Metalloendopeptidase

Overview
NameMetalloendopeptidase
Smed IDSMED30027667
Length (bp)4244
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metalloendopeptidase (SMED30027667) t-SNE clustered cells

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30027667) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metalloendopeptidase (SMED30027667) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30027667) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027667

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30027667SMESG000074510.1 SMESG000074509.1 dd_Smed_v4_2307_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30027667SMESG000074510.1 SMESG000074509.1 dd_Smed_v6_2307_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027667SMESG000074510.1 SMESG000074509.1 dd_Smed_v6_2307_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL2 (tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844])

HSP 1 Score: 72.7886 bits (177), Expect = 4.222e-12
Identity = 60/183 (32.79%), Postives = 89/183 (48.63%), Query Frame = 2
Query:   86 SNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            + L+    T +      S R +RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G   HELGHV+G  HEHTRP R+Q + + R+ IQ G E  + + +  E++S    YD  S+MHY   +FS
Sbjct:  127 TTLLHSPGTLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGN-FTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGK-NCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFS 307          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: MEP1B (meprin A subunit beta [Source:HGNC Symbol;Acc:HGNC:7020])

HSP 1 Score: 72.4034 bits (176), Expect = 5.057e-12
Identity = 69/239 (28.87%), Postives = 120/239 (50.21%), Query Frame = 2
Query:   80 LHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESV-FNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLH--YKCADLCERKVSC 787
            ++  L + L   +I L  + IR+    I  +  +W + TIPY +++S+  N + +  + +A + + ++TC+ F+    E  N++ +  G+ C S VG    G+Q LS+ + +C    T  HE  H LG  HE +R  R+ ++ +  D+I  G E  +N       +S N+PYD  SVMHY   +F  +  +PTI  + S      E+V  + + F D  ++ L+  Y C+       SC
Sbjct:   40 INEGLGLDLFEGDIRLDRAQIRNS---IIGEKYRWPH-TIPYVLEDSLEMNAKGV--ILNAFERYRLKTCIDFKPWAGE-TNYISVFKGSGCWSSVGNRRVGKQELSIGA-NCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQ-NGTEPTIVTRISD----FEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSC 265          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: MEP1B (meprin A subunit beta [Source:HGNC Symbol;Acc:HGNC:7020])

HSP 1 Score: 72.4034 bits (176), Expect = 5.183e-12
Identity = 68/238 (28.57%), Postives = 118/238 (49.58%), Query Frame = 2
Query:   80 LHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLH--YKCADLCERKVSC 787
            ++  L + L   +I L  + IR+    I  +  +W + TIPY +++S+  +     + +A + + ++TC+ F+    E  N++ +  G+ C S VG    G+Q LS+ + +C    T  HE  H LG  HE +R  R+ ++ +  D+I  G E  +N       +S N+PYD  SVMHY   +F  +  +PTI  + S      E+V  + + F D  ++ L+  Y C+       SC
Sbjct:   40 INEGLGLDLFEGDIRLDRAQIRNS---IIGEKYRWPH-TIPYVLEDSL-EMNAKGVILNAFERYRLKTCIDFKPWAGE-TNYISVFKGSGCWSSVGNRRVGKQELSIGA-NCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQ-NGTEPTIVTRISD----FEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSC 265          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 70.0922 bits (170), Expect = 1.136e-11
Identity = 57/164 (34.76%), Postives = 82/164 (50.00%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + R+ IQ G E  + + +  E+NS    YD  S+MHY   +FS
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFS 305          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 71.2478 bits (173), Expect = 1.418e-11
Identity = 57/164 (34.76%), Postives = 82/164 (50.00%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + R+ IQ G E  + + +  E+NS    YD  S+MHY   +FS
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFS 305          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-33 (Zinc metalloproteinase nas-33 [Source:UniProtKB/Swiss-Prot;Acc:P55114])

HSP 1 Score: 95.9005 bits (237), Expect = 8.829e-20
Identity = 80/268 (29.85%), Postives = 134/268 (50.00%), Query Frame = 2
Query:   83 HSNLIVVLLTFNICLTLSSI--------RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKF--CQCHIPETFENRRC 856
            +S +  V+   ++ LT+S +        R KR  ++   T W+ R IPY   ++  N +  +Q+ + +  +   TC+RF        +++  + G  C+S VG    G Q +S+    C   G   HE+GH LG  HE  RP R+ ++ ++R     G E  +++   SE+N Y+LPYD  SVMHYG KSFS      T+   + +  + +   +  + SFLD+K++N  + C+++C  +++C   GY D     QC  P   E   C
Sbjct:  162 NSKIAAVMFESDMALTVSQMNKVAQNGFRVKRK-MNLNGTTWS-RNIPYRFLDTDGNWQ--SQITNGLRHYERNTCIRFSLNGGGS-DYLVFSKGEGCYSSVG-RLGGPQEISIGD-GCETLGIITHEVGHALGFWHEQARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPVDPAFINTIG--NRVEPSFLDLKLLNTAF-CSNICTNRINCQHGGYADPNNCGQCTCPTGLEGTYC 419          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: dpy-31 (Zinc metalloproteinase dpy-31 [Source:UniProtKB/Swiss-Prot;Acc:P98060])

HSP 1 Score: 94.7449 bits (234), Expect = 1.580e-19
Identity = 77/252 (30.56%), Postives = 127/252 (50.40%), Query Frame = 2
Query:  113 FNICLTLSSIRDKRAVISTQATKW-TNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDI-NWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVD-KFC-QCHIPETFENRRC 856
            +   LT    R KR  I +   +W  +R I Y  D S    E+   +  A++ W+  TC+ F++    +  N +  T    C S VG +  GE+ L   +P+C   G   HE+ H LG  HE +RP R+Q++ V  + I +  +  + + D  ++++  +PYD  S+MHY SK+FS  D   TI+   +     + + D   LSF D++++N  Y C+ +C  K+ C   GY D + C +C  P+ F  + C
Sbjct:  113 YEQALTEGKTRVKRKFIGSNLRRWDASRPIIYAFDGSHTQREQRI-IELALEHWHNITCLNFQRNDQANSGNRIVFTDVDGCASNVGRHPLGEEQLVSLAPECIRLGVIAHEVAHALGFWHEQSRPDRDQYVTVRWENIDKDSKGQFLKEDPDDVDNAGVPYDYGSIMHYRSKAFSKFDDLYTISTYVTDYQKTIGQRD--QLSFNDIRLMNKIY-CSAVCPSKLPCQRGGYTDPRRCDRCRCPDGFTGQYC 360          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-36 (Zinc metalloproteinase nas-36 [Source:UniProtKB/Swiss-Prot;Acc:Q18206])

HSP 1 Score: 94.7449 bits (234), Expect = 1.974e-19
Identity = 81/249 (32.53%), Postives = 124/249 (49.80%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNE-DINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGH-EEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCE-RKVSCPLNGYV--DKFCQCHIPETFENRRCRNKNED 874
            R +R+ +S +   W    I Y   ES+ +   ++Q+  AI  W   TC+ F    +  D ++++   G  C+S +G N  G Q +S+    C   G   HE+GH LGL HE +RP    ++ + RD I   +  +F   +D  E+++  +PYDL SVMHYGS +FS      T+  ++S     + +   + LSF DV  IN  Y C D C+  K  C   GY+   K  +C  P+     +C  KNED
Sbjct:  123 RLRRSFVSDKTATWKTMPIKYRFHESI-DFYTISQIIAAIRFWEDSTCITFENVSDSPDGDYIEFFSGQGCYSMIGRNG-GRQGISIGE-SCVKMGVIEHEIGHALGLWHEQSRPDALGYVTIERDFILPSYISDFLQRDD--EIDTLGIPYDLGSVMHYGSTAFSVDQKSKTVVTRDSLYQQTIGQ--REKLSFYDVATINTAY-CKDECKSEKTKCENGGYMRPSKCSECLCPDGLGGEKC-EKNED 362          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-30 (Zinc metalloproteinase nas-30 [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V2])

HSP 1 Score: 92.8189 bits (229), Expect = 4.928e-19
Identity = 82/274 (29.93%), Postives = 133/274 (48.54%), Query Frame = 2
Query:   65 MTLKILHSNLIVVLLTFN-ICLTLSSIRD-----KRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVD----KFCQCHIPETFENRRC 856
            +T K+  S++++ +     I L     R+     KR VI+    +W +  IP+         ++L  + + +  W  ETCVR+ +      ++V    G+ C+S VG    G Q +S+    C   G   HE+GH LG  HE +RP R+ +IH+ +D I +G +  + +    E+    +PYD+ SVMHYGS +F+    Q TI  K+S     + +   + LSF+DVK +N  Y C  +C   + C   GY D      C+C  P+    + C
Sbjct:   72 LTNKLFESDMVLTVKQMKAIVLAAQEARNPHGRKKRKVITGSVYRWKS-VIPFRFKGGDAKWKKL--IREGLGLWEKETCVRWSEN-GPGKDYVIFFRGSGCYSSVGRTG-GSQLISIGY-GCEDKGIVAHEVGHSLGFWHEQSRPDRDDYIHLRKDWIIKGTDGNFEKRSWEEIEDMGVPYDVGSVMHYGSNAFTKDWDQITIETKDSRYQGTIGQ--RQKLSFIDVKQVNRLY-CNSVCPVALPCMHGGYPDPNNCAVCKC--PDGLGGKLC 334          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-14 (Zinc metalloproteinase nas-14 [Source:UniProtKB/Swiss-Prot;Acc:Q19269])

HSP 1 Score: 88.1965 bits (217), Expect = 1.386e-17
Identity = 109/413 (26.39%), Postives = 165/413 (39.95%), Query Frame = 2
Query:  113 FNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQ--CHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKD---LSFLDVKIINLHYKCADLC--------------------------------ERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDW---CTDQKKLGNCEYNSKYMSVNCRKTCDKC--YKYKAIFDKGKKICKNFEKDKT-------------------------------------CENWAKRGECQRNPGYMNIKCKKSCGIC 1114
            F+  L L +  DK          W    +PY ++E + N ++ T +  A D +  +TCVRF  K ++D +++ +       C S+VG    G Q++SL    C   G   HEL H LG  HEH+R  R+ F+ ++ D I+ G    + +     ++S  +PYD +SVMHY   +FS  +G+PTI  K++       E D      LS +D K +N  Y+C +                                  ++KVS                     R  RNK  +D    C   ++LG+C+++ KYM+  CRK C+ C            K + +N EK+                                       C  WAK GEC     +M I CK SCG C
Sbjct:  111 FHSALNLVTYPDKL---------WPEGQVPYMLEEGMTN-DQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSYVG-RAGGNQTVSLEVDKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFS-RNGKPTIIPKDN-------EADVGQRYKLSEMDSKKVNKLYQCGEYSKTSSTTTTTTTTTTTTTTEEPTTTTEVEEKPKDKKVSSTTTTTKKPTTTTTTTPKPVER-SRNKKCEDLNAHCGMWEQLGHCQHSVKYMAHYCRKACNLCEVEVTTTTTTTPKPVPRNKEKENKSASSTTRGTSTATSTTPKTTTTTTSAPKEKCEDKNLFCSYWAKIGECNSESKFMKIFCKASCGKC 503          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: CG6696 (gene:FBgn0030947 transcript:FBtr0074611)

HSP 1 Score: 81.6481 bits (200), Expect = 4.671e-16
Identity = 54/160 (33.75%), Postives = 89/160 (55.62%), Query Frame = 2
Query:  182 WTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGG-TQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTI 658
            W    +P+YID   FN  +   +  A   ++  TC+RFR     D +W+ I G  + C S VG    G Q L+L +P C  +G  +HEL H LG  H+ +   R++++ ++ + I +GH   +N+   + + ++ + YD QSVMHY S++FS  +G+ TI
Sbjct:  105 WPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVG-RRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFS-KNGKATI 262          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: CG5715 (gene:FBgn0039180 transcript:FBtr0084634)

HSP 1 Score: 78.9518 bits (193), Expect = 2.805e-15
Identity = 74/249 (29.72%), Postives = 120/249 (48.19%), Query Frame = 2
Query:   17 TIKLYKPKTVNCKLIKMTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKI-TGGTQCHSFVGMNEEGEQSLSLASPDC-RFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKC 757
            T  L +   V   L    L   H   I++ L++            R  I   +++W    +PY I +  F  +EL  ++ A   ++ +TCVRF+ +  E  +++ I +G + C S +G    G Q ++L SP+C R YGT +HEL H LG  HE  R  R+ ++ V +D I+      + ++       + + YD  SVMHY   SF+  +GQPT+    ++ +   +    K  S  DV+ IN  YKC
Sbjct:   54 TGALVEALGVESPLNPEELGTYHEGDILIPLSYRDA----RFNGTRNGILALSSRWPGGVVPYEI-KGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEK-DYISIGSGKSGCWSSIG-RLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFT-RNGQPTLKALRAT-SDASQMGQRKGFSAGDVRKINAMYKC 293          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tld (gene:FBgn0003719 transcript:FBtr0084691)

HSP 1 Score: 78.9518 bits (193), Expect = 2.671e-14
Identity = 78/246 (31.71%), Postives = 116/246 (47.15%), Query Frame = 2
Query:   38 KTVNCKLIKMTLKILHSNLIVVLLTFNICLTLSSI---RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRF-RKKVNEDINWVKITGGT-QCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCA 760
            K+ N   +++    L ++  V +L  +   TL+     R +RAV   +   W    IPY ID ++F+         A+  W   TC++F  +  N   N++  T     C SF+G N  G Q +S+   +C  +G  +HELGH +G  HEH R  R++ I +++  I  G E  ++     E++   LPYDL S+MHY   SFS      TI          LE    K LS  D+   NL YKCA
Sbjct:   95 KSQNKAALRLPPPFLWTDDAVDVLQHSHSPTLNGQPIQRRRRAVTVRKERTWDYGVIPYEID-TIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGRQPISIGR-NCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCA 338          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: CG6763 (gene:FBgn0039069 transcript:FBtr0084378)

HSP 1 Score: 74.3294 bits (181), Expect = 1.934e-13
Identity = 64/202 (31.68%), Postives = 108/202 (53.47%), Query Frame = 2
Query:  161 ISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITG-GTQCHSFVGMNEEGEQSLSLASPDC-RFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCA 760
            + TQ+++W N  +PY I    FN  ++  + +AI  ++  TC+RF K+ +E  +++ I G  + C S VG    G+Q ++L SP C    GT +HEL H LG LHE  R  R+ ++ +  + +Q      + +   +E  ++ +PYD  SVMHY   +FS  +GQPTI    ++    + + +    S  D++ +N  Y C 
Sbjct:  110 LPTQSSRWPNGVVPYEI-RGNFNARDMATIENAIGEYHRRTCIRFVKRSSER-DYISIRGDNSGCWSSVG-RVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTE--AFGVPYDYGSVMHYSKNAFS-INGQPTILAMQANGADKMGQRNG--FSDYDIQKLNRMYDCG 303          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: CG6763 (gene:FBgn0039069 transcript:FBtr0334497)

HSP 1 Score: 74.3294 bits (181), Expect = 1.934e-13
Identity = 64/202 (31.68%), Postives = 108/202 (53.47%), Query Frame = 2
Query:  161 ISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITG-GTQCHSFVGMNEEGEQSLSLASPDC-RFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCA 760
            + TQ+++W N  +PY I    FN  ++  + +AI  ++  TC+RF K+ +E  +++ I G  + C S VG    G+Q ++L SP C    GT +HEL H LG LHE  R  R+ ++ +  + +Q      + +   +E  ++ +PYD  SVMHY   +FS  +GQPTI    ++    + + +    S  D++ +N  Y C 
Sbjct:  110 LPTQSSRWPNGVVPYEI-RGNFNARDMATIENAIGEYHRRTCIRFVKRSSER-DYISIRGDNSGCWSSVG-RVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTE--AFGVPYDYGSVMHYSKNAFS-INGQPTILAMQANGADKMGQRNG--FSDYDIQKLNRMYDCG 303          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.7221 bits (195), Expect = 1.903e-14
Identity = 60/164 (36.59%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +   L  A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  ++NS   PYD  S+MHY   +FS
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGN-FTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFS 314          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.7221 bits (195), Expect = 1.903e-14
Identity = 60/164 (36.59%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +   L  A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  ++NS   PYD  S+MHY   +FS
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGN-FTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFS 314          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.7221 bits (195), Expect = 1.903e-14
Identity = 60/164 (36.59%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +   L  A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  ++NS   PYD  S+MHY   +FS
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGN-FTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFS 314          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: mep1b (meprin A, beta [Source:ZFIN;Acc:ZDB-GENE-041014-209])

HSP 1 Score: 79.337 bits (194), Expect = 2.073e-14
Identity = 65/207 (31.40%), Postives = 111/207 (53.62%), Query Frame = 2
Query:  146 DKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLH--YKCA 760
            + R  I  +  +W   T+PY++D S+  +     +  A + + ++TC+ F K  N + N++ +  G+ C+S VG  + G+Q LS+ S +C   GT  HE  H LGL HE +R  R+ ++ +  D+IQ+G E  +N  D ++ +S  +PYD  SVMHY   SF+    +PTI  K     +++     + + F D  ++ L+  Y C 
Sbjct:   60 ESRNTILGEQYRWPT-TVPYFLDNSL-EINAKGVILKAFEQYRLKTCIDF-KPWNGESNYIFVFKGSGCYSKVGNRQMGKQELSIGS-NCDSLGTVEHEFLHALGLWHEQSRSDRDDYVIIVWDQIQDGKEHNFNLYDETQSSSLGVPYDYSSVMHYSKTSFN-KGSEPTIVTKIPEFLNVI----GQRMEFSDNDLLKLNRLYNCT 257          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: mep1b (meprin A, beta [Source:ZFIN;Acc:ZDB-GENE-041014-209])

HSP 1 Score: 78.9518 bits (193), Expect = 2.444e-14
Identity = 65/207 (31.40%), Postives = 111/207 (53.62%), Query Frame = 2
Query:  146 DKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLH--YKCA 760
            + R  I  +  +W   T+PY++D S+  +     +  A + + ++TC+ F K  N + N++ +  G+ C+S VG  + G+Q LS+ S +C   GT  HE  H LGL HE +R  R+ ++ +  D+IQ+G E  +N  D ++ +S  +PYD  SVMHY   SF+    +PTI  K     +++     + + F D  ++ L+  Y C 
Sbjct:   62 ESRNTILGEQYRWPT-TVPYFLDNSL-EINAKGVILKAFEQYRLKTCIDF-KPWNGESNYIFVFKGSGCYSKVGNRQMGKQELSIGS-NCDSLGTVEHEFLHALGLWHEQSRSDRDDYVIIVWDQIQDGKEHNFNLYDETQSSSLGVPYDYSSVMHYSKTSFN-KGSEPTIVTKIPEFLNVI----GQRMEFSDNDLLKLNRLYNCT 259          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: lrrc59 (leucine rich repeat containing 59 [Source:Xenbase;Acc:XB-GENE-963187])

HSP 1 Score: 79.337 bits (194), Expect = 3.755e-14
Identity = 64/199 (32.16%), Postives = 96/199 (48.24%), Query Frame = 2
Query:   38 KTVNCKLIKMTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            +T+    I+  + I    L+ ++   N   T   IR  RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + R+ IQ G E  + + +  E+NS    YD  S+MHY   +FS
Sbjct:   55 RTIKASFIQFII-ISGVLLLFLVAAPNSGTTHRKIRTPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTFIERTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVNSLGESYDFDSIMHYARNTFS 250          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: tcp11l2 (t-complex 11, testis-specific-like 2 [Source:Xenbase;Acc:XB-GENE-988955])

HSP 1 Score: 77.7962 bits (190), Expect = 8.757e-14
Identity = 87/323 (26.93%), Postives = 144/323 (44.58%), Query Frame = 2
Query:   71 LKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESV-FNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFE-NRRC----RNKNEDDW----------CTDQKKLGNCEYNSKYM--SVNCRKTCDKCYKYKAIF 985
            L I   N    L  F   + L+    + ++I  +  +W    +PY++++S+  N + L  + +A + + ++TC+ F+    E  N++ +   + C+S+VG   +G+Q LSL   +C    T  HE  H LG  HE +R  R+ ++ +  D+I  G E  +N  D +  NS N+PYD  SVMHY   +F  +  +PTI  K  + + ++ +    D S  D++ +N  Y C+       SC                TFE N  C       +  DW            D   LGNC+ +  YM  S +     DK      +F
Sbjct:   35 LDIFDINEGAGLDLFEGDIILADTNQRNSIIGDR-YRWP-IPVPYFLEDSLEINAKAL--VLEAFERYRLKTCIDFKPWEGEP-NYISVFKDSGCYSYVGNLRQGKQQLSLGV-NCDRIATIQHEFLHALGFWHEQSRADRDDYVTIVWDRILPGREHNFNVYDDTRSNSLNVPYDYTSVMHYSKTAFQ-NGSEPTIVTKIDAFSDVIGQ--RMDFSDYDLEKLNRLYNCSSSISFMDSC----------------TFEYNNICGMIQGTGDNSDWNHVLLSAAGPSNDHTHLGNCKDSGYYMHFSTSTGNAGDKALLESRLF 332          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: tcp11l2 (t-complex 11, testis-specific-like 2 [Source:Xenbase;Acc:XB-GENE-988955])

HSP 1 Score: 77.411 bits (189), Expect = 1.264e-13
Identity = 75/261 (28.74%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  197 IPYYIDESV-FNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFE-NRRC----RNKNEDDW----------CTDQKKLGNCEYNSKYM 931
            +PY++++S+  N + L  + +A + + ++TC+ F+    E  N++ +   + C+S+VG   +G+Q LSL   +C    T  HE  H LG  HE +R  R+ ++ +  D+I  G E  +N  D +  NS N+PYD  SVMHY   +F  +  +PTI  K  + + ++ +    D S  D++ +N  Y C+       SC                TFE N  C       +  DW            D   LGNC+ +  YM
Sbjct:   26 VPYFLEDSLEINAKAL--VLEAFERYRLKTCIDFKPWEGEP-NYISVFKDSGCYSYVGNLRQGKQQLSLGV-NCDRIATIQHEFLHALGFWHEQSRADRDDYVTIVWDRILPGREHNFNVYDDTRSNSLNVPYDYTSVMHYSKTAFQ-NGSEPTIVTKIDAFSDVIGQ--RMDFSDYDLEKLNRLYNCSSSISFMDSC----------------TFEYNNICGMIQGTGDNSDWNHVLLSAAGPSNDHTHLGNCKDSGYYM 263          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: lrrc59 (leucine rich repeat containing 59 [Source:Xenbase;Acc:XB-GENE-963187])

HSP 1 Score: 77.411 bits (189), Expect = 1.621e-13
Identity = 59/170 (34.71%), Postives = 85/170 (50.00%), Query Frame = 2
Query:  125 LTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            L +  IR  RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + R+ IQ G E  + + +  E+NS    YD  S+MHY   +FS
Sbjct:   71 LMIKKIRTPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTFIERTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVNSLGESYDFDSIMHYARNTFS 238          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007740.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 75.485 bits (184), Expect = 6.354e-13
Identity = 66/205 (32.20%), Postives = 101/205 (49.27%), Query Frame = 2
Query:   20 IKLYKPKTVNCKLIKMTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            + + K KT+N KL     K+L +      +     +  S+ R +RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R++ + + R+ IQ G E  + + +  E+NS    YD  S+MHY   +FS
Sbjct:    1 MTVIKAKTLNNKL-----KLLITEKPATEINNTFQVQKSNDRVRRAATSRTERIWPGGVIPYAIAGN-FTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFTYRPCGCCSYVGRRGGGPQAISIGK-NCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFS 198          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 73.559 bits (179), Expect = 1.802e-12
Identity = 60/175 (34.29%), Postives = 86/175 (49.14%), Query Frame = 2
Query:  110 TFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            T N      S R +RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G   HELGHV+G  HEHTRP R+Q + + R+ IQ G E  + + +  E++S    YD  S+MHY   +FS
Sbjct:  132 TSNTTAKTFSARVRRATTSRTERIWPGGVIPYVIGGN-FTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGK-NCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFS 304          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 73.559 bits (179), Expect = 2.028e-12
Identity = 60/175 (34.29%), Postives = 86/175 (49.14%), Query Frame = 2
Query:  110 TFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            T N      S R +RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G   HELGHV+G  HEHTRP R+Q + + R+ IQ G E  + + +  E++S    YD  S+MHY   +FS
Sbjct:  132 TSNTTAKTFSARVRRATTSRTERIWPGGVIPYVIGGN-FTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGK-NCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFS 304          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 71.633 bits (174), Expect = 6.648e-12
Identity = 57/164 (34.76%), Postives = 82/164 (50.00%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + R+ IQ G E  + + +  E+NS    YD  S+MHY   +FS
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFS 305          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 69.3218 bits (168), Expect = 3.561e-11
Identity = 54/160 (33.75%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  155 AVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            A  S     W +  IP+ I  + F   +      A+  W   TCV F ++ +ED   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R++ + + R+ IQ G E  + + ++ E+ S    YD  S+MHY   +FS
Sbjct:  126 AATSRPERVWPDGVIPFVIGGN-FTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFS 283          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Mep1b (meprin 1 beta [Source:MGI Symbol;Acc:MGI:96964])

HSP 1 Score: 68.5514 bits (166), Expect = 5.632e-11
Identity = 63/206 (30.58%), Postives = 107/206 (51.94%), Query Frame = 2
Query:  179 KWTNRTIPYYIDESV-FNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLH--YKCADLCERKVSC 787
            +W + TIPY +++S+  N + +  + +A + + ++TC+ F+    E  N++ +  G+ C S VG    G+Q LS+ + +C    T  HE  H LG  HE +R  R+ ++ +  D+IQ G E  +N  + S  +S N+PYD  SVMHY   +F  +  + TI  + S      E+V  + + F D  ++ L+  Y C        SC
Sbjct:   71 RWPH-TIPYVLEDSLEMNAKGV--ILNAFERYRLKTCIDFKPWSGE-ANYISVFKGSGCWSSVGNIHAGKQELSIGT-NCDRIATVQHEFLHALGFWHEQSRADRDDYVIIVWDRIQPGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAFQ-NGTESTIVTRISE----FEDVIGQRMDFSDYDLLKLNQLYNCTSSLSFMDSC 266          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|P98068|SPAN_STRPU (Protein SpAN OS=Strongylocentrotus purpuratus OX=7668 GN=SPAN PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.232e-23
Identity = 78/248 (31.45%), Postives = 126/248 (50.81%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNED------INWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADL--CERKVSCPLNGYVDKFCQCHIPETFENRRCRN 862
            R KR     ++ +W+ + IPY I+ S      L  +  A+D W   TC+RF    +         +++    G  C S VG +   +Q +S+  P C ++GT +HE+GH +G  HE +RP R+++I+VH + +Q G E  + +     + S N+ YD+ S+MHYG   FS  +G+PTI   +  L   L +  A  LS  D+++ N  Y+C D+  C     C   GY D  C C  P ++    C++
Sbjct:   89 RKKRKATIYESQRWSYKIIPYVIESSSSGQSSL--IRSAMDHWEQNTCLRFEPLTSSHSSRLGHTSYISFFRGNGCWSHVGRSFTNQQQISIG-PQCGYFGTIVHEIGHAIGFHHEQSRPDRDEYINVHFENVQSGREHNFAKYTWGSVTSSNVEYDVGSIMHYGGYGFS-SNGRPTITTIDPRLNSRLGQRTA--LSAADIELANRIYECDDVEDCSNADECLNGGYHDADCDCVCPSSYSGDLCQD 330          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|P42674|BP10_PARLI (Blastula protease 10 OS=Paracentrotus lividus OX=7656 GN=BP10 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.271e-22
Identity = 79/249 (31.73%), Postives = 124/249 (49.80%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDIN------WVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADL--CERKVSCPLNGYVDKFCQCHIPETFENRRCRNK 865
            R KR     ++ +W  + IPY I  S      L  + +A+D W   TC+RF  + +          ++    G+ C S+VG    GEQ +S+ +  C ++GT +HE+GH +G  HE +RP R+ +I+V    IQ G +  + +     + S N+ YD+ S+MHYG   FS  +G+PTI  ++  L   L +  A  LS  D+++ NL Y+C D+  C     C   GY D  C C  P  +    C + 
Sbjct:   89 RKKRKATIYESQRWPYKVIPYVISPSSSGQSSL--IRNAMDHWEQNTCLRFEPRTSSHSRQLGHNAYLSFFRGSGCWSYVGKAFNGEQQISIGN-GCAYFGTIVHEIGHAIGFHHEQSRPDRDDYINVLYQNIQSGRQHNFAKYTWGRVTSRNVEYDVGSIMHYGGYGFS-SNGRPTITTRDPRLNSRLGQRIA--LSPADIELANLIYECDDIEDCAGANECLNGGYHDTECNCVCPSGYNGDLCEDA 331          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|A0A0C5PRQ1|NAS35_TELCI (Zinc metalloproteinase dpy-31 OS=Teladorsagia circumcincta OX=45464 GN=dpy-31 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.384e-19
Identity = 79/248 (31.85%), Postives = 129/248 (52.02%), Query Frame = 2
Query:  125 LTLSSIRDKRAVISTQATKW-TNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDI-NWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVD-KFC-QCHIPETFENRRC 856
            L     R KR  I +   +W   R I Y  D S  + E+   +  A++ W+  TC+ F +  N +  N +  T    C S VG +  GE+ L   +P+C   G   HE+ H LG  HE +RP R+QF++V  + I +  +  + + D  ++++  +PYD  S+MHY SK+FS +D   TI+   +     + + D   LSF D++++N  Y C+++C RK+ C   GY D + C +C  P+ F  + C
Sbjct:  140 LKTGQRRVKRKFIGSDLRRWDPTRPIVYSFDGSHTSREQRI-IELALEHWHNITCLNFVRNDNANSGNRIVFTDVDGCASNVGRHPLGEEQLVSLAPECIRLGVIAHEVAHALGFWHEQSRPDRDQFVNVRWENIDKDSKGQFLKEDPDDVDNAGVPYDYGSIMHYRSKAFSRYDDLYTISTFVTDYQKTIGQRD--QLSFNDIRLMNKIY-CSNVCSRKLPCQRGGYTDPRRCDRCRCPDGFTGQFC 383          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|P55114|NAS33_CAEEL (Zinc metalloproteinase nas-33 OS=Caenorhabditis elegans OX=6239 GN=nas-33 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.123e-18
Identity = 80/268 (29.85%), Postives = 134/268 (50.00%), Query Frame = 2
Query:   83 HSNLIVVLLTFNICLTLSSI--------RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKF--CQCHIPETFENRRC 856
            +S +  V+   ++ LT+S +        R KR  ++   T W+ R IPY   ++  N +  +Q+ + +  +   TC+RF        +++  + G  C+S VG    G Q +S+    C   G   HE+GH LG  HE  RP R+ ++ ++R     G E  +++   SE+N Y+LPYD  SVMHYG KSFS      T+   + +  + +   +  + SFLD+K++N  + C+++C  +++C   GY D     QC  P   E   C
Sbjct:  162 NSKIAAVMFESDMALTVSQMNKVAQNGFRVKRK-MNLNGTTWS-RNIPYRFLDTDGNWQ--SQITNGLRHYERNTCIRFSLNGGGS-DYLVFSKGEGCYSSVG-RLGGPQEISIGD-GCETLGIITHEVGHALGFWHEQARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPVDPAFINTIG--NRVEPSFLDLKLLNTAF-CSNICTNRINCQHGGYADPNNCGQCTCPTGLEGTYC 419          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|D5FM38|NAS36_BRUMA (Zinc metalloproteinase nas-36 OS=Brugia malayi OX=6279 GN=nas-36 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.435e-18
Identity = 75/229 (32.75%), Postives = 118/229 (51.53%), Query Frame = 2
Query:  176 TKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKF-CQ-CHIPETFENRRC 856
             KW    I Y  DES+ ++  ++Q+  A++ W   TC++F        ++++   G  C+S VG    G Q +S+    C   GT +HE+GH LGL HE +RP   ++I V ++ I   +   +      E+ ++N+PYDL SVMHYGS +FS      T+  K+      + + D+  LSF ++K+IN  Y C   C+ K  C   GY++   CQ C  P  F   +C
Sbjct:  102 AKWFQFPIKYRFDESL-DILHISQILKALEIWQSNTCIKFENDQEASGDYIEFFEGDGCYSMVG-RFGGRQGISIGK-GCERTGTIIHEVGHTLGLWHEQSRPDAEEYITVVKEYIIPSYISEFLTRSEHEITTFNVPYDLGSVMHYGSTAFSIDQRSKTLLTKDPFYQMTIGQRDS--LSFYNIKLINEAY-CKGDCKEKNECKNGGYLNPSNCQSCLCPSGFGGSKC 324          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A1S3H5F6 (Metalloendopeptidase OS=Lingula unguis OX=7574 GN=LOC106152365 PE=4 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 1.185e-127
Identity = 345/1220 (28.28%), Postives = 532/1220 (43.61%), Query Frame = 2
Query:   56 LIKMTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTT----PMTQIDCRNKLEEE-KCDRLMSNGKCFENKNYMKVNCQKTCGFCDS-KILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPL--------CRNVYNDSIC---ESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFIT-------SPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKEL------CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKF-CQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRI-CNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK-----------CQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEK----------MSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKT--NNSCVNLYHY-RMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLG-NESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSN--------CTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT----------LECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSI 3487
            L ++ + + H   + +        +    R+KR   S    KWTN T+PY I  S F+  E+  +H A+  W   TC +FR     D N V    G  C+S VGM   G Q L+L +P CR+ G YLHE+GH +G  HEH  P R+ +I ++ + +     +++++   +E+N+Y   YDL S+MHYG  +F+      TI  K+ S  H + +V  K+L+F D++++N  Y CA  C + V C   G++DK C+C   +   N           C     +     NS                           CKN ++D  CE WA+  EC  NP +M   C+KSC  C +   T    P  +  C N  +++ KC +   +G+CF N  +M  NC K CG C S K L                +  C+ WA   EC  N   M   CRK C  C                   CR+++ D +     + + +C  +  +M   C+K+CE C     +   T       +  C D     KC+  K  G CE  P FM   C KTC  C    E      CKN    + CQ+ AG+G+C++   +M+ NC + C  C   I  +      ++ +C  W+    CS+N  +M+  C K+C +C+  + +   D   K +      C  W++ G C  NP +M+  C ++C  C           C+N++     C  W   GEC  N  +M ENC K+C TC   N  N + G C N Y + + C+ W   G C+A    +   C K C  C  ++D            C+N+Y + A C+ W  SGEC  NP++M + C+K C  C                ++C N   D  CE  A+ + C  N  +ML+ C   C +C   + +  T  N++CVN +H    C  W   G C  NP +M K+C K+CG C  +     +C N   +++ CE W+K G+C+ NP +ML NC K+C K        +  TS     +    ++ +       +         C N   D  C +  + G C  + + M   CR++C +C K           L+C +V  +  C   A+   C  N++ M   C K+CG C                 C NK     C+ +   G C+++   M  +C   CGLC+   T+ ++
Sbjct:   56 LAELDMVMDHDQYVALYGGRRHKRSTEHSREKRKATSDLTLKWTNATMPYDIITSDFSENEIKIIHIAMREWEHHTCFKFRPAGPLDFNKVVFKNGIGCNSQVGM-VGGPQELNLEAPGCRWKGLYLHEIGHAMGFFHEHQMPDRDNYIEINYNNVAPVMRQWFDKYPRNEVNTYGTSYDLSSIMHYGITAFAADGKSQTIRAKDRSKEHTIGKVWQKELAFSDIRVVNEMYHCAAHCPKTVRCVDEGFLDKHCKCVCKDGTSN-----------CQRGTPITTGPDNSN--------------------------CKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIE-GCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNKCLNLYG-----------KDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKE-----GCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKC---ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGR-DGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKI----ATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRLQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEP-------------GACTNKH--RQCKRWARHGGCERNPGVMYRQCPVECGLCEHTKTDRAL 1195          

HSP 2 Score: 320.087 bits (819), Expect = 1.426e-86
Identity = 249/837 (29.75%), Postives = 367/837 (43.85%), Query Frame = 2
Query: 1823 NCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRC--------NAKSYEECEDSYRKEL-CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKF-CQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGY-------CENVYSDRI-CNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKD--------------KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKN---DRNCENL-GNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDI-CEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL-------ECQNVY-DDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKF-GDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKP--MGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC------TGKVLNRFAQCHNVA-GDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIA-GDLQCSYWARQDQCEKNPSYMRISCRKACGVC----TREKQQEGN--------------------------CADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 4072
            NC R   + +   NS  C+N+  D +C+ W++++ C++N  +M   C K+C +C        +    E CE++Y  +L C+ W + G C+ N ++M   CA++CG C        +  C N++ +   CQ W ++GEC+ N  +MI NC K CG C      N   G        C ++++D + C  W +EG C A    ++  C K+C  C+                   C +  ++  C+ WK  G CE +P FM   C+KTC  C   V+K  CKNL  D+ C+  A +  C+ +S YM   C   C  C           SCVN +     C  W  +GEC  NP +M+++C KSCG C T   +   D  C+N+  N++ CE W K GEC KNP +M+ NC K+CN+       C   T T                 P   NC N++ +D+ C+ W K+G C  N   M   C KSC  C            C N Y +D  C +WAK+G+C  N  +M M C K+C KC        +        C+N +  D  C+ + + GEC  +  +M   C K CGLC          +     + C N Y D  C  WA    C    TF+L  C K+C +C       G   N  + C N    DE+C+ W   GHC S P+ M   C  +C  C  +               + +CRN    D QC  WA+  QC+ NP +M  +C+KAC  C    T   Q++ N                          C + +   +C   A  G+C     WM  +C ++C  C
Sbjct:  318 NCQRGTPITTGPDNSN-CKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKC-------KSNKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC--GVDKEGCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKC--------ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNR-------CGDGTDT-----------------PDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTAN--SNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRD-------------GSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTEC 1097          

HSP 3 Score: 316.235 bits (809), Expect = 2.837e-85
Identity = 276/950 (29.05%), Postives = 388/950 (40.84%), Query Frame = 2
Query: 1505 TDAPFMKLRCKKTC-EMCSKGQNSKFITSPP----CKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNST----DCKNK-ETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNL-NSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYE------------ECEDSYRKEL-CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGIS---------NFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV----EKMSCKNLQ-NDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNC---LTKPKNDRNCEN-LGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDI-CEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT-------------LECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQN-KFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKN-VYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ------------------------------CHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFK 4084
             D  F+   CK  C +  S  Q    IT+ P    CK+I  + +C+       C   P +M+  C K+C  C    +          C+N  +   KCQ  A  G+C   + +M+ NCA+ C  C  N     C NL   D +C+ W+    C  N  +M+  C K C +C   +              +C D +   L C  W   G C  NP +M+  C +SC  CD                N  C +  D   CQ WK+ G C+ +  FMI+ C KTC  C       +D   C+N+  D+ C  W   G C A    +   C K C  C      C N + N A C +W   GEC  NP +M   C+K+C  CD          +CKN+  ND  CE+  K+  C KN  +M+  C   CN C   T +  T N C N+Y   + CDSW   GEC  NP +M ++CAKSC  C        N  +C N  GN+  C  W+K GEC  NP +M +NC K+C K                     +              C NL++DD  C++W   G C  N   M   C+K+CG C                + C N Y D  CE WA+  +C  N  FML  C K+C  C   +   +      N+ C N    D +C  + E G C  +  +M   C K CGLC           +    C+N  Y D  C +WA+ G C+    ++L  C K+CT C  K+    +Q                              C N  GD  C +    G C S    MR  C  +C +CD  S +    +      N   C ++ G+  C+  A+ + C  N  +M  +C+K CG+C     + G C +K+   QC+ WA  G C R    M   C   C +C+  K
Sbjct:  299 VDEGFLDKHCKCVCKDGTSNCQRGTPITTGPDNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK----CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC------GVDKEGCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKC--ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGN-CRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQK------------------CGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSC---DRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGG--------RDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCD-KIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDN------NRLQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLC-----EPGACTNKHR--QCKRWARHGGCERNPGVMYRQCPVECGLCEHTK 1190          

HSP 4 Score: 293.893 bits (751), Expect = 7.851e-78
Identity = 262/945 (27.72%), Postives = 389/945 (41.16%), Query Frame = 2
Query: 1367 INSKLMQKMCRKTCK----NCEPKKDKIQKPL---CRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMC----SKGQNSKFITSPPCKDIYSNE-KCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKN-KETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTG-----------CRNLNSDK-QCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSY-------------EECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRI-CNFWKTEGFCSAKYRNVLKKCSKTCGNCNM------TKDKCQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKM---SCKNL-QNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN--------CENL-GNESNCERWSKMGECEKNPKYMLINCAKSCN------------KRKNTPVNCSPATSTMSP---------PITSNTLLHVTKK-------------IPILSNCTNLFRDD-ICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK---TLECQN-VYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNR----------------------CQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC-TGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCR 3829
            ++   + K C+  CK    NC+        P    C+N+  D  CE  +   +C+ +  +M   C+K+C  C        +  +I    C++ Y ++ KC+     G C     +M+T C K C  C+       S  C N      KCQ  A +G+C++   +M  NC + C  C       G           CR++++D   C  W+    C  N  +M+  C K+C +C+                 + C D      C+ WK+ G C N+P FM+  C ++C  C     G+    CKN+ ++K CQ W   GEC+ + E+M  NC K C  C T        G C N + +   C  W  EG CS     +++ C K+CG C+       T   C+N++ N A CE W++ GEC KNP +M   CRK C  C    +     +C+N+  ND  C+S AK   C  N  +M + CA +C  C     +     SC N Y   + C  W   GEC  NP +M  +C K+C  C        +        C+NL  +++ C+ W+  GEC  NP +M INC K+C                   VNC  +                +    +L   KK                 SNC N   DD  C  W + G C  N   M   C+K+CG C     + +C+N  YDD  CE+WAK G+C+ N  +ML  C K+C KC  I     + + +V++R                      C N  GD  C      G+C     +M+  C + C  C    +N+    N  + C +V  +  C E A++  C N    +   C K+C  C  G   N+  Q         CK+W   G CE  P  M  +C + C  C+    T    + PA   N  N R
Sbjct:  299 VDEGFLDKHCKCVCKDGTSNCQRGTPITTGPDNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEG--CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCK-------SNKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC-----GVDKEGCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKCIT--------GSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKG-SNSGTVDNNRLQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTNKHRQ---------CKRWARHGGCERNPGVMYRQCPVECGLCEH---TKTDRALPAPGGNRRNDR 1206          

HSP 5 Score: 87.4261 bits (215), Expect = 2.337e-13
Identity = 75/282 (26.60%), Postives = 116/282 (41.13%), Query Frame = 2
Query:  836 TFENRRCRNKNEDD-WCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKN-FEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQID----------------------------CRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSP 1591
            T  N  C N + DD  C    + G+C  N  +M+ NC+K C  C       D     C+N    D  CE+WAK G+CQ NP +M   CKK+C  C +++ T  +Q D                            C N   + +C ++  +GKC  +  +M+ +C++ C  CD      T  ++   C D +    C   A+NN C  N + M   C+KTC  CEP         C N +      +    C  +   M  +C   C +C   +  + + +P
Sbjct:  932 TTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGD-----CRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKC-DKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRLQCIDVVG--NCAELAQNNGCSNNLQHMYNNCKKTCGLCEPG-------ACTNKHRQCKRWARHGGCERNPGVMYRQCPVECGLCEHTKTDRALPAP 1198          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2C9KD44 (Metalloendopeptidase OS=Biomphalaria glabrata OX=6526 GN=106055728 PE=4 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.818e-101
Identity = 293/1027 (28.53%), Postives = 466/1027 (45.37%), Query Frame = 2
Query:  266 AWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFE----------------NRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMT----TPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQK-TCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAK--CHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNET-NLDSGYCENVYSDRICNFWKTEGFC---------------SAKYRNVLKKCSKTCGN-----CNMTKD----------KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL 3184
            AW+ +TC+ FR   + D+N +K   G  C+S VGM   G Q +SLA+  CR  G YLHELGH +GL+HEH  P R+++IH++ D +Q   +++Y +    ++N+Y +PY+  SVMHYG   F+    + TI V++ +  H + EV  K LSF D+K++NL YKC   C     C   GY+D++C+C  P   +                   CRN  +D+ C    K G C+ N  +M  NCRK C+KC K           C N   D+ C  WA RGEC +N  +M   C++SCG C         T  T ++  N  ++E    + +     ++      +  +       S  +  +++ S   C +   +R CKRWA+  EC +N K M+K C ++C  C  +        C N++ +S C    A+  C+ +  +M+  CK++C++C +           C ++YSN  C      G C     +M T C ++C  C         +DC+N      C+  A KG+C +   +M   C R+C+ C+ N     C N  SD +C  W+    C  N  +M   C K+C  C A     C + +    C  W + G C +N  +M   C +SCG+C           C N++ +K C  W  +GECK N ++M +NC ++C  C+  N T N    +  N   D I  + ++  F                S +  + +K+ S    N      N+T            KC N++    C KW   GEC  N  +M+  C+++C+ C +     +C N+  ++ C+  A +  C+ N+ +M + C  +C+ C         N  C N++    C  W   GEC  N  +M  +C +SC  C      + +C N+  +++C++WS+  EC KN K+M  NC  SC+        C+                          NC+N +    C +W + G C  N   M   C+ +C  C   L
Sbjct:    3 AWSSKTCLTFRAARSSDVNKIKFKNGYGCNSMVGM-VGGTQIISLAAAGCRNDGMYLHELGHAIGLVHEHQLPERDEYIHINVDNVQPHMQDWYEKYSSEDVNNYGVPYEYSSVMHYGLNDFARDQHKQTIFVQDRTREHEVGEVWKKGLSFTDIKVVNLMYKCNKNCAPNQRCKEPGYLDRWCRCVCPPEVDCTKEGHGLRVGGGWGIGSDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKCAKN----------CSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDET--NVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVCHTE--------CSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQR----------DCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCL--------SDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDACNKN-----CSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGCAAG----CTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTCKTG--------CVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFCKLVNGTVNETKSWYNNDTLDSIDVYDESNLFAVDNITDLGNDNVKEYSGEEEDFVKEDSSGLSNLSTLMINLTTGSPTPITRKMKKCGNIWPDEDCSKWALRGECSLNKKWMEKNCKESCQKCSQ-----NCTNIWPNKDCDKWASRGECEINTKWMERNCIRSCDAC---------NQDCSNVWPDTDCIRWADRGECSTNQLWMETNCMRSCAAC------NMDCFNIWPDADCKKWSEQNECSKNQKWMQTNCRLSCDA-------CNL-------------------------NCSNRWNSSQCTQWAEQGECSSNKNWMEQNCKVACKVCQPNL 921          

HSP 2 Score: 260.766 bits (665), Expect = 2.587e-67
Identity = 205/785 (26.11%), Postives = 333/785 (42.42%), Query Frame = 2
Query: 2003 ECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQT-FN------------------ETNLDSGY------------------------------------CENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGD------FTCESYREIGE------CQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMG-----CKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCD------FKSPTALSYSKPAKVIN----------------TANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 4075
            +C +S++ E C  W + G C  NP +M   C ++C  C           C NV+ ++ C  W   GEC  N+++M+++C ++CG C T FN                  ETN+ +G                                     C N++ DR C  W  +G C    + + K CS++C  C+    +C N++  + C KW   GEC  N N+M+  C+++C+ C +      C N+ ++  C+  A    C  N  +M   C  +C  C          + C N++    C  W   GEC  N K+M K C +SC  C      ++NC N  +++ C  W+  GECE+N  +M  NC KSC                                    + CTN++ D  C +W   G C  N + M   C++SCG C     C N++ D+ C+ W + G+C+ N K+M   C +SC  C L+N  + E++   NN   +          F  ++  ++G         +   F+K+  +    L    M N +  S  P+      C N++ D+ C++WA  G C     ++   C +SC  C+         C N+  +++C KW SRG CE     M   C  SC  C+      +     + ++   +                     +C NI  D  C  W+ Q++C KN  +M+ +CR +C  C        NC++++++ QC  WA +GEC+  K WM +NC  +CK+CQ
Sbjct:  213 DCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKCAKN--------CSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVCHT---ECSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQR-----DCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCL---------SDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDAC------NKNCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGG--------------------------------CAAGCTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTCKTG--CVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFCKLVNGTVNETKSWYNNDTLDSIDVYDESNLFAVDNITDLGNDNVKEYSGEEEDFVKEDSSGLSNLSTL-MINLTTGSPTPITRKMKKCGNIWPDEDCSKWALRGECSLNKKWMEKNCKESCQKCS-------QNCTNIWPNKDCDKWASRGECEINTKWMERNCIRSCDACNQDCSNVWPDTDCIRWADRGECSTNQLWMETNCMRSCAACNMDCFNIWPDADCKKWSEQNECSKNQKWMQTNCRLSCDACNL------NCSNRWNSSQCTQWAEQGECSSNKNWMEQNCKVACKVCQ 918          

HSP 3 Score: 253.447 bits (646), Expect = 6.129e-65
Identity = 220/855 (25.73%), Postives = 351/855 (41.05%), Query Frame = 2
Query: 1064 RNPGYMNIKCKKSC---------GICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKL-----------RCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC---------------DKKVEKMSC------------KNLQNDQVCE-SLAKKDLCDKNSAYM----LQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANM 3472
            + PGY++  C+  C         G  +          DCRN  ++E C      G+C  N  +MK NC+K C  C             + C +   +  C +WA   EC  N + M K CR++C  C             N     I      + +  A    L           R   T        +S   ++  C +I+ +  CK    KG C     +M   C ++C  C         T+C N      C   A +G+C     +M  NC  +C +C  +     C N+ S+  C  W+ +  CS N  +M   C ++C  C      +C++ +    C+ W + G C  N ++M   C +SC +C        N  C N + +  C  W + GEC+ N  +M ENC K+CG C         +  C NV+ D  CN W   G C+     + + C ++CG C   K  C N++    C+KW  +GEC+ N  +MK  C+++CRFC               +  ++ +               +L ND V E S  ++D   ++S+ +      M   T  + +  T+ +K    C N++    C  W + GEC  N K+M K+C +SC  C       +NC N+    +C++W+  GECE N K+M  NC +SC+        C+                          +C+N++ D  C  W   G C  N   M + C +SC  C+  ++C N++ D  C+ W+++ +C KN K+M   C  SC  C+L               C N++    C  + E GEC  +  +M+  C   C +CQ N+
Sbjct:  176 KEPGYLDRWCRCVCPPEVDCTKEGHGLRVGGGWGIGSDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKC------------AKNCSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGC---GTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVCH--------TECSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQRD-----CTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVC----LSDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDAC--------NKNCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGC---------AAGCTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTC---KTGCVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFCKLVNGTVNETKSWYNNDTLDSIDVYDESNLFAVDNITDLGNDNVKEYSGEEEDFVKEDSSGLSNLSTLMINLTTGSPTPITRKMK---KCGNIWPDEDCSKWALRGECSLNKKWMEKNCKESCQKC------SQNCTNIWPNKDCDKWASRGECEINTKWMERNCIRSCDA-------CN-------------------------QDCSNVWPDTDCIRWADRGECSTNQLWMETNCMRSCAACN--MDCFNIWPDADCKKWSEQNECSKNQKWMQTNCRLSCDACNL--------------NCSNRWNSSQCTQWAEQGECSSNKNWMEQNCKVACKVCQPNL 921          

HSP 4 Score: 93.5893 bits (231), Expect = 3.220e-15
Identity = 72/258 (27.91%), Postives = 110/258 (42.64%), Query Frame = 2
Query: 3338 VNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC-TGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVI-----------NTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 4075
            + + C+N + D  C ++ + GECQ + ++MK  C K C  C  N             C NV+ D+ C++WA  G C     +++  C +SC  C TG  L                 W          +   +   L     +  + T L    P+ ++           +TA C NI  D  C  WA + +C  N  +M  +C ++C VC  E      C++ +    C  WA RGECN  K WM +NC +SCK+CQ
Sbjct:  210 IGSDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKCAKN-------------CSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTN------------WTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRG-PSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVCHTE------CSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQ 435          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: W6UF00 (Metalloendopeptidase OS=Echinococcus granulosus OX=6210 GN=EGR_08450 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 8.902e-81
Identity = 194/604 (32.12%), Postives = 283/604 (46.85%), Query Frame = 2
Query:   92 LIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHS-FVGMNE-EGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCER-KVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYK-YKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNK-LEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPEL-----------------CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCE-------PKKDKIQKP-------------------------------------LCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNC 1705
            +  +L+    C     IR +RA I   A  W    IPY ID+S+F  EE+  L  AI+ WN ETCV+FR     D +W++IT G  C S ++G     GEQ+++L+   CRFYG YLHELGHV+GL HEH R  R++++ V+   + E  + F+    + +L++Y+ PYDLQS+MHYG  SFS +  +  I+V++  + H+L  V  KD+SF D +I+NLHY+C D C+  +  CP  GY+DKFC+C  PE F  RRC + + D  C        C  N+ +M+  CRKTC  CYK       +    CK  ++ ++C +WA+ G C +  GYM + C +SCG C            C+++ +    C+     G+C   K +M  NC K+CG C +      +  +P L                 C +    + C+R      C  + K M++ CR  C  C+       PK D    P                                      CRN      C   ++ C   A F   RC   C  C            PC D  +++ CK LK  G+C+ YP      C +TC  C
Sbjct:   25 ITFLLVALVKCDDPPLIRTRRAAIPVNAISWPKGVIPYIIDKSLFKEEEMKHLATAIEVWNNETCVQFRPYRRSDRHWMRITDGNTCFSEYMGFKGIPGEQTITLSRNGCRFYGLYLHELGHVMGLDHEHARADRDKYLRVNDAGVPENFKLFFTRKSIEDLHTYDSPYDLQSIMHYGRSSFSVYADKAPIDVRDEKMRHMLAAVYVKDISFWDARILNLHYRCEDRCKNVQPLCPFPGYIDKFCKCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACK--DRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPKTDLTNSPTDWTPAKTDLPRVEANSTKYSLKAKSREASLKEALSEACRNGDPPGECPKYQSYCRNTATFQ--RCPNICNNCG-----------PCTD--TSKSCKILKQSGYCKYYPSSTIPICRRTCEVC 611          

HSP 2 Score: 82.4185 bits (202), Expect = 5.326e-12
Identity = 58/225 (25.78%), Postives = 89/225 (39.56%), Query Frame = 2
Query: 3320 EESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC---------TGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIA-----------GDLQCSYWARQDQCEKNPSYMRISCRKACGVC 3934
            +  E     RC +  GD  C+   +  EC ++  FM   C KTCG C  N+   ++  +  + CK+  + + C +WA  G C  TS ++  +C +SC  C         TG   +R+          +C+ W   G C SY   M   CA SC  C     + ++ + P     T   R +A           G   C     +  C  +  +M   CR  CG C
Sbjct:  272 QTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPS--VACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMY------PSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFC 486          

HSP 3 Score: 77.411 bits (189), Expect = 1.929e-10
Identity = 83/347 (23.92%), Postives = 130/347 (37.46%), Query Frame = 2
Query: 2411 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV------EKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNC---------LTKP--------------KNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCN-------------KRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKL-----MFSQCR---KSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC 3298
              + +C + +    C+K     EC +N +FM   CRKTC FC K +        ++CK+ Q  + C   A+   C K S YM  MC  +C  C+L          C + Y Y   C++W  +G C     +M  +CAKSCG C         +T P              K    C N     NC R      C  + K+M   C   C                 N+P + +PA + + P + +N+  +  K     ++       + C      G C K          F +C     +CG C+ T         +SC+   + G C+      + +C ++C  C
Sbjct:  277 FAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQ--ESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPKTDLTNSPTDWTPAKTDL-PRVEANSTKYSLKAKSREASLKEAL-SEACRNGDPPGECPKYQSYCRNTATFQRCPNICNNCGPCTDT--------SKSCKILKQSGYCKYYPSSTIPICRRTCEVC 611          

HSP 4 Score: 73.1738 bits (178), Expect = 3.460e-9
Identity = 89/373 (23.86%), Postives = 139/373 (37.27%), Query Frame = 2
Query: 1874 CRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRC-------NAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDL-KFKGISNFVCKNVF-DEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCK-NLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKF-----MLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSC 2947
            C + + D QC+  +    C  NA FM   C KTC  C         +    C+D  R+E C  W   G C     +M   C +SCG C+L K        CK+ +     C+ W  +G C + + +M  NC K+CG C     TN   G   N+ +  +     T        R V  K S            C+N Y +  C +      C  +  +M+ QCR  C FC      ++ K +L N     + AK DL    +            N + ++   K+  + +       C + +  GEC K   +       + C   C NC       ++C+ L          + G C+  P   +  C ++C
Sbjct:  282 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC-----TN-SEGSGVNITAPPLSATTTTA-------RGVATKVSSV----------CRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPKTDLTNSPTDWTPAKTDLPRVEA------------NSTKYSLKAKSREASLKEALSEACRNGDPPGECPKYQSYCRNTATFQRCPNICNNCGPCTDTSKSCKIL---------KQSGYCKYYPSSTIPICRRTC 608          

HSP 5 Score: 71.2478 bits (173), Expect = 1.354e-8
Identity = 60/248 (24.19%), Postives = 102/248 (41.13%), Query Frame = 2
Query: 3062 CTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDD-------QSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFT-CESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTA 3781
            C +   D  C++      C +N   M + CRK+CG C K +    V          +SC +WA+ G C K   +M M+C +SCG C+L      E+       C++++   + CE++ + G C    ++M   CAK+CG+C  +  +    +  P+              A +   R  +T + +V                  C N  G +NC++  SR  C ++   M  +C   C  C   + T 
Sbjct:  282 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGET-----GGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLS-------------ATTTTARGVATKVSSV------------------CRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTV 493          

HSP 6 Score: 71.2478 bits (173), Expect = 1.501e-8
Identity = 87/375 (23.20%), Postives = 137/375 (36.53%), Query Frame = 2
Query: 1670 MSTKCFKTCRNCRPIIEIKNSTD----CKNKETFRK-----------CQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNS--DKQ--CKMWSKNDNCSINAPFMMVQCAKTCRRCN-----AKSYEECEDSYR-KELCRLWKEAGRCYNNPRFMLHQCAQSCGSC------------------DLKFKGIS---NFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSD----------------------------------RICNFWKTEGFCSAKYRN------VLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC 2536
            +  +C   C+N +P+       D    C+  E F +           CQ LA K +C     FM+  C +TC  C  NI     R   +  D+Q  C  W++  +C+  + +M + C ++C  CN     A     C+D Y     C  W + GRC +   +M   CA+SCG C                      +G++   + VC+N +  + C+   +   C T++++M   C   CG CQ+   T        N  +D                                    C      G C  KY++        ++C   C NC    D       S  C+  K+SG C+  P+     CR+TC  C
Sbjct:  244 LHYRCEDRCKNVQPLCPFPGYIDKFCKCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPKTDLTNSPTDWTPAKTDLPRVEANSTKYSLKAKSREASLKEALSEACRNGDPPGEC-PKYQSYCRNTATFQRCPNICNNCGPCTD------TSKSCKILKQSGYCKYYPSSTIPICRRTCEVC 611          

HSP 7 Score: 70.8626 bits (172), Expect = 1.622e-8
Identity = 50/150 (33.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query: 3641 FAQ--CHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQ---QEGNCADKYS-TIQCRTWANRGECNRQKVWMNENCAKSCKIC 4072
            FAQ  C +  GD  C+K   +  C    + M   C  +C  C +K+        PA V  +  C++      C+ WAR   C K   YM++ C ++CG C   K    + G C D+Y     C  WA  G C   K+WM+ NCAKSC +C
Sbjct:  277 FAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFC-YKNIL------PATVRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC 417          

HSP 8 Score: 65.855 bits (159), Expect = 5.591e-7
Identity = 53/215 (24.65%), Postives = 78/215 (36.28%), Query Frame = 2
Query: 3509 CKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGD--ENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRN-IAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGN-----------------------CADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 4075
            C + + D  C + A+   C   ++F+   C K+C  C   +L    +      D  E+C  W   GHC      M++ C  SC  C+     A           T  C++       C  WA++ +C     +M  +C K+CGVCT  +    N                       C + Y T  CR   +R  C   K WM   C   C  CQ
Sbjct:  282 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAG---------ETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQ 487          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A1S3H8W2 (protein draper-like OS=Lingula unguis OX=7574 GN=LOC106153221 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.223e-78
Identity = 230/766 (30.03%), Postives = 332/766 (43.34%), Query Frame = 2
Query: 2006 CEDSYRKEL-CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKF-CQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGY-------CENVYSDRI-CNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKD--------------KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKN---DRNCENL-GNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDI-CEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL-------ECQNVY-DDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKF-GDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKP--MGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRF----AQCHNVA-GDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIA-GDLQCSYWARQDQCEKNPSYMRISCRKACGVC----TREKQQEGN--------------------------CADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 4072
            CE++Y  +L C+ W + G C+ N ++M   CA++CG C        +  C N++ +   CQ W ++GEC+ N  +MI NC K CG C      N   G        C ++++D + C  W +EG C A    ++  C K+C  C+                   C +  ++  C+ WK  G CE +P FM   C+KTC  C   V+K  CKNL  D+ C+  A +  C+ NS YM   C   C  C           SCVN +     C  W  +GEC  NP +M+++C KSCG C T   +   D  C+N+  N++ CE W K GEC KNP +M+ NC K+CN+       C   T T                 P   NC N++ +D+ C+ W K+G C  N   M   C KSC  C            C N Y +D  C +WAK+G+C  N  +M M C K+C KC        +        C+N +  D  C+ + + GEC  +  +M   C K CGLC          +     + C N Y D  C  WA    C    +F+L  C K+C +C     N      + C N    DE+C+ W   GHC S P+ M   C  +C  C  +               + +CRN    D QC  WA+  QC+ NP +M  +C+KAC  C    T   Q++ N                          C + +   +C   A  G+C     WM  +C ++C  C
Sbjct:    2 CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKC-------KSNKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC--GVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKC--------ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNR-------CGDGTDT-----------------PDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRD-------------GSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTEC 713          

HSP 2 Score: 284.263 bits (726), Expect = 8.355e-77
Identity = 244/856 (28.50%), Postives = 357/856 (41.71%), Query Frame = 2
Query: 1595 CKDIYSNE-KCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKN-KETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTG-----------CRNLNSDK-QCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSY-------------EECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRI-CNFWKTEGFCSAKYRNVLKKCSKTCGNCNM------TKDKCQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEK---MSCKNL-QNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLY-HYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN--------CENL-GNESNCERWSKMGECEKNPKYMLINCAKSCN------------KRKNTPVNCSPATSTMSP---------PITSNTLLHVTKK-------------IPILSNCTNLFRDD-ICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK---TLECQNV-YDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNR----------------------CQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC-TGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCR 3829
            C++ Y ++ KC+     G C     +M+T C K C  C+       S  C N      KCQ  A +G+C++   +M  NC + C  C       G           CR++++D   C  W+    C  N  +M+  C K+C +C+                 + C D      C+ WK+ G C N+P FM+  C ++C  C     G+    CKN+ ++K CQ W   GEC+ N E+M  NC K C  C T        G C N + +   C  W  EG CS     +++ C K+CG C+       T   C+N++ N A CE W++ GEC KNP +M   CRK C  C    +     +C+N+  ND  C+S AK   C  N  +M + CA +C  C     +     SC N Y +   C  W   GEC  NP +M  +C K+C  C        +        C+NL  +++ C+ W+  GEC  NP +M INC K+C                   VNC  +                +  + +L   KK                 SNC N   DD  C  W + G C  N   M   C+K+CG C     + +C+N  YDD  CE+WAK G+C+ N  +ML  C K+C KC  I     + + +V++R                      C N  GD  C      G+C     +M+  C + C  C     + ++ +N+P  C +V  +  C E A++  C N    +   C K+C  C  G   N+  Q         CK+W   G CE  P  M  +C + C  C+    T    + PA   N  N R
Sbjct:    2 CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCK-------SNKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC-----GVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCIT--------GSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQ-CIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTNKHRQ---------CKRWARHGGCERNPGVMYRQCPVECGLCEH---TKTDRALPAPGGNRRNDR 822          

HSP 3 Score: 282.337 bits (721), Expect = 3.319e-76
Identity = 244/839 (29.08%), Postives = 335/839 (39.93%), Query Frame = 2
Query: 1763 KCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNL-NSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYE------------ECEDSYRKEL-CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGIS---------NFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV----EKMSCKNLQ-NDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNC---LTKPKNDRNCEN-LGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDI-CEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT-------------LECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQN-KFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNV-YKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ------------------------------CHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTA-LSYSKPAKVINTANCRNIAGD------------------------------LQCSYWARQDQCEKNPSYMRISCRKACGVCTREK 3946
            KCQ  A  G+C   + +M+ NCA+ C  C  N     C NL   D +C+ W+    C  N  +M+  C K C +C   +              +C D +   L C  W   G C  NP +M+  C +SC  CD                N  C +  D   CQ WK+ G C+ +  FMI+ C KTC  C       +D   C+N+  D+ C  W   G C A    +   C K C  C      C N + N A C +W   GEC  NP +M   C+K+C  CD          +CKN+  ND  CE+  K+  C KN  +M+  C   CN C   T +  T N C N+Y   + CDSW   GEC  NP +M ++CAKSC  C        N  +C N  GN++ C  W+K GEC  NP +M +NC K+C K                     +              C NL++DD  C++W   G C  N   M   C+K+CG C                + C N Y D  CE WA+  +C  N  FML  C K+C  C   +   +      N+ C N    D +C  + E G C  +  +M   C K CGLC           +    C+N  Y D  C +WA+ G C+    ++L  C K+CT C  K+    +Q                              C N  GD  C +    G C S    MR  C  +C +CD  S +  +  ++P  +    NC  +A +                               QC  WAR   CE+NP  M   C   CG+C   K
Sbjct:   11 KCQQWAKDGECFVNIKWMATNCAKACGKCKSNK----CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC------GVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKC--ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGN-CRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQK------------------CGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSC---DRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGG--------RDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCD-KIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTNKHRQCKRWARHGGCERNPGVMYRQCPVECGLCEHTK 806          

HSP 4 Score: 278.485 bits (711), Expect = 8.499e-75
Identity = 239/841 (28.42%), Postives = 354/841 (42.09%), Query Frame = 2
Query: 1871 GCRN-LNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKEL-CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFV--------CKNVF-DEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSG--------YCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQ-NDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNCL--TKPKNDRNCENL-GNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDI-CEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE------------CQNVY-DDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNN-RCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKD-KICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDE-NCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSK----PAKVINTAN---------------CRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQE-------------GNCADKYST------------------------------IQCRTWANRGECNRQKVWMNENCAKSCKICQDFK 4084
            GC N  + D +C+ W+K+  C +N  +M   CAK C +C +    +C + Y K+  C+ W + G C  NP +M+  C ++CG C     G             C+++  D   C  W ++GEC+ N  +MI NC K+C  C T   T+  +          C +      C  WK  G C      +++ C KTC  C + K+ C+N+     C++W   GECE N  +M   CRK C    KK    SC N   N+  C   A +  C  N  +M++ C  +C  C   T    T+ +C N++     C++WE  GEC KNP +M+ +C K+C  C   T   +  NC N+ GN+  C+ W+K+GEC  NP +M  NCAKSC                        T            +CTN + +D  C +W K G C  N   M   C K+C KC  + +            C+N+Y DD  C++WA  G+C  N  +M + C K+CG C   +   + +  +  N  C N +GD  CE +    +C  +  FM ++C K C  C     N    +N    C N + D + C  WAE G C +   ++   C K+C  C G+  +    C N   D+  C+ W   G C++ P+ M   C  +C KCD K  T  S         ++I                   C N  GD +C+  AR  +C  +  +MR  CR+AC  C +                  GNCA+                                   QC+ WA  G C R    M   C   C +C+  K
Sbjct:    1 GCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSN---KCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKAC----KKCITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCK-----------------------TCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANS--NCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGR--DGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCD-KIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTNKHRQCKRWARHGGCERNPGVMYRQCPVECGLCEHTK 806          

HSP 5 Score: 276.559 bits (706), Expect = 3.172e-74
Identity = 232/855 (27.13%), Postives = 361/855 (42.22%), Query Frame = 2
Query: 1151 CRNKLEEE-KCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPL--------CRNVYNDSIC---ESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFIT-------SPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKEL------CRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKF-CQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYS-DRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK-----------CQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEK----------MSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKT--NNSCVNLYHY-RMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLG-NESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSN--------CTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQ--------SCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMG 3508
            C N  +++ KC +   +G+CF N  +M  NC K CG C S   +               +  C+ WA   EC  N   M   CRK C  C                   CR+++ D +     + + +C  +  +M   C+K+CE C     +   T       +  C D     KC+  K  G CE  P FM   C KTC  C    E      CKN    + CQ+ AG+G+C++   +M+ NC + C  C   I  +      ++ +C  W+    CS+N  +M+  C K+C +C+  + +   D   K +      C  W++ G C  NP +M+  C ++C  C           C+N++     C  W   GEC  N  +M ENC K+C TC   N  N + G C N Y  D  C+ W   G C+A    +   C K C  C  ++D            C+N+Y + A C+ W  SGEC  NP++M + C+K C  C                ++C N   D  CE  A+ + C  N ++ML+ C   C +C   + +  T  N++CVN +H    C  W   G C  NP +M K+C K+CG C  +     +C N   +++ CE W+K G+C+ NP +ML NC K+C K           TS     +    ++ +       +         C N   D  C +  + G C  + + M   CR++C +C K      V +++        +C   A+   C  N++ M   C K+CG C                 C NK     C+ +   G C+++   M  +C   CGLC+   T+ ++ +  P G
Sbjct:    2 CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNKCLNLYG----------KDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKE-----GCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKC---ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGR-DGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIAT----GTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEP-------------GACTNKH--RQCKRWARHGGCERNPGVMYRQCPVECGLCEHTKTDRALPA--PGG 816          

HSP 6 Score: 254.603 bits (649), Expect = 8.955e-67
Identity = 234/860 (27.21%), Postives = 347/860 (40.35%), Query Frame = 2
Query:  854 CRNKNEDDW-CTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQID-------CRN-KLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSP-----ELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNE-KCKSLKSKGHCERYPYFMSTKCFKTCRNC-RPIIEIKNSTDCKNKET-FRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINS--TG-CRNL-NSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCN-----AKSYEECEDSYRKEL-CRLWKEAGRCYNNPRFMLHQCAQSCGSC------DLKFKGISNFVCKNVF-DEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGY------CENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNS---------AVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQ-NDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIK---------------------------TNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCEN-----LGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT 3181
            C N  +DD  C    K G C  N K+M+ NC K C KC        K  K    + KD  C+ WA  GEC+ NP +M   C+K+CG C +                 CR+   +   C R  S G+C  N  +M  NC+K+C  CD+       T        + C DKL    C+ W     CE +   M + C+KTC  C      + K  C+N+  D  C+  + + +C  ++ +M   C+K C+ C  G          C + + NE +C    ++G C   P +M   C K+C  C     +      CKN  +   +C+    +G+C    ++M  NC + CN C    ++  TG CRN+  +D QC  W+K   CS N  +M   CAK+C+ C+       +   C +SY  +  C  W + G C  NP +M   C ++C  C             +   CKN++ D+  CQ W + GEC  N ++M  NC K CG C   + T   +        C N Y D  C  W  +  C+     +L++C K C +C+   D      NS           C  W   G C  NP++M   C+K C  C  +     C+N   +D  CE  AK   C  N  +ML  C   C  C                                    +++CVN +    C     DG+CI + ++M + C ++C  C  K  N    +N     +    NC   ++   C  N ++M  NC K+C         C P                          CTN  R   C+ W + G C++N  +M+ QC   CG C  T
Sbjct:    2 CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKC--------KSNKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC-----GVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCITGS---------CVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTEC-DKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGL-------CEPGA------------------------CTNKHRQ--CKRWARHGGCERNPGVMYRQCPVECGLCEHT 805          

HSP 7 Score: 240.35 bits (612), Expect = 5.024e-62
Identity = 201/694 (28.96%), Postives = 302/694 (43.52%), Query Frame = 2
Query:  845 NRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKL-EEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVY-NDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNE-KCKSLKSKGHCERYPYFMSTKCFKTCRNC------RPIIEIKNSTDCKN-KETFRKCQDLAGKGKCKSELIFMSINCARTCNLC----------SLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKS-------YEECEDSYR-KELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKN-VFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQV-----CESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC 2818
            N+ C +K + + C   K  G+CE +  +M   C+KTCDKC          K+ CKN  +DK C+ WA RGEC+ N  YM   C+K+C  C+           C NK   E +C R  + G+C  N  +M  NC+K+CG CD+      +  + +      +E  C+ W K  EC  N   M   CRK C  C    D      CRN+Y ND  C+S     +C  +  +M   C K+C+ C    N+       C + Y N+ +C     +G C   P +M+  C K C+ C             N  +CKN  +   +CQD A  G+C +   +M INC + C LC          + N  +  C N   D QC++W++++ C++N  FM+ QC K CR C+  S          C +++   E CR+W E G C +NP +M   C ++CG C  +     +  C+N  +D+  C+ W   G+C+TN ++M+ NC K C  C             +N   DR             +   +    +          D C N +    C +  R G+C  +  +M+  CR+ C  CDK     +  N +   +     C  LA+ + C  N  +M   C  TC  C           +C N   +R C  W   G C +NP  M + C   CG C
Sbjct:  156 NKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKC-------GVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCITGS--------CVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAE--CEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDG-NNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRD---GSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQE---DNNVDDR-------------EIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEP--------GACTN--KHRQCKRWARHGGCERNPGVMYRQCPVECGLC 802          

HSP 8 Score: 202.986 bits (515), Expect = 8.767e-50
Identity = 172/591 (29.10%), Postives = 253/591 (42.81%), Query Frame = 2
Query: 2426 CQNVYNSAV-CEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQN-DQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNS-------CVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKN-----------DRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQS-CENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFG-DFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKI-CNEWAESGMCRNTSTFILTVCSKSCTNC--TGKVLNRFAQCHNVAG-DENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNI-AGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEG---------NCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKD 4087
            C+N Y+  + C++W + GEC  N  +M   C K C  C    +   C NL   D  C++ A +  C  N  +M+  C   C  C   T       +       C +++   + C  W  +GEC  NP +M+ +C KSC  C T               ++ C +  + + C+ W   G CE +P +M+  C K+C+K                          V K+      C NL  D  C+EW   G C+ N + M + CRK+C KC  T  C N + +++ C  WA +G+C  N  +M+  C KSCGKC          +   +  C+N    D  CE++ + GEC K+ L+M   C K C  C  + T+T    N    C+N+Y + + C+ WA+ G C     ++   C+KSC  C       N    C N  G D  C  W  RG C + P  M + C  +CQKC                 N   C+N+   D QC  WA   +C  NP +M I+C+KACG+C                 NC + Y   QC  WA   +C     +M E C K+C+ C    D
Sbjct:    2 CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKC----KSNKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDK------------------------CGVDKE-----GCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCI-TGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCD-----TSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRC-GDGTDTPDTGN----CRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGG----NTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSD 544          

HSP 9 Score: 145.976 bits (367), Expect = 1.185e-31
Identity = 124/480 (25.83%), Postives = 193/480 (40.21%), Query Frame = 2
Query:  833 ETFENRRCRNKNEDD-WCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGIC-----VEEMTTPMTQIDCRNKLEEE-KCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPEL---CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPL---CRNVYNDSICESMK-----AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTD----------------------------CKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRN-----LNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCD 2119
            +T +   CRN   +D  C    K+G C  N  +M  NC K+C  C       + G     ++  D  C +WAKRGEC  NP +M + C+K+C  C                +C+N  +++ +C     +G+C  N ++M +NC+K CG C                  C +   +  C+ WA++N+C +N   M + C+K C++C+   D         C N ++D   ES +       C ++  +M   C+K C +C     S    +      Y + +C+     G C+  P +M   C K C  C  I    +  D                            C N     +C  +A  GKC S+  +M  +C R C  C    NS    N     ++    C   ++N+ CS N   M   C KTC  C   +   C + +R+  C+ W   G C  NP  M  QC   CG C+
Sbjct:  335 DTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDD--ESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGDCRNK----HYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPGA---CTNKHRQ--CKRWARHGGCERNPGVMYRQCPVECGLCE 803          

HSP 10 Score: 87.4261 bits (215), Expect = 2.069e-13
Identity = 75/282 (26.60%), Postives = 116/282 (41.13%), Query Frame = 2
Query:  836 TFENRRCRNKNEDD-WCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKN-FEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQID----------------------------CRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSP 1591
            T  N  C N + DD  C    + G+C  N  +M+ NC+K C  C       D     C+N    D  CE+WAK G+CQ NP +M   CKK+C  C +++ T  +Q D                            C N   + +C ++  +GKC  +  +M+ +C++ C  CD      T  ++   C D +    C   A+NN C  N + M   C+KTC  CEP         C N +      +    C  +   M  +C   C +C   +  + + +P
Sbjct:  548 TTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGD-----CRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKC-DKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVG--NCAELAQNNGCSNNLQHMYNNCKKTCGLCEPG-------ACTNKHRQCKRWARHGGCERNPGVMYRQCPVECGLCEHTKTDRALPAP 814          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A068WRN1 (Metalloendopeptidase OS=Echinococcus granulosus OX=6210 GN=EgrG_001195900 PE=4 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.137e-74
Identity = 165/483 (34.16%), Postives = 245/483 (50.72%), Query Frame = 2
Query:   92 LIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHS-FVGMNE-EGEQSLSLASPDCRF------------------YGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCER-KVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYK-YKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNK-LEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPEL-----------------CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCE 1420
            +  +L+    C     IR +RA I   A  W    IPY ID+S+F  EEL  L  AI+ WN ETCV+FR     D +W++IT G  C S ++G     GEQ+++L+   CRF                  YG YLHELGHV+GL HEH R  R++++ V+   + E  + F+    + +L++Y+ PYDLQS+MHYG  SFS +  +  I+V++  + H+L  V  KD+SF D +I+NLHY+C D C+  +  CP  GY+DKFC+C  PE F  RRC + + D  C        C  N+ +M+  CRKTC  CYK       +    CK  ++ ++C +WA+ G C +  GYM + C +SCG C            C+++ +    C+     G+C   K +M  NC K+CG C +      +  +P L                 C +    + C+R      C  + K M++ CR  C  C+
Sbjct:    6 ITFLLVALVKCDDPPLIRTRRAAIPVNAISWPKGVIPYIIDKSLFKEEELKHLATAIEVWNNETCVQFRPYRRSDRHWMRITDGNTCFSEYMGFKGIPGEQTITLSRNGCRFVSYQNKPINIQNLKKLHEYGLYLHELGHVMGLDHEHARADRDKYLRVNDAGVPENFKLFFTRKSIEDLHTYDSPYDLQSIMHYGRSSFSVYADKAPIDVRDEKMRHMLAAVYVKDISFWDARILNLHYRCEDRCKNVQPLCPFPGYIDKFCKCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACK--DRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQ 486          

HSP 2 Score: 81.6481 bits (200), Expect = 5.454e-12
Identity = 58/225 (25.78%), Postives = 89/225 (39.56%), Query Frame = 2
Query: 3320 EESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC---------TGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIA-----------GDLQCSYWARQDQCEKNPSYMRISCRKACGVC 3934
            +  E     RC +  GD  C+   +  EC ++  FM   C KTCG C  N+   ++  +  + CK+  + + C +WA  G C  TS ++  +C +SC  C         TG   +R+          +C+ W   G C SY   M   CA SC  C     + ++ + P     T   R +A           G   C     +  C  +  +M   CR  CG C
Sbjct:  271 QTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPS--VACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMY------PSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFC 485          

HSP 3 Score: 77.7962 bits (190), Expect = 1.067e-10
Identity = 62/213 (29.11%), Postives = 90/213 (42.25%), Query Frame = 2
Query: 2561 CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNC--SLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC-LTKPKNDRNCENLG------NESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC 3172
            C +   D  C+ LA K  C +N+++M   C  TC  C  ++   +++ + +C +      C  W   G C K   +M   C +SCG C LTK   D   E  G        S+CE W+K G C     +M  NCAKSC    N+        +  +PP+++ T         + S C N +    C        C  + K M  QCR  CG C
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTK---DDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSE---GSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFC 485          

HSP 4 Score: 75.485 bits (184), Expect = 4.722e-10
Identity = 64/228 (28.07%), Postives = 90/228 (39.47%), Query Frame = 2
Query: 2411 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV------EKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRM-CDSWEIDGECIKNPKFMLKSCAKSCGNC---------LTKP--------------KNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSP 3004
              + +C + +    C+K     EC +N +FM   CRKTC FC K +        ++CK+ Q  + C   A+   C K S YM  MC  +C  C+L          C + Y Y   C++W  +G C     +M  +CAKSCG C         +T P              K    C N     NC R      C  + K+M   C   C         C   TST++P
Sbjct:  276 FAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQ--ESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCG-------FCQSDTSTVTP 494          

HSP 5 Score: 72.7886 bits (177), Expect = 3.331e-9
Identity = 64/237 (27.00%), Postives = 107/237 (45.15%), Query Frame = 2
Query: 1070 PGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPEL-CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKI-QKPLCRNVY-NDSICESM--KAKCHTDAPFMKLRCKKTCEMCSKGQNSKF-ITSPP------------------CKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCR 1708
            PGY++  CK     C  +      Q  C +   + +C +L    +C+ N ++M   C+KTCGFC   IL   +T  P + C D+  + +C  WA+   C   S  M+ MC ++C  C   KD   +   C++ Y   S CE+   + +C +   +M   C K+C +C+  + S   IT+PP                  C++ Y  + C+ L S+  C  +  +M  +C   C  C+
Sbjct:  261 PGYIDKFCK-----C--QTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNIL--PATVRPSVACKDR--QESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQ 486          

HSP 6 Score: 71.2478 bits (173), Expect = 1.011e-8
Identity = 50/150 (33.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query: 3641 FAQ--CHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQ---QEGNCADKYS-TIQCRTWANRGECNRQKVWMNENCAKSCKIC 4072
            FAQ  C +  GD  C+K   +  C    + M   C  +C  C +K+        PA V  +  C++      C+ WAR   C K   YM++ C ++CG C   K    + G C D+Y     C  WA  G C   K+WM+ NCAKSC +C
Sbjct:  276 FAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFC-YKNIL------PATVRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC 416          

HSP 7 Score: 70.8626 bits (172), Expect = 1.429e-8
Identity = 61/253 (24.11%), Postives = 104/253 (41.11%), Query Frame = 2
Query: 3062 CTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDD-------QSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFT-CESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSK 3796
            C +   D  C++      C +N   M + CRK+CG C K +    V          +SC +WA+ G C K   +M M+C +SCG C+L      E+       C++++   + CE++ + G C    ++M   CAK+CG+C  +  +    +  P+              A +   R  +T + +V                  C N  G +NC++  SR  C ++   M  +C   C  C   + T    +K
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGET-----GGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLS-------------ATTTTARGVATKVSSV------------------CRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPSTK 497          

HSP 8 Score: 69.707 bits (169), Expect = 3.036e-8
Identity = 63/249 (25.30%), Postives = 103/249 (41.37%), Query Frame = 2
Query: 1670 MSTKCFKTCRNCRPIIEIKNSTD----CKNKETFRK-----------CQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNS--DKQ--CKMWSKNDNCSINAPFMMVQCAKTCRRCN-----AKSYEECEDSYR-KELCRLWKEAGRCYNNPRFMLHQCAQSCGSCD------------------LKFKGIS---NFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNET 2278
            +  +C   C+N +P+       D    C+  E F +           CQ LA K +C     FM+  C +TC  C  NI     R   +  D+Q  C  W++  +C+  + +M + C ++C  CN     A     C+D Y     C  W + GRC +   +M   CA+SCG C                      +G++   + VC+N +  + C+   +   C T++++M   C   CG CQ+   T
Sbjct:  243 LHYRCEDRCKNVQPLCPFPGYIDKFCKCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTST 491          

HSP 9 Score: 67.781 bits (164), Expect = 1.310e-7
Identity = 64/230 (27.83%), Postives = 91/230 (39.57%), Query Frame = 2
Query: 1874 CRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRC-------NAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDL-KFKGISNFVCKNVF-DEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC 2536
            C + + D QC+  +    C  NA FM   C KTC  C         +    C+D  R+E C  W   G C     +M   C +SCG C+L K        CK+ +     C+ W  +G C + + +M  NC K+CG C     TN   G   N+ +  +     T        R V  K S            C+N Y +  C +      C  +  +M+ QCR  C FC
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC-----TN-SEGSGVNITAPPLSATTTTA-------RGVATKVSSV----------CRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFC 485          

HSP 10 Score: 65.855 bits (159), Expect = 5.266e-7
Identity = 53/215 (24.65%), Postives = 78/215 (36.28%), Query Frame = 2
Query: 3509 CKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGD--ENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRN-IAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGN-----------------------CADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 4075
            C + + D  C + A+   C   ++F+   C K+C  C   +L    +      D  E+C  W   GHC      M++ C  SC  C+     A           T  C++       C  WA++ +C     +M  +C K+CGVCT  +    N                       C + Y T  CR   +R  C   K WM   C   C  CQ
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAG---------ETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQ 486          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: ENSAMXT00000035816.1 (meprin A subunit alpha-like [Source:NCBI gene;Acc:103025272])

HSP 1 Score: 84.3445 bits (207), Expect = 4.007e-16
Identity = 94/326 (28.83%), Postives = 149/326 (45.71%), Query Frame = 2
Query:  137 SIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNED--INWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCH-IPETFENR-RCRNKNEDDWCTDQKKLGNCEYNSKYM--SVNCRKTCDKCY-KYKAIFDKGKKICKNF-------EKDKTCENWAKRGECQRNP 1072
            ++   R  +  +A +W    IPY +D S+ ++     +  A + + +++CV F+    E   I + K+ G   C S VG  +EG Q LSL   +C + GT +HE+ H LG  HE +R  R+ ++++  ++I  G E  +N+ D S +   N PYD +S+MHYG  SF+     PTI  K+  LTH+L + +  D S LD+  +N  Y C+        C      +    C  +P   EN  +  +        D   +G C     YM  S N  K  D  + + + ++ K K  C           KDK    W K+ E    P
Sbjct:   59 ALPPGRNALIDKAYRW-QFPIPYILDNSL-DLNAKGVIFQAFETYRLKSCVDFKPYEGEKSFIRFEKLDG---CWSMVGDLKEG-QRLSLGE-NCDYKGTIMHEILHALGFYHEQSRTDRDNYVNIWWNQIIPGMEHNFNKYDDSFITDQNTPYDYESIMHYGPYSFNVDPRYPTITAKDPELTHVLGQYN--DFSSLDLLRLNRMYNCSAPLTLLDQCSF----ETLGICGMVPRNQENGVQWVHSRSSSQSPDHTLVGQCRDAGHYMFFSTNSGKAGDSAFLESRTLYPKRKLQCLQLFYKMTGSPKDKLVI-WTKQIESDGTP 370          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.7221 bits (195), Expect = 1.612e-14
Identity = 60/164 (36.59%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F  ++      A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  E+NS   PYD  S+MHY   +FS
Sbjct:   89 RVPRAATSRAERIWPGGVIPYVIGGN-FTGDQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFS 250          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.7221 bits (195), Expect = 1.796e-14
Identity = 60/164 (36.59%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  E+NS   PYD  S+MHY   +FS
Sbjct:   95 RVPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFS 256          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.7221 bits (195), Expect = 1.842e-14
Identity = 60/164 (36.59%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  E+NS   PYD  S+MHY   +FS
Sbjct:  138 RVPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFS 299          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 79.337 bits (194), Expect = 2.025e-14
Identity = 60/164 (36.59%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  E+NS   PYD  S+MHY   +FS
Sbjct:   42 RVPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFS 203          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001798.1 (pep scaffold:Pmarinus_7.0:GL485204:1983:11197:1 gene:ENSPMAG00000001629.1 transcript:ENSPMAT00000001798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 3.292e-12
Identity = 57/210 (27.14%), Postives = 104/210 (49.52%), Query Frame = 2
Query:  134 SSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYN--ENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKC 757
            S++RD R        +W  +TIPYY+D S+ +V     +  A + + ++TC+ F+    E   ++++  G+ C S+VG    G+Q LS+ + +C         L H++      T      F+  H   +  G E  ++  E+D+++L   N+PYD  S+MHYG+ +F   + +PTI  +      ++ +    D S  D++ +N  Y C
Sbjct:    4 SAVRDDRY-------RWP-KTIPYYLDISL-DVNAKGVIMQAFEMYRLKTCIDFKPWAGER-EYIQVIKGSGCWSYVGNLHYGKQELSIGA-NCDRLLVVPFNLAHLMDSYLHITTSMLVLFVAGHFTVLALGREGNFDKYEDDVTDLQ--NVPYDYSSMMHYGASAFQKAE-EPTIVTRIPDFMQVIGQ--RSDFSKYDLQKLNRLYNC 197          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007253.1 (pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1 gene:ENSPMAG00000006538.1 transcript:ENSPMAT00000007253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.814e-11
Identity = 53/164 (32.32%), Postives = 81/164 (49.39%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  +     W    IPY +  + F   +      A+  W   TCV F ++ +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + +  IQ G E  + + +  E++S    YD  S+MHY   +FS
Sbjct:    9 RAPRAATARSERIWPGGVIPYIVGGN-FTGSQKAMFRQAMRHWEKHTCVTFIERTDEESYIVFTYRPCGCCSYVGRRGGGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIKANIQPGQEYNFLKMEPGEVDSLGESYDFDSIMHYARNTFS 170          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004913.1 (pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 gene:ENSPMAG00000004462.1 transcript:ENSPMAT00000004913.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 4.047e-7
Identity = 39/89 (43.82%), Postives = 51/89 (57.30%), Query Frame = 2
Query:  350 CHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHY 616
            C SFVGM   GEQ +S+    C   GT  HELGH +G +HE +RP R+ FI V    +Q+G  +       S  +   +PYDL+SVMHY
Sbjct:    1 CWSFVGMIGVGEQVVSIGR-GCEGVGTVAHELGHAVGYVHEQSRPDRDAFISVLEGNVQDG--QLPQFAVYSATDPRGVPYDLKSVMHY 86          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO47261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMF1])

HSP 1 Score: 135.191 bits (339), Expect = 3.837e-34
Identity = 123/419 (29.36%), Postives = 185/419 (44.15%), Query Frame = 2
Query:  182 WTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQ---PTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKK 1429
            W +  IPY ID S+    EL ++   +  W  +TCVRF ++  ED +++ I  GT C+S VG   +G++ +S+ +  C ++   LHELGHV+G  HE +RP R++++ V    I +G E  + +     +++  + YD  S+MHY   +FS ++ +   P I VK +  T L +          DV  +NL YKC+ +C            DK   C +                      K G CE    +M   C K+C  C            +CK+  +   C  WA  G C     YM   CK+SCGIC E+   P   + C +K   + C    S G C     YM  +C+  C  C   I      H    C +K  +  C  WAK  +C      M + C+K+C  C P K
Sbjct:   10 WYDGVIPYVIDCSL---SELMKVFFTMKEWESKTCVRFVEREGED-DYLTIFRGTHCYSTVG-RAKGKRIMSVGN-GCEYHHVMLHELGHVIGFWHEQSRPDRDEYVRVLWHNIAKGWENAFLKLSWEAVDTMRVHYDFSSIMHYPFDAFSRNNKRTLLPLIPVKATPYTKLTDR---------DVLKVNLMYKCSTICR-----------DKLYSCKL--------------------WAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGIC-EDPRDP--SLPCEDK--HKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGI-----KHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 2 Score: 90.8929 bits (224), Expect = 3.274e-19
Identity = 56/172 (32.56%), Postives = 81/172 (47.09%), Query Frame = 2
Query: 2177 CQLWKNDGECKTNREFMIENCGKTCGTCQTFNE-TNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKD---KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV--EKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCS 2674
            C+LW   G C+  ++FM   C K+C  CQ  NE T      C++  S   C  W + G+C  K   +LK C ++CG C   +D    C++ + S  C  W   G C+  P +M   CR  CR C   +  E   C N   D+ C+  AK   C    +YM++ C  +CN C 
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTS--WCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHKS--CVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACP 367          

HSP 3 Score: 82.4185 bits (202), Expect = 1.805e-16
Identity = 62/187 (33.16%), Postives = 89/187 (47.59%), Query Frame = 2
Query: 1304 LCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDK--IQKPLCRNVYNDSICESMKA--KCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCS 1852
            +C DKL   +CK WAK   CEI    M   C K+CK C+ K ++     P+C++    S C    +   CHT A +M   CK++C +C   ++     S PC+D   ++ C    S G C+  P +M   C   CR C P I+      C NK+   +C   A  GKC S   +M   C ++CN C 
Sbjct:  192 ICRDKLY--SCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDP----SLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIK-HEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACP 367          

HSP 4 Score: 79.7221 bits (195), Expect = 1.338e-15
Identity = 64/197 (32.49%), Postives = 82/197 (41.62%), Query Frame = 2
Query: 3509 CKNVYKDKI--CNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDEN--CKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEG-NCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFK 4084
            C  + +DK+  C  WA+ G C     F+ T C KSC  C  K   R      V  D    C+KW S G+C +    M   C  SC  C+     +L      K               C YWA    C+  P+YM   CR AC VCT   + EG  C +K    +C  WA  G+C  +  +M E C KSC  C   K
Sbjct:  189 CSTICRDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKN-ERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHK--------------SCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 5 Score: 78.9518 bits (193), Expect = 2.409e-15
Identity = 58/200 (29.00%), Postives = 89/200 (44.50%), Query Frame = 2
Query: 2369 NVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMS-----CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKND-RNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCN 2950
            N++ KCS  C      +DK  +      C+ W + G CE   +FM  +C K+C+ C  K E+ +     CK+      C   A    C   + YML+ C  +C  C         +  C +   ++ C  W   G C   P +M K C  +C  C    K++   C+N   +  C+ W+K+G+C   P YM+  C KSCN
Sbjct:  184 NLMYKCSTIC------RDKLYS------CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICE---DPRDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCN 364          

HSP 6 Score: 77.7962 bits (190), Expect = 6.110e-15
Identity = 55/183 (30.05%), Postives = 77/183 (42.08%), Query Frame = 2
Query: 3212 SCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKC 3760
            SC+ WAK+G CE    FM   C KSC  C   N +   S     +R         C  +   G C    ++M   C ++CG+C+          +  + C++  K K C  WA  G+C    T++   C  +C  CT  + +    C N   DE C  W   G C S P+ M  KC  SC  C
Sbjct:  199 SCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTS------WCRKWASYGYCHTKAVYMLKSCKRSCGICEDP-------RDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 7 Score: 77.411 bits (189), Expect = 8.083e-15
Identity = 56/191 (29.32%), Postives = 85/191 (44.50%), Query Frame = 2
Query: 1865 STGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAK------SYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTK 2419
            ST CR+      CK+W+K   C I   FM  +C K+C+ C  K      S   C+D  R   CR W   G C+    +ML  C +SCG C+       +  C++    K C  W + G C     +M ++C   C  C        +   C+N   D  C+ W   G C+++   +++KC K+C  C  +K
Sbjct:  190 STICRD--KLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRD--PSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTP--GIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 8 Score: 73.1738 bits (178), Expect = 2.064e-13
Identity = 55/199 (27.64%), Postives = 90/199 (45.23%), Query Frame = 2
Query: 3350 CQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREK 3946
            C++K   ++C+ + + G C+    FM  +C K+C +CQ     T+  ++ P+ CK+  +   C +WA  G C   + ++L  C +SC  C     +    C +    ++C  W S G C+  P  M   C L+C+ C            P        C N   D +C +WA+  +C   PSYM   C+K+C  C   K
Sbjct:  193 CRDKL--YSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTT--TSMPV-CKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDP-RDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVC-----------TPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 9 Score: 70.0922 bits (170), Expect = 1.664e-12
Identity = 52/181 (28.73%), Postives = 89/181 (49.17%), Query Frame = 2
Query: 1595 CKD-IYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNST--DCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNIN-STGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEE---CEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSC 2116
            C+D +YS   CK    +G CE    FM T+C K+C+ C+   E   ++   CK++ ++  C+  A  G C ++ ++M  +C R+C +C    + S  C + +  K C  W+    C +   +M   C   CR C      E   C++    E C  W + G+C + P +M+ +C +SC +C
Sbjct:  193 CRDKLYS---CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSW--CRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKH--KSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 10 Score: 68.5514 bits (166), Expect = 5.220e-12
Identity = 52/187 (27.81%), Postives = 80/187 (42.78%), Query Frame = 2
Query: 1151 CRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRP 1711
            CR+KL    C      G C   K++M   C K+C  C  K     +T S  +C D+ S   C++WA    C   +  M K C+++C  CE  +D      C + +   +  +    C     +M   C+  C +C+ G   +    PPC +   +E+C      G C   P +M  KC K+C  C P
Sbjct:  193 CRDKLYS--CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNE--RTTTSMPVCKDRTS--WCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLP--CEDKHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHE---GPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPP 368          

HSP 11 Score: 68.1662 bits (165), Expect = 7.729e-12
Identity = 54/199 (27.14%), Postives = 77/199 (38.69%), Query Frame = 2
Query: 2588 CESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSC-VNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT 3181
            C+  AK+  C+    +M   C  +C  C    K+ +T  S  V       C  W   G C     +MLKSC +SCG C         CE+     +C  W+ +G C+  P YM  +C  +C         C+P      PP                  C N   D+ C+ W K+G C      M  +C+KSC  C  +
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQ--DKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACR-------VCTPGIKHEGPP------------------CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPS 369          

HSP 12 Score: 63.1586 bits (152), Expect = 2.956e-10
Identity = 53/198 (26.77%), Postives = 74/198 (37.37%), Query Frame = 2
Query: 2735 CDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLG----NESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCS 3301
            C  W   G C     FM   C KSC  C  + KN+R   ++       S C +W+  G C     YML +C +SC         C        P                   C +  +   C  W  +G C      M+  CR +C  C+  ++     C N   D+ C++WAK GKC     +M+  C KSC  C 
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKIC--QDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCG-------ICEDPRDPSLP-------------------CEDKHKS--CVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACP 367          

HSP 13 Score: 54.299 bits (129), Expect = 2.244e-7
Identity = 37/110 (33.64%), Postives = 52/110 (47.27%), Query Frame = 2
Query: 3776 TALSYSKPAKVINTANCRNIAGD--LQCSYWARQDQCEKNPSYMRISCRKACGVCT----REKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKD 4087
            T L+     KV     C  I  D    C  WA+Q  CE    +M   C K+C +C     R       C D+  T  CR WA+ G C+ + V+M ++C +SC IC+D +D
Sbjct:  173 TKLTDRDVLKVNLMYKCSTICRDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDR--TSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRD 280          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO37770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEU5])

HSP 1 Score: 106.686 bits (265), Expect = 5.743e-25
Identity = 81/236 (34.32%), Postives = 121/236 (51.27%), Query Frame = 2
Query:  179 KWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKD-LSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWC 883
            KW N  +PY I   +        + +A+  W  +TCVRF+K+  +  N+V    G  C S+VGM + G Q++SL S  C   GT  HE+GH LG  HE +RP R+ ++ VH D I+   +  +N+     +N++  PYD  S+MHYG+  FS  +G+ TI  K S       ++  +D LS LDV  +NL Y C +  + +  C L  +     +C        +RC  K   DWC
Sbjct:   63 KWPNAILPYEIRSDLKGTPAEGVIQNAMREWESKTCVRFQKRTTQK-NYVYFFKGDGCWSYVGMLDRGAQAISLGS-GCWHKGTAAHEIGHALGFYHEQSRPDRDNYVTVHWDNIKTDSKHNFNKYSADRINTFGTPYDFGSLMHYGTNYFS-VNGRATITPKKSG-----AKIGQRDYLSDLDVHQMNLRYGCPNHYKVEYGC-LWRFQSAGRRCW-------KRCGIKGSGDWC 282          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO39627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9K8])

HSP 1 Score: 103.605 bits (257), Expect = 2.891e-24
Identity = 76/206 (36.89%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  146 DKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHD-AIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCA 760
            + RA I T    WTN  +PY +D S+ +      + + AI  +N +TC+RFR +V  D   +KI  G  C S+VGM+   +Q LSLA   C   G  +HE  H LG  HE +RP R+QF+ +  + I++G    + ++  + + ++  PYD  SVMHYG+ +FS  +G+PTI  K   +  +L +   + LS +D K IN+HY+C 
Sbjct:   40 NSRAAIKTN--HWTNGVVPYELDPSISSSSYAVSVINSAIAEYNQKTCIRFRPRVPSDKYGLKIFKGGGCWSYVGMSMPTQQ-LSLAG-GCWSKGIVIHEFAHALGFYHEQSRPDRDQFVEIKTENIRDGVASNFKKHSFNYVTTHGTPYDYGSVMHYGAYAFS-KNGKPTIVAKQPGV--ILGQ--RRGLSDIDTKQINIHYRCG 236          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO43132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN5])

HSP 1 Score: 101.679 bits (252), Expect = 1.590e-23
Identity = 93/292 (31.85%), Postives = 142/292 (48.63%), Query Frame = 2
Query:  242 TQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDG-QPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGIC 1114
            +Q++  I+ ++  TC+RF K+  E      +   + C+S VG+   GEQ L++    C++ G  LHE GH +G  HEH RP R+  I+V  D +Q   ++ + +   SE N+  LPYDL S+MHY + +F+     + TI VK S  T+ +  V  ++ S  D+K IN+ Y C       V+C                      C +K +D  C      G C  N+ +MS NC K+C  C            +C+  +K   C +WA  GEC  N  +M+  CKKSC +C
Sbjct:   13 SQIYKGIEHYHKYTCLRFVKRTTEKDYIRVMKPQSGCNSMVGV-MGGEQILNMGD-GCQYVGLVLHEFGHAIGYFHEHNRPDRDNTINVLWDNVQPWFKDAFKKYQFSEANTQGLPYDLTSIMHYENTAFAKAGFCKTTITVK-SDPTYEISPVYLREFSPQDIKKINMLYGCTTNQLPPVAC---------------------VCEDKYKDR-CPGWASSGECSNNNAWMSNNCPKSCRTC--------GDPNLCE--DKYPKCSSWASTGECSANFQWMHQNCKKSCRVC 269          

HSP 2 Score: 53.9138 bits (128), Expect = 1.572e-7
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 3848 QCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 4072
            +C  WA   +C  N ++M  +C K+C  C         C DKY   +C +WA+ GEC+    WM++NC KSC++C
Sbjct:  201 RCPGWASSGECSNNNAWMSNNCPKSCRTCGDPNL----CEDKYP--KCSSWASTGECSANFQWMHQNCKKSCRVC 269          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO49949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REP7])

HSP 1 Score: 98.2117 bits (243), Expect = 1.275e-21
Identity = 67/223 (30.04%), Postives = 113/223 (50.67%), Query Frame = 2
Query:  125 LTLSSIRDKRAVISTQATKWTNRTIPYYIDESV-FNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCP 790
            LT   I + ++  + +  KW    +PY +D S+  + + +  ++ AI  +   TC+  R K   + +++ I  G+ C S++G     +Q LSL    C + G  +H + H LG  HEH RP R++++ +    I+ G E ++ +N  S   ++N+PYD  SVMHYG  ++S    QPTI      L   +     + LS LDV  + +HY C +     V+ P
Sbjct:    3 LTEEQINELKSGAAMKTRKWPGGVVPYELDSSLSGDSQAVNAINGAIVDYAKLTCITLRPKKANETSYLSIFKGSGCWSYLGQTGR-KQELSLGR-GCWYKGVVIHAIAHALGFFHEHNRPDRDRYVKIIFPNIEPGREVYFRKNSASSFTTHNIPYDYSSVMHYGVGAYSRMMSQPTI----VPLISGVSIGQRRGLSMLDVAKVKIHYNCKETSPPPVTKP 219          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 79.337 bits (194), Expect = 2.383e-14
Identity = 60/164 (36.59%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  E+NS   PYD  S+MHY   +FS
Sbjct:   55 RIPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFS 216          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: alv (alveolin [Source:NCBI gene;Acc:100049214])

HSP 1 Score: 75.485 bits (184), Expect = 2.427e-14
Identity = 69/193 (35.75%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  182 WTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCA 760
            W    IPY I   + + +  +++ +A       TC+RF+++  E  N++ I  G  C S+VG +  G QS+   S  C   G   HEL H +G+ HEHTR  R+QFI V  D I+ G +  +   D+   ++ NLPYD  S+MHYG+  FS  DG PTI          +     K LS LD++ IN  Y+C 
Sbjct:   74 WAQGVIPYTISMELAHRQ--SEIKEAFSMITSATCIRFQERTYE-ANYLDIKDGDGCASYVGCSG-GAQSVYFGS-TCSV-GNLCHELVHAVGMYHEHTRYDRDQFISVIWDNIKPGKQGNF---DVKMGDTLNLPYDFGSIMHYGTSYFS-KDGSPTIQPNEG-----VNIGQRKRLSQLDIQKINTLYRCG 251          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 79.337 bits (194), Expect = 2.690e-14
Identity = 60/164 (36.59%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  143 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFS 634
            R  RA  S     W    IPY I  + F   +      A+  W  +TCV F +K +E+   V       C S+VG    G Q++S+   +C  +G  +HELGHV+G  HEHTRP R+  + + RD IQ G E  + + +  E+NS   PYD  S+MHY   +FS
Sbjct:  154 RIPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFS 315          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: alv (alveolin [Source:NCBI gene;Acc:100049214])

HSP 1 Score: 75.485 bits (184), Expect = 3.017e-14
Identity = 69/193 (35.75%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  182 WTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCA 760
            W    IPY I   + + +  +++ +A       TC+RF+++  E  N++ I  G  C S+VG +  G QS+   S  C   G   HEL H +G+ HEHTR  R+QFI V  D I+ G +  +   D+   ++ NLPYD  S+MHYG+  FS  DG PTI          +     K LS LD++ IN  Y+C 
Sbjct:   85 WAQGVIPYTISMELAHRQ--SEIKEAFSMITSATCIRFQERTYE-ANYLDIKDGDGCASYVGCSG-GAQSVYFGS-TCSV-GNLCHELVHAVGMYHEHTRYDRDQFISVIWDNIKPGKQGNF---DVKMGDTLNLPYDFGSIMHYGTSYFS-KDGSPTIQPNEG-----VNIGQRKRLSQLDIQKINTLYRCG 262          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: ENSORLT00000018637.2 (pep primary_assembly:ASM223467v1:3:32702055:32705063:-1 gene:ENSORLG00000014863.2 transcript:ENSORLT00000018637.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 7.143e-14
Identity = 60/188 (31.91%), Postives = 97/188 (51.60%), Query Frame = 2
Query:  194 TIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKC 757
             IPY I  S ++  E+  +  A+ A+N  TC+RF ++ NE  +++ +     C+S +G  + G+Q LSL    C + G   HEL H LG  HE TR  R+ ++ ++   I       +N++D + LN+   PYD  S+MHYG  +FS   G+ TI    +    + +      +S  D+  IN+ Y C
Sbjct:   91 VIPYVI-SSQYSRGEVATIEGAMRAFNGRTCIRFVRRTNE-YDFISVVSKNGCYSELG-RKGGQQELSLNRGGCMYSGIIQHELNHALGFQHEQTRSDRDSYVRINWQNIIPASAYNFNKHDTNNLNT---PYDYSSIMHYGRDAFSIAYGRDTITPIPNPNVPIGQR---NGMSRWDITRINVLYNC 269          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074509.1 (SMESG000074509.1)

HSP 1 Score: 1347.03 bits (3485), Expect = 0.000e+0
Identity = 669/674 (99.26%), Postives = 670/674 (99.41%), Query Frame = 2
Query: 2081 MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNN 4102
            MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLD GYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEK+SCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSP ITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNK MGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQC NVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNN
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNN 674          

HSP 2 Score: 293.893 bits (751), Expect = 5.104e-85
Identity = 218/687 (31.73%), Postives = 322/687 (46.87%), Query Frame = 2
Query: 1382 MQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRC-----NAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCG----------------TCQTFNETNLDS-------GYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC---------DKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNC--SLFTKSIKTNN--SCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKND-RNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC 3298
            M   C ++C +C+ K   I   +C+NV+++  C+  K   +C T+  FM   C KTC  C +  N   +    C+++YS+  C   K++G C      +  KC KTC NC    +      C+N      C+     G+C+    FM + C +TC  C   +    C+NL +D+ C+  +K D C  N+ +M+  CA TC  C     + K+   C + Y   +C  W+  G C  NP+FML  CA+SCG+C  K K   N  C+N+ +E  C+ W   GEC+ N ++M+ NC K+C                 + Q  + T L           C N++ D IC  WK  G C   ++ +  +C K+CG C+ T + CQNVY+   CE W + G+CEKN  FM + C K+C  C          +K     C+N   D  CES  +   C K+  +M   CA TC  C  ++   SI +N    C N+Y  ++C+ W   G C     F+L  C+KSC NC  K  N    C+N+  + NC++W   G CE  P  M I CA SC K        SP   + S P           K+   +NC N+  D  C  W +   C+KN   M   CRK+CG C++  +    C + Y    C  WA +G+C +   +M   C KSC  C
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTC-QTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKD-----KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN--CENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFK----SPTALSYSKPA----------KVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 664          

HSP 3 Score: 278.87 bits (712), Expect = 6.731e-80
Identity = 218/687 (31.73%), Postives = 320/687 (46.58%), Query Frame = 2
Query:  929 MSVNCRKTCDKC-YKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAK--CHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCN--------------LCSLNINS-------------TGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGIS------NFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQT-FNETNLDSGY---CENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTK----DKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCD-------------KKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC 2818
            M   C ++C  C  K+K I      +CKN   +K C+ W   GEC+ N  +M   C K+CG C     T +    C N   +  C+   + G C      +   C KTCG C+          + + C +  +   C++W ++ ECE N   M+  CRKTC+ C+ K +KI    C+N+ ND +CES+  K  C  ++ +M   C  TC  CS    S   T+  C ++Y    C S +  G C + P FM   C K+C NC  + + KN  +C+N      C+  +  G+C+    +M INCA++CN                S  I S             + C NL  D  C+ W K  +C  N   M  QC K+C +C+     EC++ Y  + C  W + G+C  N +FML  C +SCG C L    I       N  C+N F +  C+ ++  GEC+ +  FM + C KTCG CQ     T++ S     C+NVY D+ICN W   G C      +L  CSK+C NC         +CQNV     C+KWK  G CE  PN M+++C  +C+ CD             K +   +C+N+  D  C   A++D C+KN +YM   C   C  C   T+  +   +C + Y    C +W   GEC +   +M ++CAKSC  C
Sbjct:    1 MLHQCAQSCGSCDLKFKGI---SNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCN---------MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKIS---CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKS-IKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC--LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL--ECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVC---TREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 664          

HSP 4 Score: 271.166 bits (692), Expect = 3.547e-77
Identity = 216/737 (29.31%), Postives = 321/737 (43.55%), Query Frame = 2
Query: 1226 MKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEP-KKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKL--RCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINST----GCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEE--CEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSC------------GSCDLKFKGISNFV------------CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNM-----------TKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV--------EKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC---------LTKPK---NDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCN---KRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKK 3235
            M   C ++CG CD K    ++     +C +   E+ C+ W  + EC+ N + M + C KTC  C+   +  +    C NVY+D IC   K +    A +  +  +C KTC  C+       +T   C+++Y++  C+  K  G CE+ P FM  +C KTCR C   +E      CKN +  + C+ LA K  C     +M   CA TCN CSL   S      C NL   + C  W  +  C  N  FM+  CAK+C  C  K   +  CE+   +  C  W + G C  NP++ML  CA+SC             +  +  +  SN +            C N+F +  C+ WK  G C+ N + M   C K+CG C    E       C+NVY D+ C  W  +G C    + +L  C K+CG C++             ++CQN +    CE ++  GEC+K+  FMK +C KTC  C   +        ++M CKN+  D++C   A+  +C   S ++L +C+ +C NC+   K +     C N+     C  W+  G C   P  M   CA SC  C          +KP    N  NC N+  +  C  W++  +CEKNP YM I+C K+C    + K    NC+   ST+                              C  W   G C +    M   C KSC  C    + +   +DQ  E+  KK
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNF----VCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCN-------MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVE---KISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-------CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCT--GKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQ-----------------------------CRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNNEDQKVEDEDKK 685          

HSP 5 Score: 229.18 bits (583), Expect = 5.344e-63
Identity = 188/687 (27.37%), Postives = 307/687 (44.69%), Query Frame = 2
Query:  839 FENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAI-FDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQK-PLCRNVYNDSICES--MKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPP----CKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCR-------NCRPII-----------------EIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYE----------ECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFV-----CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTC--QTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCN---------------MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDK-KVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNN 2704
              N  C+N  ++ +C   K  G C+ N ++M  NC KTC  C  +     D G   C+N   D+ C  W   G C      +  KC K+CG C       MT+  C+N      C++   +G+C +N N+MK+ C+KTC FCD K+   +       C +  +++ C+  AK + C+ NS  M +MC  TC NC      I+    C N+Y+  +C+S  +  +C  +  FM   C K+C  C        +T P     C+++ +   C+     G CE+ P +M   C K+C        NC P                   +I   ++C N      C++    G C+     M   C ++C  CS  +    C+N+  D+ C+ W+K   C  N  FM++ C K+C +C+  +++           C++ +    C  ++E G C  +  FM  +CA++CG C       S +      CKNV+ +K C  W   G C+    F++  C K+C  C  +  N        C+NV  D  C  WK+ G C +   ++  KC+ +C  C+               +    C+N+     C  W R  +CEKNP++M++ CRK C  C + K ++ +C +  +   C + A +  C++   +M + CA +C  C  F K +K NN
Sbjct:   19 ISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFG--YCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNC------NMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKIS-------CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC--------LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE---CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRF----AQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDF-KDLKYNN 674          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074509.1 (SMESG000074509.1)

HSP 1 Score: 1127.08 bits (2914), Expect = 0.000e+0
Identity = 560/564 (99.29%), Postives = 561/564 (99.47%), Query Frame = 2
Query: 2411 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNN 4102
            MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEK+SCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSP ITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNK MGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQC NVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNN
Sbjct:    1 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNN 564          

HSP 2 Score: 255.373 bits (651), Expect = 8.332e-73
Identity = 183/566 (32.33%), Postives = 265/566 (46.82%), Query Frame = 2
Query: 1739 CKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRC-----NAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCG----------------TCQTFNETNLDS-------GYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC---------DKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNC--SLFTKSIKTNN--SCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKND-RNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC 3298
            C+N      C+     G+C+    FM + C +TC  C   +    C+NL +D+ C+  +K D C  N+ +M+  CA TC  C     + K+   C + Y   +C  W+  G C  NP+FML  CA+SCG+C  K K   N  C+N+ +E  C+ W   GEC+ N ++M+ NC K+C                 + Q  + T L           C N++ D IC  WK  G C   ++ +  +C K+CG C+ T + CQNVY+   CE W + G+CEKN  FM + C K+C  C          +K     C+N   D  CES  +   C K+  +M   CA TC  C  ++   SI +N    C N+Y  ++C+ W   G C     F+L  C+KSC NC  K  N    C+N+  + NC++W   G CE  P  M I CA SC K        SP   + S P           K+   +NC N+  D  C  W +   C+KN   M   CRK+CG C++  +    C + Y    C  WA +G+C +   +M   C KSC  C
Sbjct:    6 CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN--CENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFK----SPTALSYSKPA----------KVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 554          

HSP 3 Score: 251.521 bits (641), Expect = 1.382e-71
Identity = 182/589 (30.90%), Postives = 279/589 (47.37%), Query Frame = 2
Query: 2000 EECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK----CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCR--------------------------FCDKKVEKMS-CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLT---------KPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL-----ECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC---SLINFQIEESEKHVNN-RCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC 3619
            ++C++ Y   +C  WK +G C  NP FM  QC ++C  CD K + IS   CKN+ +++ C+       C  N  +M++ C  TC  C  F ++   +  C N+Y  R+C+ W+ +G C    + +LK C+K+CGNC +TK K    C+N+ N + CE+W + GECEKNP +M + C K+C                              KK+  +S C NL  D +CE   K   C KN   M   C  +C  CS   K+++    C N+Y  + C++W   G+C KN KFML  C KSCG C           K  N+R C+N   +  CE + ++GEC+K+  +M   CAK+C                +     +NT ++  K++     C N+++D IC EW + G C+     + + C KSC  C+  +     +CQNV  D++C+ W  +G CE     M + C  SC KC   S       +  K +N   C+N  GD  C  +    +C+K+  +M+  C K CG+C       +    +   C + Y    C  WA  G C     ++   C+KSC  C
Sbjct:    4 DKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKIS---CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC-LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCS---KTLE----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNR-CQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCG---------------LCQANMTNTSIYSNKRM----GCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVC-------TREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 554          

HSP 4 Score: 234.958 bits (598), Expect = 7.248e-66
Identity = 180/613 (29.36%), Postives = 265/613 (43.23%), Query Frame = 2
Query: 1580 ITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINST----GCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEE--CEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSC------------GSCDLKFKGISNFV------------CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNM-----------TKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKV--------EKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC---------LTKPK---NDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKK 3235
            +T   C+++Y++  C+  K  G CE+ P FM  +C KTCR C   +E      CKN +  + C+ LA K  C     +M   CA TCN CSL   S      C NL   + C  W  +  C  N  FM+  CAK+C  C  K   +  CE+   +  C  W + G C  NP++ML  CA+SC             +  +  +  SN +            C N+F +  C+ WK  G C+ N + M   C K+CG C    E       C+NVY D+ C  W  +G C    + +L  C K+CG C++             ++CQN +    CE ++  GEC+K+  FMK +C KTC  C   +        ++M CKN+  D++C   A+  +C   S ++L +C+ +C NC+   K +     C N+     C  W+  G C   P  M   CA SC  C          +KP    N  NC N+  +  C  W++  +CEKNP YM I+C K+C                             T++     NC + +    C  W   G C +    M   C KSC  C    + +   +DQ  E+  KK
Sbjct:    1 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVE---KISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-------CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCT--GKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACG--------------------------VCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNNEDQKVEDEDKK 575          

HSP 5 Score: 213.772 bits (543), Expect = 1.203e-58
Identity = 172/578 (29.76%), Postives = 258/578 (44.64%), Query Frame = 2
Query:  851 RCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKI-CKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCK-------NCEPKKDKIQKPL-----------------CRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPI-IEIKNSTD-----CKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINST--------GCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAK---SYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLK----------FKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKD 2422
            +C+N      C   K+ G CE N  +M + CRKTC  C K      K +KI CKN + D+ CE+ AK+  C +N  YM   C  +C  C     +  T   C N      CD    +G+C +N  +M  +C K+CG C       T   +   C +  +E  C+RW+K  ECE N K M   C K+C        NC P    +   +                 C N++ D ICE  K    C  +   M  +C+K+C  CSK        +  C+++Y ++ C++   KG CE+   FM   C K+C  C  I  +I+ S       C+NK     C+     G+C+   +FM   CA+TC LC  N+ +T        GC+N+  DK C  W+++  C   + F++  C+K+C  C  K    + +C++    E C+ WK  G C + P  M  +CA SC  CD K           K I+   C+N+  +  C  W    +C+ N  +M  +C K CG C    +     G C + YS   C  W   G C+ +   + + C+K+C  C   KD
Sbjct:    5 KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDK------KVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC------LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK--------TLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQ---QEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKD 559          

HSP 6 Score: 199.134 bits (505), Expect = 8.743e-54
Identity = 158/584 (27.05%), Postives = 267/584 (45.72%), Query Frame = 2
Query: 1136 MTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQK-PLCRNVYNDSICES--MKAKCHTDAPFMKLRCKKTCEMC-SKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCR-------NCRPII-----------------EIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYE----------ECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFV-----CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTC--QTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCN---------------MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDK-KVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNN 2704
            MT+  C+N      C++   +G+C +N N+MK+ C+KTC FCD K+   +       C +  +++ C+  AK + C+ NS  M +MC  TC NC      I+    C N+Y+  +C+S  +  +C  +  FM   C K+C  C +K +N +      C+++ +   C+     G CE+ P +M   C K+C        NC P                   +I   ++C N      C++    G C+     M   C ++C  CS  +    C+N+  D+ C+ W+K   C  N  FM++ C K+C +C+  +++           C++ +    C  ++E G C  +  FM  +CA++CG C       S +      CKNV+ +K C  W   G C+    F++  C K+C  C  +  N        C+NV  D  C  WK+ G C +   ++  KC+ +C  C+               +    C+N+     C  W R  +CEKNP++M++ CRK C  C + K ++ +C +  +   C + A +  C++   +M + CA +C  C  F K +K NN
Sbjct:    1 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKIS-------CKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDR-----NCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE---CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRF----AQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDF-KDLKYNN 564          

HSP 7 Score: 195.667 bits (496), Expect = 1.388e-52
Identity = 161/575 (28.00%), Postives = 259/575 (45.04%), Query Frame = 2
Query:  995 KKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNC--EPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPP-------------------------CKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNIN----------STGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEE---------CEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFV-CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNL---------DSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK---CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC 2536
            K  C+N      CE W + GEC++NP +M ++C+K+C  C ++    + +I C+N   ++ C+ L     C +N  YM   C  TC  C    L   S  +   C +    R C  W  + EC  N K M K C K+C NC  +PK D+     C N+ N+S CE  S   +C  +  +M + C K+   C+K +N+    SP                          C +++ ++ C+  K  G C++    M ++C K+C  C   +E +N  D       + C++ A KGKC+  + FM + C ++C  CSL IN          +  C+N   D  C+ + +   C  +  FM  +CAKTC  C A              C++ Y+ ++C  W E+G C N   F+L  C++SC +C  K   ++ F  C+NV  ++ C+ WK+ G C++    M   C  +C  C   + T L         ++  C N+  D  C++W  +  C      +   C K CG C   K +   C + Y++  C  W   GEC +   +M   C K+C+ C
Sbjct:    3 KDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKK----VEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCS---LFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN----CENLGNESNCERWSKMGECEKNPKYMLINCAKS---CNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYD------DQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSL-INFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKV--LNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 554          

HSP 8 Score: 188.734 bits (478), Expect = 3.181e-50
Identity = 154/529 (29.11%), Postives = 234/529 (44.23%), Query Frame = 2
Query:  839 FENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKI---CKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKIL---IFTSTHSPEL-----------------CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCS----KGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRP-----IIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNI--NSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKS--------------YEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNE 2275
             E   C+N   D  C    K   C+ NS YM   C  TC+ C    ++F K  K    C N    + C++W   GEC +NP +M   C KSCG C   +T P    +C N   E  C+R    G+C +N  YM +NC K+C    +  +     TST SP++                 C +   +  C+ W K   C+ N KLM   CRK+C  C    +      C+NVY+D  CE  + K KC  +  FM + C K+C  CS    + + S+   +  C++ + +  C+S +  G C++   FM  KC KTC  C+       I       CKN    + C + A  G C++   F+   C+++C  C+  +      C+N+  D+ CK W    +C      M ++CA +C++C+ KS                 C +      C  W    +C  NP +M   C ++CG C  + +   N  C + +    C+ W N GEC   + +M ENC K+C  CQ F +
Sbjct:   46 VEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNC----SLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC---LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE------CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGN--CADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKD 559          

HSP 9 Score: 97.4413 bits (241), Expect = 2.175e-20
Identity = 76/265 (28.68%), Postives = 120/265 (45.28%), Query Frame = 2
Query:  818 QCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKC---YKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPEL------CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESM--KAKCHTDAPFMKLRCKKTCEMCSKGQNSKF 1579
            Q    E   N RC+NK  D  C   +++G C+ +  +M   C KTC  C       +I+   +  CKN  KDK C  WA+ G C+    ++   C KSC  C  ++     Q  C+N   +E C +  S G C    N M++ C  +C  CD K     S   P        C +   +  C  WA+ ++CE N   M+  CRK C  C   ++K Q+  C + Y+   C +   + +C+    +M   C K+C++C   ++ K+
Sbjct:  302 QIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ--CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCT--REKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKY 562          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074510.1 (SMESG000074510.1)

HSP 1 Score: 1061.98 bits (2745), Expect = 0.000e+0
Identity = 533/553 (96.38%), Postives = 537/553 (97.11%), Query Frame = 2
Query:   65 MTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEI 1723
            MTLKI HSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVN+DINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYLHELGHVLGLLHEHTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKIC+NFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSK LIFTST SPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYP      C    RN   ++EI
Sbjct:    1 MTLKIHHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNDDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYLHELGHVLGLLHEHTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPIL----CL---RNVLKLVEI 546          

HSP 2 Score: 119.398 bits (298), Expect = 2.330e-27
Identity = 90/288 (31.25%), Postives = 143/288 (49.65%), Query Frame = 2
Query: 3062 CTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE--------CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNN-RCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQA-NMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLN-RFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNP 3892
            C N   DD C + KK+G+C+ N K M   CRK+C KC K           C+N   D++CENWAK+G+C++N  +M + C KSCG C      +EE    +    C+NK  +  C+     G+C ++  +MK  C KTCG C +  +  TS  S  P  C +   ++ C  WA++  C   S  +  +C K+C NC  K    +   C NV  D  C+  K++ H ++    M+++C  +C+ C        S  + +K I +  C++I  + +C     +  CE+ P
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGIC------VEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQS--PELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDA--PFMKLRCKKTCEMC--------SKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYP 533          

HSP 3 Score: 114.005 bits (284), Expect = 1.132e-25
Identity = 91/318 (28.62%), Postives = 140/318 (44.03%), Query Frame = 2
Query: 2423 KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVE-----KMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC------LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK--------TLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQI 3319
            +C+N      C   K+ G CE N  +M + CRKTC  C K        K  C+N + D+ CE+ AK+  C +N  YM   C  +C  C     +  T   C N      CD    +G+C +N  +M  +C K+CG C       T  ++   C +  +E  C+RW+K  ECE N K M   C K+C        NC P    +  P+                 C N++ D ICE  K    C  +   M  +C+K+C  CSK        +  C+++Y ++ C++   KG CE+      +LC+++  K   I  ++
Sbjct:  263 RCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCK-------NCEPKKDKIQKPL-----------------CRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCER----YPILCLRNVLKLVEIAVRL 550          

HSP 4 Score: 107.457 bits (267), Expect = 1.414e-23
Identity = 96/329 (29.18%), Postives = 144/329 (43.77%), Query Frame = 2
Query: 1451 CRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNC-----RPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLC---SLNINSTG----CRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTC-QTFNETNLDSGYCENVYSDRICNFWKTEGFCSAK----YRNVLK 2380
            CRN   D  C   K    C  ++ +M + C+KTC+ C K +         C++   ++ C++   +G C+R P +M+ KC K+C  C      P+ +I    DC+NK    KC  L   GKC     +M +NC +TC  C   +L   ST     C +  S++ CK W+KN+ C IN+  M   C KTC+ C  K     +D  +K LCR                                       NV+++  C+  K   +C T+  FM   C KTC  C +  N   + S  C+++YS+  C   K++G C        RNVLK
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQI----DCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPK-----KDKIQKPLCR---------------------------------------NVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 5 Score: 107.457 bits (267), Expect = 1.452e-23
Identity = 82/282 (29.08%), Postives = 130/282 (46.10%), Query Frame = 2
Query: 2006 CEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGI---SNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCN---------MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDK---KVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKS-IKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAK 2803
            C +    + C   K+ G C  N ++M   C ++C  C  K+K I      +C+N   +K C+ W   GEC+ N  +M   C K+CG C     T +    C N   +  C+   + G C      +   C KTCG C+          + + C +  +   C++W ++ ECE N   M+  CRKTC+ C+    K++K  C+N+ ND +CES+  K  C  ++ +M   C  TC  CS    S   T+  C ++Y    C S +  G C + P   L++  K
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKC-YKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAK--CHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 6 Score: 106.686 bits (265), Expect = 3.021e-23
Identity = 84/311 (27.01%), Postives = 140/311 (45.02%), Query Frame = 2
Query: 3188 CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVL-----NRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQE----GNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLK 4093
            C+N  +D  C +  K G CE N K+M + C K+C KC       ++ +K     C+N   D TCE++ + GECQ++  +M  KC K+CG+C   MT         + C+N  +++ C+    +G C     ++   C K+C  C  K L          C +   +  CK+W     CE     M+  C  +C+ C+   P      KP        CRN+  D  C   + + +C  +  +M++ C+K C +C++ +  +      C D YS  +C++  ++G C R  +    N  K  +I      LK
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKK----ICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMT----QIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCE---PKKDKIQKPL-------CRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLKLVEIAVRLLKLK 554          

HSP 7 Score: 106.301 bits (264), Expect = 3.701e-23
Identity = 89/302 (29.47%), Postives = 130/302 (43.05%), Query Frame = 2
Query: 2738 DSWEID----GECIKNPKFMLKSCAKSCGNCL----TKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC-SKTL---------ECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFIL 3589
            D W  D    G C  N K+M  +C K+C  C        K  + C N   +  CE W+K GEC++NP YM I C KS          C      M+ P+T               +C N   ++ C+     G C +N   M   C+K+CG C SKTL          C +   +++C+ WAK  +CE N K M  +C K+C  C     +I++        C+N + D  CES +   +C     FMK +C KTC +C     N+   ++ P  CK++Y ++ C      G C       L
Sbjct:  270 DDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKS----------CGICVEEMTTPMTQ-------------IDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKP------LCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQ-NSKFITSPP--CKDIYSNEKCKSLKSKGHCERYPILCL 537          

HSP 8 Score: 97.8265 bits (242), Expect = 1.802e-20
Identity = 74/260 (28.46%), Postives = 118/260 (45.38%), Query Frame = 2
Query: 3329 EKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ--CHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCT--REKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKY 4096
            E   N RC+NK  D  C   +++G C+ +  +M   C KTC  C       +I+      C+N  KDK C  WA+ G C+    ++   C KSC  C  ++     Q  C N   +E C +  S G C    N M++ C  +C  CD K+    S   P        C +   +  C  WA+ ++CE N   M+  CRK C  C   ++K Q+  C + Y+   C +   + +C+    +M   C K+C++C   ++ K+
Sbjct:  257 ETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKC---YKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPEL------CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESM--KAKCHTDAPFMKLRCKKTCEMCSKGQNSKF 505          

HSP 9 Score: 72.4034 bits (176), Expect = 1.684e-12
Identity = 37/38 (97.37%), Postives = 37/38 (97.37%), Query Frame = 3
Query: 1662 PILCLRNVLKLVEIAVRLLKLKTLPTVRIRRHFESVKI 1775
            PILCLRNVLKLVEIAVRLLKLK LPTVRIRRHFESVKI
Sbjct:  533 PILCLRNVLKLVEIAVRLLKLKILPTVRIRRHFESVKI 570          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074522.1 (SMESG000074522.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 418/1097 (38.10%), Postives = 615/1097 (56.06%), Query Frame = 2
Query:  827 IPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKN-KETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK---CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC---LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC-SLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLC-QANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCD--FKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQD 4078
            IP   + + C N   +D C      G C  N K+M  NC K+C+ C        +    C N  K+  C+ W++ GEC +NP YM + C KSC  C         Q +C N  ++ +C+     G+C +N  YM VNC K+C  CDS             C +  ++  C +W+   EC+ N K M   C K+CK+C+ +++      C N +ND+ C   S   +C  +  +M + C K+C  C      K      C +I S+++C++   +G C + P +M   C K+C +C    ++   T C N  +   +C+  + KG+C     FM  NCA++CN+C  N  + GCRNL+ +  C+ W +   C  N  +M VQC K+C RCNAK+Y +C+D Y+++ C+ WK+ G C+ NP FML +C+Q+CGSCD++   +    CKN+   + C  W+  GEC+ N  +M+ NC K C TCQ  +  N++   C++VYSD  C  WK EG C  +   +  KCSKTCG C+  K+    CQN YN A+C KWK  GEC KNPNFM +QC+++C  C+K  +  +C NL ND+ CE  A ++ C KNS YML+ C  +CNNCS  + +   +  C NL +   C+SW   G C KN  +MLK CAKSC  C   +T      NC N  N+S CE    +G+CEKN  +M+  C KSC        +C PA    S   T                C NL++DD C+ WKK G C    K M S C KSCG+CS+  EC+N+Y++  C+ WA +G+C KN KFM+ LC+KSCG+C  L N ++  +    ++ C+NK+GD++CE+++++GEC+++ +FM D+C+K+CG C ++  T+TS        CKN Y +K+C+EW ++G C++ S F+   C++SC +C     +   +C N+   E C K K  G CE     M   CA +C KC+  F  P  ++ +      +   C N AGD QCSYWARQ QCE N SYMR+ C+K+CG C  EK  + +C DK++T++C +W+ RGEC+R   WM ENCAKSC +CQ+
Sbjct:  264 IPS--DGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNC----KTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYC---KFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS----------DRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDSERE------CLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGT----CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQL--PTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKK-CDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCG-------SCRPAKEKTSENKT----------------CLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTN---SDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 1302          

HSP 2 Score: 501.901 bits (1291), Expect = 3.318e-154
Identity = 377/1196 (31.52%), Postives = 544/1196 (45.48%), Query Frame = 2
Query:  929 MSVNCRKTCDKCYKYKAIF--DKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHS---------PELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKG---------------------------------------QNSKFITSP--PCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNIN-STGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKD---KCQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTK--PKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSC-----NKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPI-------------LSN----CTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK-------------------------------TLE---------------------CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKC-DFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGN--------CADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFK 4084
            M +NC K C KC      F        CK+  ++ +C +WA   EC +NP +M+  CKKSC +C+ +         C N+ +   C      G+C  N+ YM+ NC+K+C FC    +  T+T S           LC +K  ++ C+ +    EC  N   M   C K+C  C+  K      LC+N+  D+ CE +K   +C  +  +M++ C KTC  C+                                          N   I S    C +IY N+KC+   + G C + P FM   C K+C NC+     +N ++C N     +C   +  G+C     +M +NCA++CN C  N +    C N + D +C+ WSK   C  N  +M+V CAK+C+ C+  S  EC +++    C  W   G C  NP++ML  CA+SC SCD      S   C N  ++  C  W + GEC  N ++M+ NC K+C +C++   +N D G C N+ SD+ C  W   G C+   + +L  C+K+C +C         C N++ N   C KW   GEC KNPNFM   C K+C  C    E   C+NL  +  CES  +   C  N  YM   C  +C  C     + KT   C ++Y    C +W+  GEC KNP FML  C+++CG+C  +  P     C+N+ +  NC  W   GECEKNP YML+NCAK+C     +  KN    C    S +S        L   + + +             L N    C N + D IC +WK MG C KN   M  QC++SCGKC K                                LE                     C N+ +D  CE+W+K G CEKN+ +ML  C KSC  C+ +   I  S   +N  C NK  D TCE+ + +G+C+K+ +FM +KC K+CG C+     TS   NK   C N+YKD  C+ W ++G C     F+L+ C KSC  C+      +++C N+  +  C KW + G C      M   C  SC +C D K+             N+  C N  GD  C  W +  +CE+NP +M   C K+CG C +      +        C + YS   C  W   G+C     +M  NCA+SC  CQ+ K
Sbjct:    1 MELNCAKACGKCGTDSDGFLDPDKDDDCKDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEK-----CTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPG-NDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASIVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCK--TSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCD--SDRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCD------SERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKS---SNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC-----NAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRL---ITTSLPSIN--CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTS--ENKT--CLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCS-----EYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNL-------KVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK 1151          

HSP 3 Score: 459.529 bits (1181), Expect = 9.096e-139
Identity = 352/1088 (32.35%), Postives = 510/1088 (46.88%), Query Frame = 2
Query: 1226 MKVNCQKTCGFCDSKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNC---EPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMC--SKGQNS-----KFITSPP----CKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCN--AKSYEECEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTN-NSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLG-NESNCERWSKMGECEKNPKYMLINCAKSCN--KRKNTPVNCS--PATSTMSPPITSNTLLHVTKKIPI-------------LSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK------TLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSC---------TNC---------------------TGKVLNRFAQ-----------------CHNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTAL--------------------------------------SYSKPAKVINTAN--CRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYN 4099
            M++NC K CG C +    F      + C D   E +C  WA  NEC  N   M KMC+K+CK C   EP+K       C N Y++  C   S   +C ++  +M+  CKK+C+ C  SK Q +       IT P     C++ Y ++ C+  KSKG C + P FM  +C K+C  C+   +  N + CKN E    C+ L  +G+C   + +M +NCA+TC  C+ +I    C N   D +C  WSK   C  N  +M++ CAK+C  C+      ++C + YR + C  W  AG C  NP+FML  CA+SC +C    +  SN  C N+     C  W   GEC  N  +M+ NC K+C  C+ FN+ +L    C N + D  C  W   G C    + +L  C+K+C +C+  ++ C N +N A C KW   GEC+KNP +M + C K+C+ CD + E   C N  ND  C   +    C KN  YML  CA +CN+C    KS  T+  +C N+   + C++W   GEC KNPK+ML +CAKSC +C +  +    C N+  NE  C +WS+ GEC KNP +ML NCAKSCN  K  N    C      S       +   L+  K + +               +C +++++D C+ WK +G C KN   M S+C ++CG C           C+N+  +++C  W   G+CEKN  +ML+ C K+C  C       ++  K+V  +C + + D +C  ++  G C+K  L MK KC+KTCG C     N ++       C+N Y D IC +W   G C     F+L  C +SC         TNC                     +  +L R  +                 C N+A D +C+ W   GHCE   + M   CA SC+ C+    T+L                                         +PAK   + N  C N+  D  C  W +   C   P +M   C K+CG C+   +    C + Y+ I C  WA  GEC +   +M + C KSC  C D K+LK N
Sbjct:    1 MELNCAKACGKCGTDSDGFLDPDKDDDCKDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEK-------CTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKET-KPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASIVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSN--CVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCK-FNK-DLQKN-CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSDRE-CVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDSERE---CLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSC----KSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQ------KDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM-------CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE----CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVN 1050          

HSP 4 Score: 391.734 bits (1005), Expect = 1.780e-114
Identity = 307/951 (32.28%), Postives = 441/951 (46.37%), Query Frame = 2
Query:  845 NRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKILIFTSTHSPELCFD-KLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNC----RPIIEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLC----SLNINSTGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEE--CEDSYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCN------MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFC----DKKVEKMSCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCL------TKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCN---KRKNTPVNCSPATSTMSPPITSNTLL-HVTK-------------------------KIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC------------------SKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQAN 3469
            +R C N + D  C     +G C+ N KYM VNC K+C  C          ++ C N   D  C  W+  GEC +NP YM + C KSC  C    T   T   C N   +++C+     G+C +N  YM +NC K+C  C+S      +T  P  C +   +E  C++W++  EC  N   M + C K+C  C   K   +   CRN+  +S CES K   +C  +  +MK++C K+C  C    N+K  T   CKDIY  + CK+ K  G C + P FM +KC +TC +C     P++       CKN ++   C      G+C+    +M +NCA+ C  C    + N+    C ++ SD  C  W     C   +  M V+C+KTC  C+     +  C+++Y   +C  WK  G C  NP FML QC +SCG C+   K   N  C N+ ++K C+ W  + EC  N ++M+E C K+C  C + +     S  C N+ +D  C  W   G C      +LK C+K+C  CN      +    C N  N + CE  K  G+CEKN  FM  +C K+C  C    +K  E  +C NL  D  C+   K   C     +ML  C  +C  CS +++       C NLY+  +CD W  +GEC+KN KFM++ C KSCG C           N   CEN   + +CE W ++GECE+NP +M   C+KSC    K   T  +     S++     SN L    TK                         K  +   C N+   + C + KK G C+KN K M   C  +C KC                  S   +C N   D  C  WA++ +CE N  +M + C KSCG C +        EK     C +KF    C S+   GEC ++  +M + CAK+C +CQ N
Sbjct:  402 DRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSC--------DSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGT---CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCES------ATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC---KFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC----NAK--TYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVV----VETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKK-CDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCE---KLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE-------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLM--------EKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 1303          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074521.1 (SMESG000074521.1)

HSP 1 Score: 330.102 bits (845), Expect = 3.218e-102
Identity = 164/334 (49.10%), Postives = 227/334 (67.96%), Query Frame = 2
Query:   65 MTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYXXXXXXXXXXXXXXTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICKNFEKDKTCENWAKRGECQR 1066
            M   +   N + ++  F I     + R KRAV+   A +W +  IPYYID + FN EE++ L DAI+ WN ETCV FR K   D NWVKITGG  C+S VGM+   EQ ++LASP CR YG YLHELGH +GL HEH R  R+ ++ +  + IQ  + + + +N+ S+   +++P+DLQS+MHYG  SF    G+P+I V N S+ HLL EV  KDLSFLD K++NL+YKCAD C + V+C   GY+D++CQCH PE+FE+RRC++KN++ WC +Q+K G+CE  +KYMS NCRKTC+KC+K++  F    K CKN EK++TC+ WA  G  ++
Sbjct:    1 MNFILFPWNFLGLIFGFFIVFHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWANEGSAKK 334          
The following BLAST results are available for this feature:
BLAST of Metalloendopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLL24.222e-1232.79tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844][more]
MEP1B5.057e-1228.87meprin A subunit beta [Source:HGNC Symbol;Acc:HGNC... [more]
MEP1B5.183e-1228.57meprin A subunit beta [Source:HGNC Symbol;Acc:HGNC... [more]
TLL11.136e-1134.76tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL11.418e-1134.76tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nas-338.829e-2029.85Zinc metalloproteinase nas-33 [Source:UniProtKB/S... [more]
dpy-311.580e-1930.56Zinc metalloproteinase dpy-31 [Source:UniProtKB/S... [more]
nas-361.974e-1932.53Zinc metalloproteinase nas-36 [Source:UniProtKB/S... [more]
nas-304.928e-1929.93Zinc metalloproteinase nas-30 [Source:UniProtKB/S... [more]
nas-141.386e-1726.39Zinc metalloproteinase nas-14 [Source:UniProtKB/S... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG66964.671e-1633.75gene:FBgn0030947 transcript:FBtr0074611[more]
CG57152.805e-1529.72gene:FBgn0039180 transcript:FBtr0084634[more]
tld2.671e-1431.71gene:FBgn0003719 transcript:FBtr0084691[more]
CG67631.934e-1331.68gene:FBgn0039069 transcript:FBtr0084378[more]
CG67631.934e-1331.68gene:FBgn0039069 transcript:FBtr0334497[more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll11.903e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll11.903e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll11.903e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
mep1b2.073e-1431.40meprin A, beta [Source:ZFIN;Acc:ZDB-GENE-041014-20... [more]
mep1b2.444e-1431.40meprin A, beta [Source:ZFIN;Acc:ZDB-GENE-041014-20... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc593.755e-1432.16leucine rich repeat containing 59 [Source:Xenbase;... [more]
tcp11l28.757e-1426.93t-complex 11, testis-specific-like 2 [Source:Xenba... [more]
tcp11l21.264e-1328.74t-complex 11, testis-specific-like 2 [Source:Xenba... [more]
lrrc591.621e-1334.71leucine rich repeat containing 59 [Source:Xenbase;... [more]
ENSXETT00000007740.16.354e-1332.20tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tll21.802e-1234.29tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll22.028e-1234.29tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll16.648e-1234.76tolloid-like [Source:MGI Symbol;Acc:MGI:106923][more]
Bmp13.561e-1133.75bone morphogenetic protein 1 [Source:MGI Symbol;Ac... [more]
Mep1b5.632e-1130.58meprin 1 beta [Source:MGI Symbol;Acc:MGI:96964][more]
back to top
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98068|SPAN_STRPU2.232e-2331.45Protein SpAN OS=Strongylocentrotus purpuratus OX=7... [more]
sp|P42674|BP10_PARLI1.271e-2231.73Blastula protease 10 OS=Paracentrotus lividus OX=7... [more]
sp|A0A0C5PRQ1|NAS35_TELCI2.384e-1931.85Zinc metalloproteinase dpy-31 OS=Teladorsagia circ... [more]
sp|P55114|NAS33_CAEEL1.123e-1829.85Zinc metalloproteinase nas-33 OS=Caenorhabditis el... [more]
sp|D5FM38|NAS36_BRUMA1.435e-1832.75Zinc metalloproteinase nas-36 OS=Brugia malayi OX=... [more]
back to top
BLAST of Metalloendopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H5F61.185e-12728.28Metalloendopeptidase OS=Lingula unguis OX=7574 GN=... [more]
A0A2C9KD445.818e-10128.53Metalloendopeptidase OS=Biomphalaria glabrata OX=6... [more]
W6UF008.902e-8132.12Metalloendopeptidase OS=Echinococcus granulosus OX... [more]
A0A1S3H8W21.223e-7830.03protein draper-like OS=Lingula unguis OX=7574 GN=L... [more]
A0A068WRN12.137e-7434.16Metalloendopeptidase OS=Echinococcus granulosus OX... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035816.14.007e-1628.83meprin A subunit alpha-like [Source:NCBI gene;Acc:... [more]
tll11.612e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll11.796e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll11.842e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll12.025e-1436.59tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001798.13.292e-1227.14pep scaffold:Pmarinus_7.0:GL485204:1983:11197:1 ge... [more]
ENSPMAT00000007253.11.814e-1132.32pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1... [more]
ENSPMAT00000004913.14.047e-743.82pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 g... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO472613.837e-3429.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377705.743e-2534.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396272.891e-2436.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431321.590e-2331.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499491.275e-2130.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll12.383e-1436.59tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
alv2.427e-1435.75alveolin [Source:NCBI gene;Acc:100049214][more]
tll12.690e-1436.59tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
alv3.017e-1435.75alveolin [Source:NCBI gene;Acc:100049214][more]
ENSORLT00000018637.27.143e-1431.91pep primary_assembly:ASM223467v1:3:32702055:327050... [more]
back to top
BLAST of Metalloendopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074509.15.104e-8599.26SMESG000074509.1[more]
SMESG000074509.18.332e-7399.29SMESG000074509.1[more]
SMESG000074510.12.330e-2796.38SMESG000074510.1[more]
SMESG000074522.13.318e-15438.10SMESG000074522.1[more]
SMESG000074521.13.218e-10249.10SMESG000074521.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027667 ID=SMED30027667|Name=Metalloendopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=4244bp
CATTCATATACTTTAAACAATCAAACTTTATAAACCGAAAACTGTGAATT
GTAAATTAATTAAAATGACATTAAAAATACTCCATTCTAATCTAATTGTG
GTATTATTAACATTCAATATATGTCTAACTCTTTCGTCGATCAGAGACAA
AAGAGCTGTCATATCTACTCAAGCTACAAAATGGACAAATCGAACTATAC
CATATTACATTGATGAATCAGTTTTCAATGTTGAAGAGTTGACTCAGTTG
CATGATGCGATTGATGCATGGAATATGGAAACTTGTGTGAGATTTCGAAA
GAAGGTAAATGAAGATATAAACTGGGTTAAGATCACAGGCGGAACACAAT
GTCATTCTTTTGTTGGAATGAATGAAGAGGGTGAACAAAGTTTAAGTCTT
GCCTCTCCAGACTGCCGATTTTATGGAACTTATTTACATGAACTAGGTCA
TGTGTTGGGTCTTCTCCATGAACATACTCGACCTGGAAGAAATCAATTTA
TTCACGTGCATAGAGATAAAATTCAGGAGGGTCATGAAGAGTTTTACAAC
GAGAATGACATGTCCGAGTTAAACTCATACAATCTTCCGTATGATCTTCA
ATCAGTGATGCATTATGGATCAAAGTCTTTTTCAGGACATGATGGGCAAC
CGACAATAAATGTAAAAAATAGCTCGCTTACACATTTACTTGAAGAAGTA
GATGCCAAAGATTTATCTTTTTTAGATGTAAAGATCATTAATTTACATTA
CAAATGTGCAGACTTGTGTGAAAGAAAGGTATCTTGTCCACTGAACGGCT
ATGTGGACAAATTCTGCCAATGTCATATTCCTGAAACCTTCGAAAACCGA
CGATGTCGGAACAAAAACGAGGACGACTGGTGCACGGATCAAAAGAAACT
AGGCAATTGTGAATACAATTCCAAATACATGTCTGTCAACTGCCGAAAAA
CATGTGACAAATGCTATAAGTACAAGGCAATATTCGATAAAGGTAAAAAA
ATTTGTAAGAATTTTGAAAAGGATAAAACTTGTGAAAATTGGGCTAAAAG
AGGCGAGTGTCAAAGAAATCCCGGCTATATGAACATAAAATGCAAAAAGT
CATGTGGAATATGTGTAGAGGAAATGACAACACCAATGACACAAATAGAC
TGTAGAAATAAACTAGAAGAGGAGAAATGTGACCGATTAATGTCAAATGG
GAAATGTTTTGAAAATAAGAATTACATGAAAGTCAACTGTCAAAAGACAT
GTGGATTCTGTGATTCGAAAATCTTAATATTTACCTCCACTCATTCTCCT
GAGCTTTGCTTTGATAAATTAAGTGAACGTACTTGCAAAAGGTGGGCTAA
AAACAACGAATGTGAAATAAATTCAAAACTCATGCAGAAAATGTGCAGAA
AAACCTGCAAAAATTGTGAACCCAAAAAAGATAAAATCCAGAAACCTCTA
TGTAGGAATGTCTATAATGATTCCATATGTGAATCAATGAAAGCCAAGTG
TCACACTGACGCACCATTCATGAAGCTACGATGCAAAAAGACCTGTGAAA
TGTGCTCAAAAGGTCAAAATTCAAAGTTTATCACGAGTCCTCCGTGCAAG
GATATTTATAGTAATGAAAAATGTAAAAGTTTAAAGTCAAAAGGACACTG
TGAAAGATATCCCTATTTTATGTCTACGAAATGTTTTAAAACTTGTAGAA
ATTGCCGTCCGATTATTGAAATTAAAAACTCTACCGACTGTAAGAATAAG
GAGACATTTCGAAAGTGTCAAGATTTAGCTGGCAAAGGAAAATGTAAAAG
TGAATTGATTTTCATGTCAATAAATTGTGCTAGAACTTGTAATTTGTGTT
CCCTTAATATCAACTCCACCGGATGTAGGAATCTCAATTCCGATAAACAA
TGCAAAATGTGGAGTAAAAATGACAACTGTTCTATTAATGCCCCCTTTAT
GATGGTACAATGTGCAAAGACATGTAGACGATGTAACGCAAAGAGTTACG
AAGAATGCGAAGATTCTTATAGAAAAGAATTGTGTAGATTGTGGAAGGAG
GCTGGACGATGTTACAATAACCCAAGGTTTATGCTTCACCAGTGTGCCCA
ATCATGTGGCAGTTGTGATTTGAAGTTTAAGGGAATTTCGAATTTTGTCT
GCAAAAATGTTTTTGATGAGAAATTTTGTCAACTCTGGAAAAACGATGGA
GAATGCAAAACTAATCGAGAGTTCATGATTGAGAATTGTGGAAAGACTTG
TGGAACTTGTCAAACCTTTAATGAGACGAATTTGGATTCTGGATATTGTG
AAAATGTCTATTCTGACAGAATCTGTAACTTTTGGAAAACTGAGGGGTTT
TGTTCAGCAAAATATCGAAATGTACTCAAGAAATGTTCAAAGACTTGTGG
AAACTGTAACATGACCAAAGACAAATGTCAAAATGTATACAACAGTGCTG
TTTGTGAGAAATGGAAAAGATCTGGTGAATGTGAGAAAAATCCCAATTTT
ATGAAGCTTCAATGTCGCAAAACTTGTAGATTTTGTGATAAAAAAGTCGA
GAAAATGTCATGCAAAAATTTACAAAATGATCAAGTTTGCGAATCGCTTG
CTAAAAAAGACCTCTGTGACAAAAATTCTGCTTACATGCTTCAGATGTGT
GCTAATACTTGTAATAATTGTTCATTATTTACCAAGTCAATTAAAACAAA
TAATTCCTGTGTTAATTTATATCATTATAGAATGTGCGATTCCTGGGAAA
TTGATGGGGAATGCATAAAAAATCCAAAGTTCATGTTGAAAAGTTGCGCA
AAATCATGCGGAAATTGTCTCACAAAGCCGAAAAATGATCGAAATTGTGA
AAATTTAGGCAATGAATCAAATTGCGAAAGATGGAGTAAAATGGGGGAAT
GTGAGAAGAATCCGAAATATATGTTGATAAATTGTGCAAAATCCTGCAAC
AAACGGAAAAATACTCCAGTTAATTGCTCACCAGCAACGTCCACAATGTC
ACCCCCAATAACTAGTAACACGTTATTACATGTCACAAAAAAGATTCCAA
TTCTTTCAAACTGCACAAATCTTTTCCGAGATGACATCTGTGAGGAATGG
AAGAAAATGGGAAGTTGTCAAAAGAATCACAAATTAATGTTTTCCCAATG
CCGTAAATCATGCGGAAAATGCAGTAAAACCTTGGAATGCCAGAATGTTT
ACGATGACCAATCATGCGAAAATTGGGCTAAAAAGGGAAAATGCGAGAAA
AATATGAAATTTATGTTGATGCTCTGCATGAAGTCTTGTGGAAAGTGTTC
TTTGATAAATTTTCAAATTGAAGAATCAGAAAAACATGTTAATAATCGAT
GTCAAAATAAATTCGGAGATTTTACCTGCGAATCCTATAGAGAAATAGGT
GAATGTCAGAAGAGCTTTCTATTTATGAAAGATAAATGCGCTAAGACTTG
TGGACTTTGTCAAGCGAATATGACAAATACGTCAATTTACTCAAATAAAC
CTATGGGATGCAAAAATGTCTACAAAGACAAAATATGCAACGAGTGGGCC
GAAAGTGGAATGTGTAGAAATACCTCAACGTTTATTTTAACAGTTTGTTC
GAAATCTTGCACAAATTGCACAGGAAAAGTGCTCAACCGCTTTGCCCAGT
GTCACAATGTAGCTGGAGATGAAAACTGTAAGAAATGGAAATCAAGAGGT
CATTGTGAAAGTTACCCAAATTCGATGAGAATAAAATGTGCTCTCTCTTG
TCAAAAATGTGATTTTAAGTCACCAACTGCTTTATCATATAGCAAGCCAG
CTAAAGTAATTAATACGGCAAATTGTAGAAATATTGCTGGTGACTTACAA
TGCTCGTATTGGGCGAGACAAGATCAGTGTGAAAAAAATCCTTCCTACAT
GCGAATTTCATGTCGAAAAGCTTGCGGTGTTTGCACTAGAGAAAAACAGC
AAGAAGGTAATTGTGCTGATAAATATTCCACGATCCAATGTCGAACCTGG
GCTAATAGGGGAGAATGTAACAGACAGAAAGTTTGGATGAATGAAAACTG
TGCTAAATCTTGCAAAATCTGTCAAGATTTCAAAGATTTAAAATATAACA
ATGAAGATCAAAAAGTAGAAGACGAAGACAAAAAATAATTCCTAGCCTTA
TATTAATTATTAAATTTTCTAAAATGTTATCAAAACGTTTTTCTAATTAT
TAGACAAGTTTATTATTAAAATAAATTTGATGCATCGAAAACAA
back to top

protein sequence of SMED30027667-orf-1

>SMED30027667-orf-1 ID=SMED30027667-orf-1|Name=SMED30027667-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1358bp
MTLKILHSNLIVVLLTFNICLTLSSIRDKRAVISTQATKWTNRTIPYYID
ESVFNVEELTQLHDAIDAWNMETCVRFRKKVNEDINWVKITGGTQCHSFV
GMNEEGEQSLSLASPDCRFYGTYLHELGHVLGLLHEHTRPGRNQFIHVHR
DKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINV
KNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKF
CQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKC
YKYKAIFDKGKKICKNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGIC
VEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCD
SKILIFTSTHSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKN
CEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMCSKG
QNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPYFMSTKCFKTCRNCRPI
IEIKNSTDCKNKETFRKCQDLAGKGKCKSELIFMSINCARTCNLCSLNIN
STGCRNLNSDKQCKMWSKNDNCSINAPFMMVQCAKTCRRCNAKSYEECED
SYRKELCRLWKEAGRCYNNPRFMLHQCAQSCGSCDLKFKGISNFVCKNVF
DEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDSGYCENVYS
DRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKW
KRSGECEKNPNFMKLQCRKTCRFCDKKVEKMSCKNLQNDQVCESLAKKDL
CDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGEC
IKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNP
KYMLINCAKSCNKRKNTPVNCSPATSTMSPPITSNTLLHVTKKIPILSNC
TNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQS
CENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKF
GDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKPMGCK
NVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCHNVA
GDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVIN
TANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNC
ADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNNEDQK
VEDEDKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000421FA58C
IPR001506Peptidase_M12A
IPR006026Peptidase_Metallo
IPR003582ShKT_dom
IPR024079MetalloPept_cat_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003582ShKT domainSMARTSM00254ShkT_1coord: 560..598
e-value: 1.6E-5
score: 34.4
coord: 660..698
e-value: 0.019
score: 24.1
coord: 112..150
e-value: 5.4E-5
score: 32.6
coord: 209..247
e-value: 1.7E-4
score: 31.0
coord: 718..756
e-value: 1.0E-7
score: 41.7
coord: 23..61
e-value: 2.6E-4
score: 30.3
coord: 160..198
e-value: 5.5E-6
score: 35.9
coord: 68..106
e-value: 5.1E-6
score: 36.0
coord: 252..290
e-value: 2.6E-8
score: 43.6
coord: 392..430
e-value: 8.3E-5
score: 32.0
coord: 297..335
e-value: 3.6E-4
score: 29.8
coord: 464..502
e-value: 2.4E-5
score: 33.8
coord: 346..384
e-value: 9.9E-6
score: 35.0
coord: 613..651
e-value: 1.4
score: 17.9
coord: 506..544
e-value: 3.7E-6
score: 36.4
coord: 764..802
e-value: 4.1E-9
score: 46.3
IPR003582ShKT domainPFAMPF01549ShKcoord: 719..755
e-value: 1.2E-5
score: 25.7
coord: 210..246
e-value: 0.015
score: 15.8
coord: 69..105
e-value: 3.8E-5
score: 24.1
coord: 764..801
e-value: 2.2E-8
score: 34.5
coord: 465..501
e-value: 2.7E-5
score: 24.6
coord: 168..197
e-value: 2.1E-5
score: 24.9
coord: 305..334
e-value: 0.99
score: 10.0
coord: 113..149
e-value: 6.8E-6
score: 26.5
coord: 24..60
e-value: 0.02
score: 15.4
coord: 346..383
e-value: 6.4E-5
score: 23.4
coord: 507..543
e-value: 4.1E-4
score: 20.8
coord: 393..427
e-value: 1.3E-5
score: 25.6
coord: 614..650
e-value: 0.048
score: 14.2
coord: 660..697
e-value: 0.0034
score: 17.9
coord: 561..597
e-value: 3.2E-6
score: 27.6
coord: 252..289
e-value: 4.6E-7
score: 30.3
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 507..543
score: 10.272
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 661..697
score: 9.459
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 300..334
score: 7.541
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 210..246
score: 9.688
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 24..60
score: 10.804
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 253..289
score: 10.606
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 113..149
score: 7.144
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 465..501
score: 11.582
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 69..105
score: 9.337
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 1..12
score: 6.547
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 161..197
score: 10.009
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 347..383
score: 8.325
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 561..597
score: 10.36
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 719..755
score: 8.53
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 765..801
score: 11.044
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 393..436
score: 9.594
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 614..650
score: 8.389
NoneNo IPR availablePANTHERPTHR21724UNCHARACTERIZEDcoord: 246..427