjct:   36 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAP-YLPGGLHSLRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 120          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Mouse
Match: Plac8l1 (PLAC8-like 1 [Source:MGI Symbol;Acc:MGI:1916651])

HSP 1 Score: 63.5438 bits (153), Expect = 1.225e-11
Identity = 45/158 (28.48%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  253 MSYEKKSFSN--KFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRL-----------WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            MS+    FS   K  S   ++ P+    P+     +          V+++QP   + GR            WS+G+ S   D + C   +LCP C    +   YGEC C    +P + FALRI  R RH+I G++  D      C+  S CQ+ R++ 
Sbjct:    1 MSWMGHHFSRWCKDISVLSSHLPLFSPMPSEDEHLISNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGGDWSTGLFSVCRDRKICFWGLLCPMCLECDIARHYGECLCWPL-LPGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVARELK 157          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 59.3066 bits (142), Expect = 8.846e-11
Identity = 35/104 (33.65%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  382 TVIIQQPNISSG--GRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            TVI+ QP          W + +C CF D   C C   C TC   ++ +   ECC     +     A+R  +R R+ I GSI +D    +FC   S CQ+KRD++
Sbjct:    6 TVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECC-----LCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 59.3066 bits (142), Expect = 8.846e-11
Identity = 35/104 (33.65%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  382 TVIIQQPNISSG--GRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            TVI+ QP          W + +C CF D   C C   C TC   ++ +   ECC     +     A+R  +R R+ I GSI +D    +FC   S CQ+KRD++
Sbjct:    6 TVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECC-----LCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Plac8 onzin related protein 1 vs. UniProt/SwissProt
Match: sp|A1L4L8|PL8L1_HUMAN (PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PLAC8L1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.077e-12
Identity = 47/146 (32.19%), Postives = 67/146 (45.89%), Query Frame = 1
Query:  250 KMSYEKKSFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
             MS E + F +       A+  +++QP       V   S     T I+Q    + GG  WS+G+ S   D   C C + CP C    +   YGEC C    +P + FALRI  R RHKI G++  D      C+  S CQ+ R++ 
Sbjct:   27 HMSSEDEHFISNLRGHVPAS-AVVKQP-------VRGASGRTTITAIVQ----TGGG--WSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPL-LPGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELK 157          
BLAST of Plac8 onzin related protein 1 vs. UniProt/SwissProt
Match: sp|Q0VBW2|CNFN_BOVIN (Cornifelin OS=Bos taurus OX=9913 GN=CNFN PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.241e-11
Identity = 32/86 (37.21%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L +LR   R R++I GSI  D     FC   + CQM R++
Sbjct:   23 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCTP-YLPGGLHSLRTGMRERYRIQGSIGKDWAALTFCLPCALCQMAREL 107          
BLAST of Plac8 onzin related protein 1 vs. UniProt/SwissProt
Match: sp|Q6PCW6|CNFN_MOUSE (Cornifelin OS=Mus musculus OX=10090 GN=Cnfn PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.939e-11
Identity = 31/86 (36.05%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L +LR   R R+ I GS+ +D     FC   + CQM R++
Sbjct:   23 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAP-YLPGGLHSLRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 107          
BLAST of Plac8 onzin related protein 1 vs. UniProt/SwissProt
Match: sp|Q08EJ0|PL8L1_MOUSE (PLAC8-like protein 1 OS=Mus musculus OX=10090 GN=Plac8l1 PE=2 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 8.567e-11
Identity = 45/158 (28.48%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  253 MSYEKKSFSN--KFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRL-----------WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            MS+    FS   K  S   ++ P+    P+     +          V+++QP   + GR            WS+G+ S   D + C   +LCP C    +   YGEC C    +P + FALRI  R RH+I G++  D      C+  S CQ+ R++ 
Sbjct:    1 MSWMGHHFSRWCKDISVLSSHLPLFSPMPSEDEHLISNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGGDWSTGLFSVCRDRKICFWGLLCPMCLECDIARHYGECLCWPL-LPGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVARELK 157          
BLAST of Plac8 onzin related protein 1 vs. UniProt/SwissProt
Match: sp|Q9BYD5|CNFN_HUMAN (Cornifelin OS=Homo sapiens OX=9606 GN=CNFN PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.054e-10
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDM 684
            W +G+  C +DM  C C    P C   R+   +GECCC+   +P  L ++R   R R+ I GS+ +D     FC   + CQM R++
Sbjct:   24 WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAP-YLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 108          
BLAST of Plac8 onzin related protein 1 vs. TrEMBL
Match: A0A0P0DI19 (Placenta specific protein 8 OS=Dugesia japonica OX=6161 GN=Plac 8 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 7.905e-26
Identity = 60/118 (50.85%), Postives = 77/118 (65.25%), Query Frame = 1
Query:  370 PGQTT--VIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYC-LSACQMKRDMDYVVATKGTL 714
            PG+T+  V+I QP      R+WSS ICSCF+D+E C      P CY   +Y  Y EC CSS  VPN+L ALRIQHRNRH I G+I +D C    CY   + CQ+KRDM ++++TKG+L
Sbjct:   18 PGKTSENVVISQPK---SERMWSSEICSCFEDIEICLWSTFFPQCYLCCMYMEYNECFCSSLLVPNSLMALRIQHRNRHGIKGTICDD-CIKSTCYGPCTMCQLKRDMKHIISTKGSL 131          
BLAST of Plac8 onzin related protein 1 vs. TrEMBL
Match: A0A4Z2DCA3 (Cornifelin OS=Schistosoma japonicum OX=6182 GN=EWB00_002377 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.434e-22
Identity = 50/112 (44.64%), Postives = 72/112 (64.29%), Query Frame = 1
Query:  388 IIQQP---NISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVP---NALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATK 705
            ++ QP      +  R W+SG+C+CFDD+ +CC V+ CP CY   LY++ GE    SC VP     +  LRI+HR  HKI G+++ND+C   FC  L+ CQ+KRD+DYV +T+
Sbjct:    7 VVHQPVAMQRQTFEREWNSGLCACFDDLPTCCLVLFCPQCYMCYLYNKEGE----SCWVPFCGAGILPLRIKHRIMHKIMGTLINDVCITCFCGPLAVCQLKRDIDYVKSTR 114          
BLAST of Plac8 onzin related protein 1 vs. TrEMBL
Match: A0A3Q0KMC6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.903e-22
Identity = 48/109 (44.04%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  388 IIQQPNI---SSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATK 705
            ++QQP      +  R WSSG+C+CFDD+ +CC V+ CP CY   LY++ GE C    C    +  LRI+HR  H+I G+++ND+CT  FC  L+ CQ+KRD+DY  + +
Sbjct:    7 VVQQPTSIQRQTSEREWSSGLCACFDDLPTCCLVLFCPHCYMCYLYNKEGESCWIPVC-GAGILPLRIKHRIMHEIMGTLMNDVCTTCFCGQLAICQLKRDIDYTKSIR 114          
BLAST of Plac8 onzin related protein 1 vs. TrEMBL
Match: A0A5J4NRE5 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0010981 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.061e-20
Identity = 55/157 (35.03%), Postives = 80/157 (50.96%), Query Frame = 1
Query:  253 MSYEKKSFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNIS--SGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLA 717
            M Y++K     +      + P    P A P +S      P Q  VI+ QP  +  +G R W  G+CSC ++  +C        C    +Y RYGECCC+ C +P +   L ++HR+RH+I GSI  D CT + C   + C++ RDM YV    GTL+
Sbjct:    1 MDYQEKVPPPPYPGMASTSVPKASAPTATPLLS-----QPNQINVIVNQPEPTRGTGYRDWHDGLCSCGNNCGNCLLTAFFYPCVECHMYQRYGECCCTPCVIPMSGMVLAVKHRSRHRIVGSISGDCCTFMCCAPCALCRLYRDMVYVEGVNGTLS 152          
BLAST of Plac8 onzin related protein 1 vs. TrEMBL
Match: G7Y8A7 (PLAC8-like protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_102652 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.341e-20
Identity = 52/137 (37.96%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  310 EPILQQPPAYPGVSVGQPSYPGQTTVIIQQPN--ISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTL 714
            +P+ Q PPA P V+V           I++QP   +S G R W  G+C C ++  +C    L   C    +Y  YGECCC+   VP A   L ++HR+RH+I GS+  D CT + C   + C++ RDM +V A KG+L
Sbjct:   35 QPLYQTPPAVPTVNV-----------IVEQPKPVVSEGYRDWKDGLCDCGNNCGNCILTALFYPCMVCHMYKLYGECCCTPLVVPMADMVLSVKHRSRHRIVGSVAGDCCTFMCCGPCALCRLYRDMTFVEALKGSL 160          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 62.7734 bits (151), Expect = 1.054e-11
Identity = 39/114 (34.21%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  382 TVIIQ----QPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCC-------VPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDY 690
            TVI+Q    QP  +     WSSGIC C +DM  CC    CP C       +YGEC C           +P   +++R   R R+ I GS+ +D C +  C   + CQ+ R++ Y
Sbjct:    5 TVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 62.7734 bits (151), Expect = 1.054e-11
Identity = 39/114 (34.21%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  382 TVIIQ----QPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCC-------VPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDY 690
            TVI+Q    QP  +     WSSGIC C +DM  CC    CP C       +YGEC C           +P   +++R   R R+ I GS+ +D C +  C   + CQ+ R++ Y
Sbjct:    5 TVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 62.003 bits (149), Expect = 1.193e-11
Identity = 39/114 (34.21%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  382 TVIIQ----QPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCC-------VPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDY 690
            TVI+Q    QP  +     WSSGIC C +DM  CC    CP C       +YGEC C           +P   +++R   R R+ I GS+ +D C +  C   + CQ+ R++ Y
Sbjct:    5 TVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Cavefish
Match: ponzr2 (cornifelin homolog [Source:NCBI gene;Acc:103025611])

HSP 1 Score: 63.1586 bits (152), Expect = 1.203e-11
Identity = 38/111 (34.23%), Postives = 55/111 (49.55%), Query Frame = 1
Query:  379 TTVIIQQPNISSGGRL---WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSC-----CVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            T V+I  P++    R+   W SGIC C DD+  CC    C  C+       YG+C C         VP A  ++R+  R+R+ I G++ ND   A  C   + CQM R+M+
Sbjct:   43 TKVVITPPSMVLESRVSDEWGSGICDCCDDVPECCFAFWCCPCFACIKTKEYGQCLCLPLLDICGIVPAATLSMRVSMRHRYGIKGTLCNDCLIATCCTSCAWCQMSREMN 153          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 61.6178 bits (148), Expect = 1.732e-11
Identity = 39/114 (34.21%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  382 TVIIQ----QPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGEC-------CCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDY 690
            TVI+Q    QP  +     WSSGIC C +DM  CC    CP C       +YGEC        C    +P   +++R   R R+ I GS+ +D C +  C   + CQ+ R++ Y
Sbjct:    5 TVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009354.1 (pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 gene:ENSPMAG00000008464.1 transcript:ENSPMAT00000009354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 6.811e-13
Identity = 37/109 (33.94%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  376 QTTVIIQQPNISS----GGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDY 690
            Q  V++ QP   +    G   WSS +  CF D E C C   C      ++ S +GEC C    +P AL ALR   R RH I G++ +D  +   C   + CQM R++ +
Sbjct:    2 QPPVLVTQPVAHTVNVQGQAQWSSHMMDCFQDTEICVCGFFCLPLLQCKVASDFGECFCVP-MLPGALMALRTGIRERHHIEGTVFDDFVSLWCCNHCTTCQMARELRH 109          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001184.1 (pep scaffold:Pmarinus_7.0:GL488356:6425:7851:-1 gene:ENSPMAG00000001063.1 transcript:ENSPMAT00000001184.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.188e-8
Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  475 CVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDY 690
            C + C  C   R+   +GEC C    +P +  ALR   R R+ I GSI +D     FC+C + CQM R++ +
Sbjct:   13 CGIFCMLCLNCRMAKDFGECFCLPI-LPGSSMALRTAIRERYHIQGSICDDCVMLTFCFCCATCQMAREIKH 83          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Nematostella
Match: EDO42647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V8])

HSP 1 Score: 60.077 bits (144), Expect = 1.663e-11
Identity = 39/109 (35.78%), Postives = 50/109 (45.87%), Query Frame = 1
Query:  370 PGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPN-ALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYV 693
            PG TT  I Q       R WSSG+  C  D+  C    LCP     ++  R GE     CC  + A F LR + R    I GS+ ND      C   + CQM R++D+V
Sbjct:   17 PGTTTYTIGQQ------RDWSSGLFECTKDIGGCLVTFLCPCVTLCQISQRMGEGLAYGCCCADIAAFTLRAKLRTEQNIQGSLCNDAIHVSCCMHCALCQMSRELDHV 119          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Nematostella
Match: EDO42612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W1])

HSP 1 Score: 56.9954 bits (136), Expect = 4.121e-10
Identity = 39/92 (42.39%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  421 RLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCL-SACQMKRDMDYV 693
            R W SG+C CFDD+ SC     CP      +  R GE CC  CC P AL  LR++ R    I GS++ND C AV C  L   CQ+ R++ ++
Sbjct:   52 RDWHSGMCGCFDDIGSCLLGYFCPCFLLIDVSQRMGEGCCFPCCCPGALVGLRVKLRVEQNIQGSLINDYC-AVQCLPLCVLCQLSRELKHL 142          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Medaka
Match: plac8l1 (PLAC8 like 1 [Source:NCBI gene;Acc:101175585])

HSP 1 Score: 67.0106 bits (162), Expect = 5.578e-13
Identity = 39/122 (31.97%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  370 PGQTTVIIQQPNIS----------SGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATK 705
            P    V++ QP +             G  WS+G+ + + D  +C    L P C    L  +YGEC C    +P + FA+R+  R R+KI GS+  D      CY L+ CQM R+M   + T+
Sbjct:   42 PAVEDVVLTQPGLGVTTTTITTITQTGGNWSTGLFNIWGDKTTCLLGALVPCCLDLSLAHQYGECLCLPL-LPGSTFAIRVGIRERYKIQGSVCEDWTAVYCCYPLAVCQMIREMKQRMKTQ 162          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Medaka
Match: ponzr3 (cornifelin homolog A [Source:NCBI gene;Acc:101160195])

HSP 1 Score: 65.4698 bits (158), Expect = 6.310e-13
Identity = 40/110 (36.36%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  382 TVIIQQPN---ISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCC-----SSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            TV   QP     +S    WSSGIC CFDD+ SCC    C  C+      + GEC C        C+P    A+R+  R ++ I G+I  D   + FC   S CQ+ R+M 
Sbjct:    4 TVKTTQPRPYITTSTSNEWSSGICDCFDDLRSCCFAFWCFPCFACITSKKAGECLCLPLLDGFGCIPPITTAMRVSIRKQYGIEGTICRDCVFSFFCGPCSWCQISREMK 113          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028572.1 (cornifelin homolog [Source:NCBI gene;Acc:101172524])

HSP 1 Score: 56.6102 bits (135), Expect = 8.723e-10
Identity = 39/120 (32.50%), Postives = 57/120 (47.50%), Query Frame = 1
Query:  385 VIIQQPNISSGGR-----LWSSGICSCFDDMESCCCVMLCP---TCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 720
            V+  QP     G       WS+G+CSCF+D   C     CP   +CYTA    +YGE  C   CVP  + A+R   R  + I G++ ND   A+  +C   C+M R    +    G +++
Sbjct:    5 VVTHQPGAGGYGTNVQTGEWSTGLCSCFNDCLICALGFFCPAGLSCYTAH---KYGENFCLG-CVPGGMTAMRTHMRLTYGIQGTVCND---AIMVFCCGLCEMCRMAREIRIRNGEVSI 117          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031234.1 (cornifelin homolog B-like [Source:NCBI gene;Acc:105356361])

HSP 1 Score: 56.9954 bits (136), Expect = 1.067e-9
Identity = 37/110 (33.64%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  379 TTVIIQ-QPNIS-SGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSC-----CVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            T +++Q QP I       WS+G+C C+ DM  CC  + C   +T ++    G C C        CVP A  A+R   R R+ I GS  +D      CY LS  Q+ R++ 
Sbjct:    3 TRLVVQLQPRIRVQEAEQWSTGLCECYKDMGDCCFALCCLPVFTCKVTRAAGACPCLPLLDCIGCVPPASLAMRASVRERYGIKGSAWSDCWYGCCCYTLSWLQISRELK 112          
BLAST of Plac8 onzin related protein 1 vs. Ensembl Medaka
Match: ponzr1 (cornifelin homolog B [Source:NCBI gene;Acc:110017082])

HSP 1 Score: 55.8398 bits (133), Expect = 2.373e-9
Identity = 35/91 (38.46%), Postives = 47/91 (51.65%), Query Frame = 1
Query:  427 WSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCC----SSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMD 687
            WS+G+C C  D+ +CCC M C  C   +   ++G CC       C V   L  LR   R RH I GS ++D C  +FCY    CQM R++ 
Sbjct:   40 WSTGMCECCADVGTCCCAMWCFPCMQCQTAQKHGWCCAMPLLDICGVVTCL--LRSSIRERHHIPGSCIDDCCKCMFCYPCVWCQMHREVK 128          
BLAST of Plac8 onzin related protein 1 vs. Planmine SMEST
Match: SMESG000050229.1 (SMESG000050229.1)

HSP 1 Score: 317.39 bits (812), Expect = 2.674e-110
Identity = 155/156 (99.36%), Postives = 155/156 (99.36%), Query Frame = 1
Query:  253 MSYEKKSFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 720
            MSYEK SFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM
Sbjct:    1 MSYEK-SFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 155          
BLAST of Plac8 onzin related protein 1 vs. Planmine SMEST
Match: SMESG000050221.1 (SMESG000050221.1)

HSP 1 Score: 237.654 bits (605), Expect = 5.766e-79
Identity = 113/150 (75.33%), Postives = 127/150 (84.67%), Query Frame = 1
Query:  280 NKFNSADDANEPILQQPPAYPGVSVGQPSY---PGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 720
            NKF+  DD+ +PILQQPP YPG+S  Q SY    GQTTVIIQQP+IS+GGRLWSSGICSCFDDMESCCC +L PTCY  RLYSRY EC CSSCC+PNALFALRIQHRNRHK+SG+ILND  TA +CY  + CQ+KRDMDYVVATKG+LAM
Sbjct:    2 NKFSRIDDSTDPILQQPPEYPGISTHQTSYVGNHGQTTVIIQQPSISTGGRLWSSGICSCFDDMESCCCTILLPTCYIGRLYSRYNECICSSCCIPNALFALRIQHRNRHKVSGTILNDCMTASWCYLCAVCQLKRDMDYVVATKGSLAM 151          
BLAST of Plac8 onzin related protein 1 vs. Planmine SMEST
Match: SMESG000050216.1 (SMESG000050216.1)

HSP 1 Score: 146.747 bits (369), Expect = 1.690e-43
Identity = 80/145 (55.17%), Postives = 99/145 (68.28%), Query Frame = 1
Query:  298 DDANEPILQQPPAYPG----VSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 720
            +D      ++PP Y G    V   QP   GQTTVI+QQ   + GGR WSS +CSC DDMESCCCV      YT  L S+YGECCC++C +P  + ALRIQHRNRHKI G++LND CT+++C     CQ+KRDMDYV+ATKGTL +
Sbjct:    2 NDPYNKFQEKPPGYGGEFQPVIQNQPYAGGQTTVIVQQTTQNIGGRDWSSPMCSCCDDMESCCCVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 146          
BLAST of Plac8 onzin related protein 1 vs. Planmine SMEST
Match: SMESG000050210.1 (SMESG000050210.1)

HSP 1 Score: 135.576 bits (340), Expect = 2.944e-39
Identity = 70/133 (52.63%), Postives = 89/133 (66.92%), Query Frame = 1
Query:  325 QPPAYPGVSVGQPSYPGQT---TVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTL 714
            Q   +P V+     +  Q+   TVIIQQ   +   R W+SG+C+C DDMESCCCV  CP CY   +Y +Y ECCC++C V  +   LRIQHRNRHKI GSILND CT + C   S CQ+KRDM+YV++TKG+L
Sbjct:    7 QATVFPVVTQPAQVFSLQSVPQTVIIQQQ--AENKRQWNSGLCACIDDMESCCCVAFCPYCYLCHMYCQYDECCCTACLVGCSPMILRIQHRNRHKIMGSILNDCCTTLCCMQCSICQLKRDMNYVISTKGSL 137          
BLAST of Plac8 onzin related protein 1 vs. Planmine SMEST
Match: SMESG000050208.1 (SMESG000050208.1)

HSP 1 Score: 129.798 bits (325), Expect = 4.645e-37
Identity = 62/113 (54.87%), Postives = 77/113 (68.14%), Query Frame = 1
Query:  376 QTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTL 714
            QT +  QQ   +S  R WSSG+C+CFDD+ESCCCVM  P CY   LY RY ECCC+ CC+      L +QHRNRHKI G+I ND   +  CY  S C++KRDMD+V+ TKG+L
Sbjct:   19 QTVITTQQFITTSLVRNWSSGLCACFDDLESCCCVMCFPHCYVCHLYMRYDECCCTGCCLMGNPIYLAVQHRNRHKIQGTIFNDCLESFLCYQCSICRLKRDMDHVMNTKGSL 131          
The following BLAST results are available for this feature:
BLAST of Plac8 onzin related protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLAC8L11.265e-1232.19PLAC8 like 1 [Source:HGNC Symbol;Acc:HGNC:31746][more]
CNFN2.195e-1134.88cornifelin [Source:HGNC Symbol;Acc:HGNC:30183][more]
CNFN2.195e-1134.88cornifelin [Source:HGNC Symbol;Acc:HGNC:30183][more]
PLAC81.482e-829.46placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC81.482e-829.46placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr103.450e-1232.48plac8 onzin related protein 10 [Source:ZFIN;Acc:ZD... [more]
BX005027.23.479e-1232.48plac8 onzin related protein 10 [Source:NCBI gene;A... [more]
ponzr17.255e-1236.21plac8 onzin related protein 1 [Source:ZFIN;Acc:ZDB... [more]
ponzr17.255e-1236.21plac8 onzin related protein 1 [Source:ZFIN;Acc:ZDB... [more]
ponzr17.255e-1236.21plac8 onzin related protein 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abtb11.189e-932.71ankyrin repeat and BTB (POZ) domain containing 1 [... [more]
ENSXETT00000008293.14.866e-932.41novel protein similar to cornifelin [Source:NCBI g... [more]
ifi356.055e-933.96interferon induced protein 35 [Source:Xenbase;Acc:... [more]
myo197.600e-928.35myosin XIX [Source:Xenbase;Acc:XB-GENE-999897][more]
ifi351.195e-827.86interferon induced protein 35 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnfn7.061e-1236.05cornifelin [Source:MGI Symbol;Acc:MGI:1919633][more]
Cnfn8.875e-1236.05cornifelin [Source:MGI Symbol;Acc:MGI:1919633][more]
Plac8l11.225e-1128.48PLAC8-like 1 [Source:MGI Symbol;Acc:MGI:1916651][more]
Plac88.846e-1133.65placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac88.846e-1133.65placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1L4L8|PL8L1_HUMAN6.077e-1232.19PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PL... [more]
sp|Q0VBW2|CNFN_BOVIN1.241e-1137.21Cornifelin OS=Bos taurus OX=9913 GN=CNFN PE=3 SV=1[more]
sp|Q6PCW6|CNFN_MOUSE4.939e-1136.05Cornifelin OS=Mus musculus OX=10090 GN=Cnfn PE=1 S... [more]
sp|Q08EJ0|PL8L1_MOUSE8.567e-1128.48PLAC8-like protein 1 OS=Mus musculus OX=10090 GN=P... [more]
sp|Q9BYD5|CNFN_HUMAN1.054e-1034.88Cornifelin OS=Homo sapiens OX=9606 GN=CNFN PE=1 SV... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P0DI197.905e-2650.85Placenta specific protein 8 OS=Dugesia japonica OX... [more]
A0A4Z2DCA31.434e-2244.64Cornifelin OS=Schistosoma japonicum OX=6182 GN=EWB... [more]
A0A3Q0KMC61.903e-2244.04Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5J4NRE51.061e-2035.03Uncharacterized protein OS=Paragonimus westermani ... [more]
G7Y8A75.341e-2037.96PLAC8-like protein 1 OS=Clonorchis sinensis OX=799... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr61.054e-1134.21cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr61.054e-1134.21cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr61.193e-1134.21cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr21.203e-1134.23cornifelin homolog [Source:NCBI gene;Acc:103025611... [more]
ponzr61.732e-1134.21cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009354.16.811e-1333.94pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 g... [more]
ENSPMAT00000001184.13.188e-836.11pep scaffold:Pmarinus_7.0:GL488356:6425:7851:-1 ge... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO426471.663e-1135.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426124.121e-1042.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plac8l15.578e-1331.97PLAC8 like 1 [Source:NCBI gene;Acc:101175585][more]
ponzr36.310e-1336.36cornifelin homolog A [Source:NCBI gene;Acc:1011601... [more]
ENSORLT00000028572.18.723e-1032.50cornifelin homolog [Source:NCBI gene;Acc:101172524... [more]
ENSORLT00000031234.11.067e-933.64cornifelin homolog B-like [Source:NCBI gene;Acc:10... [more]
ponzr12.373e-938.46cornifelin homolog B [Source:NCBI gene;Acc:1100170... [more]
back to top
BLAST of Plac8 onzin related protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050229.12.674e-11099.36SMESG000050229.1[more]
SMESG000050221.15.766e-7975.33SMESG000050221.1[more]
SMESG000050216.11.690e-4355.17SMESG000050216.1[more]
SMESG000050210.12.944e-3952.63SMESG000050210.1[more]
SMESG000050208.14.645e-3754.87SMESG000050208.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027672 ID=SMED30027672|Name=Plac8 onzin related protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=967bp
GCGAAATTTCAATATAAAATCCAATCAATAATTGACATGTCAAACAAATG
GTGAAAAATTCAAACGTGAAGATTTCCAAAACCTCGTTAATAAAAGTACA
TACTGGATTATTCAGAATATTCGCAAGTCATGTTAGTCGGTGTGTCATGT
CTAGATAAACCAGTCAACCAATCAGATTCCAAATAATCTTGTTGACAAAA
CATTGTAAGAAAATTTCAGTATTTCTCAGAATTAGGAAATTGTTAAGAAA
AAATGAGTTACGAAAAAAAAAGCTTTTCGAATAAATTTAATTCTGCTGAT
GATGCCAATGAACCAATTCTACAACAGCCTCCTGCGTATCCTGGAGTTTC
AGTTGGGCAACCATCATATCCTGGACAAACTACAGTGATCATTCAACAAC
CGAACATTAGTTCAGGAGGCCGATTGTGGAGTTCTGGAATATGTTCATGT
TTTGATGACATGGAGTCTTGCTGTTGTGTTATGTTGTGTCCAACTTGTTA
CACTGCACGTTTGTATTCCAGATATGGTGAATGCTGTTGCAGTTCTTGTT
GTGTTCCAAATGCATTATTTGCTTTGAGGATTCAACACAGAAATCGACAT
AAAATATCGGGTTCGATTTTAAATGATATGTGCACAGCAGTCTTTTGTTA
CTGTCTCTCCGCTTGCCAGATGAAACGCGACATGGATTATGTAGTCGCTA
CCAAAGGAACATTAGCTATGTAGATAAAATCTGAATTTTAATGTATGTAA
TAATAATTGGTTATTGTATTAACTTGCTACAAAAGAAATGATTTGTTGAT
TATAATACCTCAACGTAAACATTTCAATTTATTTTGTGTTAGAACAACAC
AATTCATTTACGTAGCGATATTATATTTCGCCTATTCATAATTTTGATAG
CAAAATTATATTTTAATGTCTAGTATATGTTATAATAAAATAAATGTTAT
TTCTGTTTTTAAAAAAA
back to top

protein sequence of SMED30027672-orf-1

>SMED30027672-orf-1 ID=SMED30027672-orf-1|Name=SMED30027672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MSYEKKSFSNKFNSADDANEPILQQPPAYPGVSVGQPSYPGQTTVIIQQP
NISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCC
VPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVAT
KGTLAM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035775pronephric glomerulus morphogenesis
GO:0048703embryonic viscerocranium morphogenesis
GO:0072078nephron tubule morphogenesis
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 57..143
e-value: 2.2E-15
score: 55.3
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 58..141
e-value: 9.9E-13
score: 48.9
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 41..145
NoneNo IPR availablePANTHERPTHR15907:SF93PLACENTA-SPECIFIC 8, TANDEM DUPLICATE 1-RELATEDcoord: 41..145