GCR103

Overview
NameGCR103
Smed IDSMED30027658
Length (bp)1257
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR103 (SMED30027658) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR103 (SMED30027658) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR103 (SMED30027658) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR103 (SMED30027658) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027658

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027658SMESG000078225.1 SmedASXL_002935SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR103 vs. TrEMBL
Match: A0A193KUC5 (GCR103 OS=Schmidtea mediterranea OX=79327 GN=gcr103 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.388e-71
Identity = 160/365 (43.84%), Postives = 231/365 (63.29%), Query Frame = 3
Query:   57 NETITGFE--LILFYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSKPM-WNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFSXXXXXXXXXXXXXXSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSN----HRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLVILFRCKKHNWSRGKWNSKNI 1130
            N T T +E  LI FY Y VSW VPV++ FG SGT + I+VL+     + +I  WFL LS ND+  LI GL++LYL+KL LI ++    + D +SS  FVC+F S  ++F+L LSSW+Q GIS +R +S S PL ++T+ T S AR  L++ I   L+ S+++VN T+ Y E Y  N ++G RC+L  K+ + F+  SL+ +VIIP L+L+LSS +IW++L+ Q   R       N D     NS +P+    HS HS     +RN+S  LL MNL FLL+NLPFEIFK+I +N+++  IK   +   ++  RI DK FNI VY NQ+TNW+FYF+LGK+FR     +  C+     + +++ KN+
Sbjct:   10 NITTTKYEIRLIYFYHYVVSWLVPVILLFGCSGTSICIVVLVKTAKRRAKIWSWFLVLSTNDIISLILGLTSLYLNKLYLITNRASSISEDFRSSNIFVCHFLSTGLYFTLFLSSWMQVGISVIRTISISCPLFIKTRFTASVARKALVIHISITLLFSIILVNSTLIYDEVYSGNFSRGFRCKLSNKYDDLFYFVSLVFKVIIPTLILILSSIIIWRNLSSQYDSRD----FNNTDSIKFTNSDTPQ----HSEHSRRISINRNLSLTLLGMNLTFLLSNLPFEIFKVINRNFNINKIKLPKDFEDFLTMRILDKSFNISVYFNQATNWMFYFLLGKSFRTFFCKVIYCRNRTRFQRQYSLKNV 366          
BLAST of GCR103 vs. TrEMBL
Match: A0A1I8HY28 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.149e-29
Identity = 107/352 (30.40%), Postives = 174/352 (49.43%), Query Frame = 3
Query:   93 YKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLS------KLNLILSKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYKEEYLRNRTQGHRCRL----KKKFINTFFVFSXXXXXXXX-XXXXXXSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLV-ILFRCKKHNWSRGK 1112
            YKY  +W VP++   G +GTIV + VLL R +TQ E R WF+ALS  DL  L  GL  +YL+      K  L  +  + ++D +S     CY  +   ++ L+ SSW+Q GIS  R +S   PL  R ++  ++++  L + +   ++L++  V  +V+Y E    N   G          +K+ + ++ +S +V  +    + L +SS  I  SL+R +                 R  P+ + +         R IS  L+ MN  FLL  LP+E++ +IY       ++     +   L +I ++ F +L+Y N +TNW+FYF+LG  FR++L   LF C     S GK
Sbjct:  132 YKYLFAWLVPLLYVSGCAGTIVCVTVLLRRGSTQKEARPWFIALSLTDLCVLSVGLPIMYLNIVRAIVKAELSPTATVGSYDPRSWNAPACYGLTILQYYGLIASSWVQVGISLTRCLSAVMPLACRRRLNYAASKRALAVTLAVPIVLAVAAVTSSVKYYERSEANNGTGGGGGSGGVCAQKWKSPYYFYSTLVLRVFFPAVCLAVSSAGIMYSLHRFK-----------------RTFPTDQARL----SQQQRRISIALIGMNSTFLLFALPYELY-LIYATERRADLQRGGPAHAAAL-KIAERVFAVLMYTNNATNWIFYFVLGHRFRQELQRRLFVCCSTPASSGK 460          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000078225.1 (SMESG000078225.1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 397/397 (100.00%), Postives = 397/397 (100.00%), Query Frame = 3
Query:   48 MFSNETITGFELILFYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFSXXXXXXXXXXXXXXSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLVILFRCKKHNWSRGKWNSKNINNLEFSSTYSAKFNRKILSNPTTLEKFYEYNRRLEQ 1238
            MFSNETITGFELILFYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARIYLILLIGTALILSLLIVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFSLIVRVIIPILLLLLSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLVILFRCKKHNWSRGKWNSKNINNLEFSSTYSAKFNRKILSNPTTLEKFYEYNRRLEQ
Sbjct:    1 MFSNETITGFELILFYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARIYLILLIGTALILSLLIVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFSLIVRVIIPILLLLLSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLVILFRCKKHNWSRGKWNSKNINNLEFSSTYSAKFNRKILSNPTTLEKFYEYNRRLEQ 397          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000061776.1 (SMESG000061776.1)

HSP 1 Score: 160.999 bits (406), Expect = 1.233e-44
Identity = 136/392 (34.69%), Postives = 205/392 (52.30%), Query Frame = 3
Query:   90 FYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLIL-----SKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFSXXXXXXXXXXXXXXSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLVILFRCKKHNWSRGKWNSKNINNLEFSSTY-----SAKFNRKILSNPTTLEKFYEYNRRLE 1235
            FY++FVSWFVP++I FG  GT++ +IVLL RRT   E R WF+ALS  D++ L+ GLS  Y S+++ I            FD++    F CYF +  ++F LL+S+W+Q GIS LR +S            T    I L + + + +I++ +++ + +EY   + +       CRL       FF  SL ++V++P + LL  S +I   L  ++ +RR S    + + +   N  S   KR+       + IS  LL MN  F L  LPFE++KI +  Y   +I TKN      L R  DK  NI++Y N +TNWLFYFMLG+ FR+ +V L  C+K+          +I+   F ST+     S + NR+  S P       + NR L+
Sbjct:   46 FYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGISVLRVLSVKSKSPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEY--TFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHL--KKFKRRFS----SRENNNVNNINSVIRKRV-----KQKYISYTLLGMNFTFFLLTLPFEVYKIHF-FYRTDAINTKNVA----LIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLI-CQKY----------SISCTSFVSTFRRLNTSLRSNRRTKSTPVVCTAGKQTNRLLK 408          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000064805.1 (SMESG000064805.1)

HSP 1 Score: 157.918 bits (398), Expect = 4.936e-44
Identity = 124/337 (36.80%), Postives = 193/337 (57.27%), Query Frame = 3
Query:   90 FYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLIL-----SKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQP-LKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYKEEYLRNRTQGHR-CRLKKKFINTFFVFSXXXXXXXXXXXXXXSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKII--YKNYDVLSIKT--KNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDL 1067
            FYK+FVSW+ P ++ FG SGT++ +IV+   R+ Q E+R WF+ALS  D++ L  GLS LY+S+++ I      S  ++   IK+S ++ C+  +  ++  LLLS W+Q GIS  RAV+   P +     I   ++   LI  I   L ++ +++  ++EY+     +R    + C++K      FF FSL V+VI+PI+LLL SS++I + L +     R++    N+  S        R K++       R+IS  LL MN   LL  LPFE++KII  Y   D+   K   K     ++ +R+FDK  NI++Y N +TNWLFYFMLGK FR+++
Sbjct:   37 FYKFFVSWYTPCLLIFGVSGTVICLIVINKHRSGQHELRAWFIALSVVDIYSLCVGLSILYISRISFIFPFSQNSTNIFQDGIKNSNKYSCFIINYMVYVGLLLSVWVQVGISMSRAVALKWPNIPRNNSIRLRNSYYALIFCIFMCLSIAFVLIFDSLEYRGT---DRCPIFKICKVKSSKFRKFFYFSLTVKVIVPIILLLSSSYVITQKLKQSVDNYRRNFDRYNYYFS--------RLKKMQ-----QRHISLTLLGMNSTLLLFVLPFEVYKIIHFYHYEDIKETKPDLKAGQSPHVTARLFDKLLNIILYTNNATNWLFYFMLGKRFRREV 357          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000075889.1 (SMESG000075889.1)

HSP 1 Score: 118.242 bits (295), Expect = 6.236e-31
Identity = 79/197 (40.10%), Postives = 118/197 (59.90%), Query Frame = 3
Query:   57 NETITGFE--LILFYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSKPM-WNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFS 638
            N T T +E  LI FY Y VSW VPV++ FG SGT + I+VL+  +T +   + W               L++LYL+KL LI ++    + D +SS  FVC+F S  ++F+L LSSW+Q GIS +R +S S PL ++T+ T S AR  L++ I   L+ S+++VN T+ Y E Y  N ++G RC+L  K+ + F+  S
Sbjct:   10 NITTTKYEIRLIYFYHYVVSWLVPVILLFGCSGTSICIVVLV--KTAKRRAKIW--------------SLTSLYLNKLYLITNRASSISEDFRSSNIFVCHFLSTGLYFTLFLSSWMQVGISVIRTISISCPLFIKTRFTASVARKALVIHISITLLFSIILVNSTLIYDEVYSGNFSRGFRCKLSNKYDDLFYFVS 190          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000055874.1 (SMESG000055874.1)

HSP 1 Score: 67.0106 bits (162), Expect = 5.423e-12
Identity = 91/339 (26.84%), Postives = 156/339 (46.02%), Query Frame = 3
Query:   87 LFYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSW----LQAGISALRAVSTSQPLKLRTKITTSSARXXXXXXXXXXXXXXXXXVNITVEYK---EEYLRNRTQGHRCRLKK-KFINTFFVFSXXXXXXXXXXXXXXSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKII------YKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRK 1061
            L   YF SWF+ +V      G  + + V+L  +      R WFLAL+A+D       +ST+ ++  +  L+    NF + S+ +++ +F     F +++  SW    LQ+G S  R++S  +PL+ R  +T   +++ +I+L    LI    +  +++++     E LR    G+   + K  +     VF       IP+L++++ SF+I  S+ + + +R    L  N   SA  N          +       +  +LL MN   LL N  F IF++I       K +  LS           LS I    FN L+Y N  TNW+FY ++G  F++
Sbjct:   17 LIKTYFFSWFLLLVNLVSLFGCCLCLGVILKYKVFTKSTRIWFLALAASD-------ISTILIATSDNYLALTFSNFHL-STMKYLGFFGCQIRFGAIVAISWTCNILQSGFSIERSISIIKPLQARVFLTEMRSKLVIIILTSVTLICGFSVTAVSMKFDTKTSECLRKEYLGNVISITKIVYYTDLIVFR-----TIPLLIMIIGSFIIAISM-KFRTKRSVKYLQINRRTSAESNGKDS------NISGRESQVFVLLLIMNFMALLTNPLFLIFELIDGEGSENKEFGKLSGDK-------CLSNILTTVFNCLMYTNNFTNWIFYIVIGTRFKR 328          
The following BLAST results are available for this feature:
BLAST of GCR103 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A193KUC51.388e-7143.84GCR103 OS=Schmidtea mediterranea OX=79327 GN=gcr10... [more]
A0A1I8HY282.149e-2930.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of GCR103 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078225.10.000e+0100.00SMESG000078225.1[more]
SMESG000061776.11.233e-4434.69SMESG000061776.1[more]
SMESG000064805.14.936e-4436.80SMESG000064805.1[more]
SMESG000075889.16.236e-3140.10SMESG000075889.1[more]
SMESG000055874.15.423e-1226.84SMESG000055874.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027658 ID=SMED30027658|Name=GCR103|organism=Schmidtea mediterranea sexual|type=transcript|length=1257bp
TCCGATCTGTTAAAACAAAAAAAATCGAGTTTTCCCATGTTGTGACTATG
TTTTCAAATGAAACAATAACCGGTTTTGAATTGATTCTTTTCTACAAATA
TTTTGTGTCGTGGTTCGTTCCCGTTGTCATTTGTTTTGGTTCATCTGGCA
CGATCGTTAGTATCATTGTTCTTTTGCTTCGTCGAACTACTCAACCGGAA
ATTCGTTGTTGGTTTCTGGCGTTATCAGCGAATGATTTGTTTGGTTTGAT
ATTCGGCTTGTCGACTTTGTACCTTAGTAAGCTGAATTTGATTTTATCTA
AACCGATGTGGAATTTTGATATTAAGTCATCACAAGAATTCGTTTGTTAT
TTCAATTCAAATTGCATATTTTTTTCTCTTCTTTTGTCAAGTTGGCTGCA
GGCAGGAATCTCTGCGCTGAGAGCTGTCAGCACATCACAGCCGTTAAAAC
TCCGTACAAAAATCACGACTTCATCGGCACGGATCTATCTAATCCTCTTA
ATTGGAACGGCTTTGATTCTGTCGCTATTAATTGTAAACATCACTGTGGA
ATATAAAGAAGAATATTTACGCAATCGAACTCAGGGGCATCGTTGTCGGT
TAAAAAAAAAATTTATCAATACATTTTTCGTTTTCAGTCTAATTGTGAGA
GTTATTATTCCAATTTTACTTTTACTTCTTTCTTCGTTTATGATATGGAA
AAGTCTTAACCGACAGCAACATGAACGGCGGCAATCATGTTTGTTGGGAA
ATCATGATCTCAGCGCGTCTAGAAACAGTCCGAGCCCTAGAGGCAAAAGA
ATTCACAGTCCACATTCAAATCATAGAAACATATCATGCATGCTTTTGTG
GATGAATTTAGCATTTCTCTTGGCAAATTTACCGTTTGAAATTTTTAAAA
TTATTTATAAAAACTATGATGTGCTTTCTATTAAAACCAAAAATGAAATG
TATTTATATATTCTCAGTAGAATTTTCGATAAATTTTTCAACATTCTTGT
TTATCTAAATCAATCGACGAACTGGTTGTTTTATTTCATGCTTGGAAAGA
ACTTTCGAAAAGATTTAGTAATTTTATTTCGCTGCAAAAAGCACAATTGG
TCGCGTGGTAAATGGAATTCAAAAAATATTAACAATTTGGAGTTTTCCTC
AACTTACAGTGCAAAATTTAATCGAAAAATTCTTTCAAATCCAACTACTT
TAGAGAAATTCTATGAATATAACCGACGACTTGAACAATAACAGTTTGGA
GAGATCG
back to top

protein sequence of SMED30027658-orf-1

>SMED30027658-orf-1 ID=SMED30027658-orf-1|Name=SMED30027658-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
RSVKTKKIEFSHVVTMFSNETITGFELILFYKYFVSWFVPVVICFGSSGT
IVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLILSK
PMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKL
RTKITTSSARIYLILLIGTALILSLLIVNITVEYKEEYLRNRTQGHRCRL
KKKFINTFFVFSLIVRVIIPILLLLLSSFMIWKSLNRQQHERRQSCLLGN
HDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKI
IYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKN
FRKDLVILFRCKKHNWSRGKWNSKNINNLEFSSTYSAKFNRKILSNPTTL
EKFYEYNRRLEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 19..366
e-value: 1.4E-34
score: 121.5
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 19..377
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 31..353
e-value: 2.78592E-16
score: 76.9028
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 14..368
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
NoneNo IPR availableTMHMMTMhelixcoord: 159..181
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 49..340
e-value: 1.0E-9
score: 38.1
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 47..342
score: 21.555