Neuroligin 4-like

Overview
NameNeuroligin 4-like
Smed IDSMED30027655
Length (bp)2103
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuroligin 4-like (SMED30027655) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuroligin 4-like (SMED30027655) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027655

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027655SMESG000077711.1 SmedASXL_001739SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027655SMESG000077711.1 SmedASXL_001738SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027655SMESG000077713.1 dd_Smed_v6_100266_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027655SMESG000077711.1 dd_Smed_v6_86353_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027655SMESG000077711.1 dd_Smed_v6_58346_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuroligin 4-like vs. Ensembl Human
Match: NLGN4Y (neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC:15529])

HSP 1 Score: 181.415 bits (459), Expect = 2.282e-47
Identity = 154/594 (25.93%), Postives = 267/594 (44.95%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVP-KKNYHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ   +      ++G R    F  VCPQ+L     F  + +   W    +  +  +++DQNE+CL LNIYVP + + H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  LK+ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIQGLRTPLPSEILGPVEQYLGVPYAS-----PPTG-ERRFQPPESP---SSWTGIRNATQFSAVCPQHLD--ERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLKNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Human
Match: NLGN4Y (neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC:15529])

HSP 1 Score: 181.415 bits (459), Expect = 2.282e-47
Identity = 154/594 (25.93%), Postives = 267/594 (44.95%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVP-KKNYHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ   +      ++G R    F  VCPQ+L     F  + +   W    +  +  +++DQNE+CL LNIYVP + + H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  LK+ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIQGLRTPLPSEILGPVEQYLGVPYAS-----PPTG-ERRFQPPESP---SSWTGIRNATQFSAVCPQHLD--ERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLKNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Human
Match: NLGN4X (neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC:14287])

HSP 1 Score: 179.489 bits (454), Expect = 8.560e-47
Identity = 152/592 (25.68%), Postives = 265/592 (44.76%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ          ++G R    F  VCPQ+L   S         +  ++  +  +++DQNE+CL LNIYVP ++  H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  L++ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYAS-----PPTG-ERRFQPPEPP---SSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLRNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Human
Match: NLGN4X (neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC:14287])

HSP 1 Score: 179.489 bits (454), Expect = 8.560e-47
Identity = 152/592 (25.68%), Postives = 265/592 (44.76%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ          ++G R    F  VCPQ+L   S         +  ++  +  +++DQNE+CL LNIYVP ++  H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  L++ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYAS-----PPTG-ERRFQPPEPP---SSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLRNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Human
Match: NLGN4X (neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC:14287])

HSP 1 Score: 179.489 bits (454), Expect = 8.560e-47
Identity = 152/592 (25.68%), Postives = 265/592 (44.76%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ          ++G R    F  VCPQ+L   S         +  ++  +  +++DQNE+CL LNIYVP ++  H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  L++ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYAS-----PPTG-ERRFQPPEPP---SSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLRNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Celegans
Match: nlg-1 (Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTG1])

HSP 1 Score: 148.288 bits (373), Expect = 7.219e-37
Identity = 157/620 (25.32%), Postives = 267/620 (43.06%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQN----LVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKK-NYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMA-NGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKL----------FNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQ---KMTNDNKLLDIDLWVGVMRNNAGKYFNK--VETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQS------TFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLD----PFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRF---------SWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDI-AQFWNEFIPHTCLSFKSSNITQPVPKD 1755
            +++G  +     +L  +  Y GI Y        G AP  +YRF  ++++  +      +      PVC Q     L     F + +   +  + +++ P LK Q+E+CL +NIYVP++      N   V++ VHGE++  GTGNA++ + L++YG II VT+NYRLG+ GFL    +    GN  + DL +A+  +   +  F GD ++++L G+G GA  +     S L Q    +  R ++L      P+  + +P   F +   +L          FN    +++  ++  +S  I  A  K+     +   AP+   QL     Q        +   +IDL VG+  N +    +   ++     E     FR L++N  +       +IL+ I+   YT+W      + +     +R    N  L+D  + AP I+ +  HS  + R+        F H       +  N  +  +   D +   FG PLA  ++ +     FN  D      IS +MM  +S F+KSG+P+   K     K F         +WP +    +      + R  P+V    N   +    FWN FIP      K+   T+PV ++
Sbjct:   29 MVRGEVVSPEGDDLPPVAQYLGIPY--------GVAPTGQYRFNMAISAAKWTHMP--KDARKVSPVCIQTDMPELSETKAFKHTSAQRFDFNHRLL-PHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLVRNLYD---FHREEILASIINE-YTDWE-----NPRDHPKSIRNGVLNA-LSDVLYTAPLIETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQGDSEERLYSGFNTDDK----GISKVMMHYVSNFVKSGDPS---KPNPMSKNFPMGDVFHSTAWPQFDQPNREAYLEITDR--PRV---KNYYRNAQVGFWNNFIPQL---HKNGKETEPVGEE 612          
BLAST of Neuroligin 4-like vs. Ensembl Celegans
Match: nlg-1 (Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTG1])

HSP 1 Score: 147.902 bits (372), Expect = 9.314e-37
Identity = 157/620 (25.32%), Postives = 267/620 (43.06%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQN----LVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKK-NYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMA-NGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKL----------FNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQ---KMTNDNKLLDIDLWVGVMRNNAGKYFNK--VETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQS------TFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLD----PFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRF---------SWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDI-AQFWNEFIPHTCLSFKSSNITQPVPKD 1755
            +++G  +     +L  +  Y GI Y        G AP  +YRF  ++++  +      +      PVC Q     L     F + +   +  + +++ P LK Q+E+CL +NIYVP++      N   V++ VHGE++  GTGNA++ + L++YG II VT+NYRLG+ GFL    +    GN  + DL +A+  +   +  F GD ++++L G+G GA  +     S L Q    +  R ++L      P+  + +P   F +   +L          FN    +++  ++  +S  I  A  K+     +   AP+   QL     Q        +   +IDL VG+  N +    +   ++     E     FR L++N  +       +IL+ I+   YT+W      + +     +R    N  L+D  + AP I+ +  HS  + R+        F H       +  N  +  +   D +   FG PLA  ++ +     FN  D      IS +MM  +S F+KSG+P+   K     K F         +WP +    +      + R  P+V    N   +    FWN FIP      K+   T+PV ++
Sbjct:   29 MVRGEVVSPEGDDLPPVAQYLGIPY--------GVAPTGQYRFNMAISAAKWTHMP--KDARKVSPVCIQTDMPELSETKAFKHTSAQRFDFNHRLL-PHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLVRNLYD---FHREEILASIINE-YTDWE-----NPRDHPKSIRNGVLNA-LSDVLYTAPLIETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQGDSEERLYSGFNTDDK----GISKVMMHYVSNFVKSGDPS---KPNPMSKNFPMGDVFHSTAWPQFDQPNREAYLEITDR--PRV---KNYYRNAQVGFWNNFIPQL---HKNGKETEPVGEE 612          
BLAST of Neuroligin 4-like vs. Ensembl Celegans
Match: nlg-1 (Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTG1])

HSP 1 Score: 147.902 bits (372), Expect = 1.086e-36
Identity = 157/623 (25.20%), Postives = 268/623 (43.02%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLV-------NFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKK-NYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMA-NGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKL----------FNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQ---KMTNDNKLLDIDLWVGVMRNNAGKYFNK--VETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQS------TFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLD----PFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRF---------SWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDI-AQFWNEFIPHTCLSFKSSNITQPVPKD 1755
            +++G  +     +L  +  Y GI Y        G AP  +YRF  ++++  +      +      PVC Q  +        F  F + +   +  + +++ P LK Q+E+CL +NIYVP++      N   V++ VHGE++  GTGNA++ + L++YG II VT+NYRLG+ GFL    +    GN  + DL +A+  +   +  F GD ++++L G+G GA  +     S L Q    +  R ++L      P+  + +P   F +   +L          FN    +++  ++  +S  I  A  K+     +   AP+   QL     Q        +   +IDL VG+  N +    +   ++     E     FR L++N  +       +IL+ I+   YT+W      + +     +R    N  L+D  + AP I+ +  HS  + R+        F H       +  N  +  +   D +   FG PLA  ++ +     FN  D      IS +MM  +S F+KSG+P+   K     K F         +WP +    +      + R  P+V    N   +    FWN FIP      K+   T+PV ++
Sbjct:   29 MVRGEVVSPEGDDLPPVAQYLGIPY--------GVAPTGQYRFNMAISAAKWTHMP--KDARKVSPVCIQTDMPELSETKRFRAFKHTSAQRFDFNHRLL-PHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLVRNLYD---FHREEILASIINE-YTDWE-----NPRDHPKSIRNGVLNA-LSDVLYTAPLIETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQGDSEERLYSGFNTDDK----GISKVMMHYVSNFVKSGDPS---KPNPMSKNFPMGDVFHSTAWPQFDQPNREAYLEITDR--PRV---KNYYRNAQVGFWNNFIPQL---HKNGKETEPVGEE 615          
BLAST of Neuroligin 4-like vs. Ensembl Celegans
Match: nlg-1 (Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTG1])

HSP 1 Score: 147.517 bits (371), Expect = 1.155e-36
Identity = 157/620 (25.32%), Postives = 267/620 (43.06%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQN----LVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKK-NYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMA-NGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKL----------FNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQ---KMTNDNKLLDIDLWVGVMRNNAGKYFNK--VETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQS------TFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLD----PFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRF---------SWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDI-AQFWNEFIPHTCLSFKSSNITQPVPKD 1755
            +++G  +     +L  +  Y GI Y        G AP  +YRF  ++++  +      +      PVC Q     L     F + +   +  + +++ P LK Q+E+CL +NIYVP++      N   V++ VHGE++  GTGNA++ + L++YG II VT+NYRLG+ GFL    +    GN  + DL +A+  +   +  F GD ++++L G+G GA  +     S L Q    +  R ++L      P+  + +P   F +   +L          FN    +++  ++  +S  I  A  K+     +   AP+   QL     Q        +   +IDL VG+  N +    +   ++     E     FR L++N  +       +IL+ I+   YT+W      + +     +R    N  L+D  + AP I+ +  HS  + R+        F H       +  N  +  +   D +   FG PLA  ++ +     FN  D      IS +MM  +S F+KSG+P+   K     K F         +WP +    +      + R  P+V    N   +    FWN FIP      K+   T+PV ++
Sbjct:   29 MVRGEVVSPEGDDLPPVAQYLGIPY--------GVAPTGQYRFNMAISAAKWTHMP--KDARKVSPVCIQTDMPELSETKAFKHTSAQRFDFNHRLL-PHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLVRNLYD---FHREEILASIINE-YTDWE-----NPRDHPKSIRNGVLNA-LSDVLYTAPLIETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQGDSEERLYSGFNTDDK----GISKVMMHYVSNFVKSGDPS---KPNPMSKNFPMGDVFHSTAWPQFDQPNREAYLEITDR--PRV---KNYYRNAQVGFWNNFIPQL---HKNGKETEPVGEE 612          
BLAST of Neuroligin 4-like vs. Ensembl Celegans
Match: nlg-1 (Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTG1])

HSP 1 Score: 147.517 bits (371), Expect = 1.461e-36
Identity = 157/623 (25.20%), Postives = 268/623 (43.02%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLV-------NFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKK-NYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMA-NGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKL----------FNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQ---KMTNDNKLLDIDLWVGVMRNNAGKYFNK--VETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQS------TFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLD----PFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRF---------SWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDI-AQFWNEFIPHTCLSFKSSNITQPVPKD 1755
            +++G  +     +L  +  Y GI Y        G AP  +YRF  ++++  +      +      PVC Q  +        F  F + +   +  + +++ P LK Q+E+CL +NIYVP++      N   V++ VHGE++  GTGNA++ + L++YG II VT+NYRLG+ GFL    +    GN  + DL +A+  +   +  F GD ++++L G+G GA  +     S L Q    +  R ++L      P+  + +P   F +   +L          FN    +++  ++  +S  I  A  K+     +   AP+   QL     Q        +   +IDL VG+  N +    +   ++     E     FR L++N  +       +IL+ I+   YT+W      + +     +R    N  L+D  + AP I+ +  HS  + R+        F H       +  N  +  +   D +   FG PLA  ++ +     FN  D      IS +MM  +S F+KSG+P+   K     K F         +WP +    +      + R  P+V    N   +    FWN FIP      K+   T+PV ++
Sbjct:   29 MVRGEVVSPEGDDLPPVAQYLGIPY--------GVAPTGQYRFNMAISAAKWTHMP--KDARKVSPVCIQTDMPELSETKRFRAFKHTSAQRFDFNHRLL-PHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLVRNLYD---FHREEILASIINE-YTDWE-----NPRDHPKSIRNGVLNA-LSDVLYTAPLIETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQGDSEERLYSGFNTDDK----GISKVMMHYVSNFVKSGDPS---KPNPMSKNFPMGDVFHSTAWPQFDQPNREAYLEITDR--PRV---KNYYRNAQVGFWNNFIPQL---HKNGKETEPVGEE 615          
BLAST of Neuroligin 4-like vs. Ensembl Fly
Match: Nlg3 (gene:FBgn0083963 transcript:FBtr0333927)

HSP 1 Score: 152.14 bits (383), Expect = 8.519e-38
Identity = 97/276 (35.14%), Postives = 137/276 (49.64%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYAS--VGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLN----SYWMHVKMIQPFLKDQNEECLTLNIYVP---------------------------------------KKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGD----IDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS 687
            II   +  I G+ +     +L  + AY GI YAS  VG L        RF   V++  +   SG ++ + F PVCPQ L +  H +   L         ++K + P+L++Q+E+CL LNIYVP                                            +  ++ VL+FVHGE +   +GN YD SVL+SYG I+ VTINYRLG+LGFLN AN D    +  N+ L D+ AA+ W+K +I  F GDP +I+L G+G GA  +HF   S
Sbjct:  157 IINTRNGAISGVIVQLDGRHLDPVEAYRGIPYASPPVGNL--------RFMPPVSAAMW---SGVKKADRFSPVCPQRLPDI-HNETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSSSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVTINYRLGVLGFLN-ANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHFLISS 419          

HSP 2 Score: 53.5286 bits (127), Expect = 6.508e-7
Identity = 67/275 (24.36%), Postives = 114/275 (41.45%), Query Frame = 1
Query:  931 SQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFN-KLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN-------FVEKAASQLKRFSWPNYSHSTKHFV----------HYHSQRTIPKVSISSNLMPDIAQFWNEFIP 1701
             QL N    + T  NKL   DL  GV R  A   FN  +     E  + + R+L            ++I + IV   YT+W        +  Q  + I +   + L+DA  +APA + V+ HS   + ++++ + FD      +          +DL   FGAPL      + F +    + +++S ++M   S F+++GNPN          +  S+ K   W  Y    K ++          HY + R    +S   NL+PD+ +   + +P
Sbjct:  550 GQLENIVLMRKTAINKLSRYDLMAGVTRAEAFFSFNSGDVQYGIE-ADRRSRILKAYVRNTYTFHLNEIFATIVNE-YTDW-------ERPVQHPINIRDETLEALSDAQVVAPAAQTVDLHS--ADHRNSYLYVFDYQTRFGDYPQRQGCIHGEDLPYIFGAPLV--GGFNHFTRNYTKTEISLSEVVMFYWSNFVRTGNPNEQMETEHGSRQERSRYKTIEWTAYESVHKKYLNFDTKPKLKNHYRAHR----LSFWLNLIPDLHKPGGDNVP 807          
BLAST of Neuroligin 4-like vs. Ensembl Fly
Match: Nlg3 (gene:FBgn0083963 transcript:FBtr0301072)

HSP 1 Score: 152.14 bits (383), Expect = 8.519e-38
Identity = 97/276 (35.14%), Postives = 137/276 (49.64%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYAS--VGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLN----SYWMHVKMIQPFLKDQNEECLTLNIYVP---------------------------------------KKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGD----IDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS 687
            II   +  I G+ +     +L  + AY GI YAS  VG L        RF   V++  +   SG ++ + F PVCPQ L +  H +   L         ++K + P+L++Q+E+CL LNIYVP                                            +  ++ VL+FVHGE +   +GN YD SVL+SYG I+ VTINYRLG+LGFLN AN D    +  N+ L D+ AA+ W+K +I  F GDP +I+L G+G GA  +HF   S
Sbjct:  157 IINTRNGAISGVIVQLDGRHLDPVEAYRGIPYASPPVGNL--------RFMPPVSAAMW---SGVKKADRFSPVCPQRLPDI-HNETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSSSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVTINYRLGVLGFLN-ANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHFLISS 419          

HSP 2 Score: 53.5286 bits (127), Expect = 6.508e-7
Identity = 67/275 (24.36%), Postives = 114/275 (41.45%), Query Frame = 1
Query:  931 SQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFN-KLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN-------FVEKAASQLKRFSWPNYSHSTKHFV----------HYHSQRTIPKVSISSNLMPDIAQFWNEFIP 1701
             QL N    + T  NKL   DL  GV R  A   FN  +     E  + + R+L            ++I + IV   YT+W        +  Q  + I +   + L+DA  +APA + V+ HS   + ++++ + FD      +          +DL   FGAPL      + F +    + +++S ++M   S F+++GNPN          +  S+ K   W  Y    K ++          HY + R    +S   NL+PD+ +   + +P
Sbjct:  550 GQLENIVLMRKTAINKLSRYDLMAGVTRAEAFFSFNSGDVQYGIE-ADRRSRILKAYVRNTYTFHLNEIFATIVNE-YTDW-------ERPVQHPINIRDETLEALSDAQVVAPAAQTVDLHS--ADHRNSYLYVFDYQTRFGDYPQRQGCIHGEDLPYIFGAPLV--GGFNHFTRNYTKTEISLSEVVMFYWSNFVRTGNPNEQMETEHGSRQERSRYKTIEWTAYESVHKKYLNFDTKPKLKNHYRAHR----LSFWLNLIPDLHKPGGDNVP 807          
BLAST of Neuroligin 4-like vs. Ensembl Fly
Match: Nlg2 (gene:FBgn0031866 transcript:FBtr0307033)

HSP 1 Score: 144.821 bits (364), Expect = 2.279e-35
Identity = 84/242 (34.71%), Postives = 127/242 (52.48%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYAS--VGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLV---NFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQ--------------FAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGD-IDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKL 693
            +++GI +  S     ++ A+ GI YAS  VG L        RF   +    ++     R  + F PVCPQN+    N          +    ++ + P LK+Q+E+CL LNIYVP   Y T+ Q               + ++F+HGE +   +GN YD S L+++G++I VTIN+RLGI GFL     +   GNF L DL A + W+K ++  F GDP++I+L+GYG GAV  +    S +
Sbjct:  191 LLRGIVVRSSP----LVEAFLGIPYASPPVGSL--------RFMPPITPSTWKTV---RSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVP---YETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPV 414          
BLAST of Neuroligin 4-like vs. Ensembl Fly
Match: Nlg2 (gene:FBgn0031866 transcript:FBtr0079344)

HSP 1 Score: 144.821 bits (364), Expect = 2.279e-35
Identity = 84/242 (34.71%), Postives = 127/242 (52.48%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYAS--VGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLV---NFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQ--------------FAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGD-IDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKL 693
            +++GI +  S     ++ A+ GI YAS  VG L        RF   +    ++     R  + F PVCPQN+    N          +    ++ + P LK+Q+E+CL LNIYVP   Y T+ Q               + ++F+HGE +   +GN YD S L+++G++I VTIN+RLGI GFL     +   GNF L DL A + W+K ++  F GDP++I+L+GYG GAV  +    S +
Sbjct:  191 LLRGIVVRSSP----LVEAFLGIPYASPPVGSL--------RFMPPITPSTWKTV---RSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVP---YETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPV 414          
BLAST of Neuroligin 4-like vs. Ensembl Fly
Match: Nlg2 (gene:FBgn0031866 transcript:FBtr0343867)

HSP 1 Score: 144.821 bits (364), Expect = 2.279e-35
Identity = 84/242 (34.71%), Postives = 127/242 (52.48%), Query Frame = 1
Query:   28 IIKGIDIHFSKYNLSMIRAYYGIRYAS--VGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLV---NFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQ--------------FAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGD-IDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKL 693
            +++GI +  S     ++ A+ GI YAS  VG L        RF   +    ++     R  + F PVCPQN+    N          +    ++ + P LK+Q+E+CL LNIYVP   Y T+ Q               + ++F+HGE +   +GN YD S L+++G++I VTIN+RLGI GFL     +   GNF L DL A + W+K ++  F GDP++I+L+GYG GAV  +    S +
Sbjct:  191 LLRGIVVRSSP----LVEAFLGIPYASPPVGSL--------RFMPPITPSTWKTV---RSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVP---YETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPV 414          
BLAST of Neuroligin 4-like vs. Ensembl Zebrafish
Match: nlgn2a (neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2])

HSP 1 Score: 190.274 bits (482), Expect = 1.232e-50
Identity = 149/591 (25.21%), Postives = 261/591 (44.16%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL--QLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP +      ++GI    +   L  +  Y G+ YA        TAP  + RFQ   A   +++    R    F PVCPQN+          +   W    + +   ++++Q+E+CL LN+YVP ++    + +  V++F+HG  +  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P      +     ++   + +T   L+  L+  N  E++   Q ++  +      P+    +   + + +    + L+ DL +GV +    K+ +   T ++  ++   F   + N V+ L        IL   ++  YT+W       +     +MR      L  D  ++APAI     H+  Q+     TF+H              ++A   D++   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  I  N   +   FW E +PH
Sbjct:   46 YPTVTTNYGKLRGIKKELNNEILGPVEQYLGVPYA--------TAPIGDRRFQPPEAPGSWQE---VRNATQFAPVCPQNVHGVLP---EIMLPVWFTDSLDVAATYIQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGTGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSAISSWSISYQPLKY---TKILARKVGCTYGET-ADLVDCLRRKNFRELV--DQDIQPARYHIAFGPVMDGDVVPDDPEILMQQGEFLNYDLLIGVNQGEGLKFVDDGGTESEEGISAAAFDYTISNFVDNLYGYPKGKDILRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAIATAKLHADYQSPVYFYTFYHHCQT----ETRPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKND----IMLSAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGL-----KPRIRDNYRANKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Zebrafish
Match: nlgn4xb (neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-100309-1])

HSP 1 Score: 186.422 bits (472), Expect = 2.559e-49
Identity = 156/589 (26.49%), Postives = 261/589 (44.31%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVPKKNYHTQNQFA---VLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPS--SSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G+ +      L  +  + G+ YA         AP  E RFQ          + G R    F PVCPQ L +        +   W    +  +  ++ DQ+E+CL LNIYVP +   TQ+      V++++HG  +  GTGN  D SVL+SYG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ WVK +I+ F+GDPE +++ G G GA  +   T S     LFQ   + S   L           N  P+  +    E +         L+  L+S N  E++  +Q +   K      P+    +   + Q +    + L+ D+ +GV   N G+ +  V+ +  SE  +T   F   +   V+ L    + K  L   ++  YT+W       +     +MR      L  D  ++APA+   + H+  Q    T+F+ F      D+ P  A      ++   D+L   FG P+  P +L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   32 LRGLRVALPSEILGPVEQFLGVPYA--------MAPTGERRFQAPEPPL---SWPGIRNATQFAPVCPQFLED--RLLLTDMLPVWFTANLDTVATYVHDQSEDCLYLNIYVPTEE-ETQDDAGLKPVMVYIHGGSYVEGTGNMIDGSVLASYGNVIVVTVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQSFSGDPERVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWA------VNYQPAKYTRLLAEKVGCNEDDTLELIECLQSKNYKELI--EQNITPAKYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGYKFVDGILDSEDRVTSNDFEFAISEFVDHLYGYPEGKDTLRETIKFMYTDW-------ADRENPEMRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSDMKPAWA------DSSHGDELPYVFGIPMIGPTDL--FNCNFSKNDIMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKIAFWLELVPH 573          
BLAST of Neuroligin 4-like vs. Ensembl Zebrafish
Match: nlgn4xb (neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-100309-1])

HSP 1 Score: 186.422 bits (472), Expect = 2.559e-49
Identity = 156/589 (26.49%), Postives = 261/589 (44.31%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVPKKNYHTQNQFA---VLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPS--SSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G+ +      L  +  + G+ YA         AP  E RFQ          + G R    F PVCPQ L +        +   W    +  +  ++ DQ+E+CL LNIYVP +   TQ+      V++++HG  +  GTGN  D SVL+SYG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ WVK +I+ F+GDPE +++ G G GA  +   T S     LFQ   + S   L           N  P+  +    E +         L+  L+S N  E++  +Q +   K      P+    +   + Q +    + L+ D+ +GV   N G+ +  V+ +  SE  +T   F   +   V+ L    + K  L   ++  YT+W       +     +MR      L  D  ++APA+   + H+  Q    T+F+ F      D+ P  A      ++   D+L   FG P+  P +L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   32 LRGLRVALPSEILGPVEQFLGVPYA--------MAPTGERRFQAPEPPL---SWPGIRNATQFAPVCPQFLED--RLLLTDMLPVWFTANLDTVATYVHDQSEDCLYLNIYVPTEE-ETQDDAGLKPVMVYIHGGSYVEGTGNMIDGSVLASYGNVIVVTVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQSFSGDPERVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWA------VNYQPAKYTRLLAEKVGCNEDDTLELIECLQSKNYKELI--EQNITPAKYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGYKFVDGILDSEDRVTSNDFEFAISEFVDHLYGYPEGKDTLRETIKFMYTDW-------ADRENPEMRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSDMKPAWA------DSSHGDELPYVFGIPMIGPTDL--FNCNFSKNDIMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKIAFWLELVPH 573          
BLAST of Neuroligin 4-like vs. Ensembl Zebrafish
Match: nlgn4xb (neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-100309-1])

HSP 1 Score: 186.422 bits (472), Expect = 2.559e-49
Identity = 156/589 (26.49%), Postives = 261/589 (44.31%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVPKKNYHTQNQFA---VLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPS--SSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G+ +      L  +  + G+ YA         AP  E RFQ          + G R    F PVCPQ L +        +   W    +  +  ++ DQ+E+CL LNIYVP +   TQ+      V++++HG  +  GTGN  D SVL+SYG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ WVK +I+ F+GDPE +++ G G GA  +   T S     LFQ   + S   L           N  P+  +    E +         L+  L+S N  E++  +Q +   K      P+    +   + Q +    + L+ D+ +GV   N G+ +  V+ +  SE  +T   F   +   V+ L    + K  L   ++  YT+W       +     +MR      L  D  ++APA+   + H+  Q    T+F+ F      D+ P  A      ++   D+L   FG P+  P +L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   32 LRGLRVALPSEILGPVEQFLGVPYA--------MAPTGERRFQAPEPPL---SWPGIRNATQFAPVCPQFLED--RLLLTDMLPVWFTANLDTVATYVHDQSEDCLYLNIYVPTEE-ETQDDAGLKPVMVYIHGGSYVEGTGNMIDGSVLASYGNVIVVTVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQSFSGDPERVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWA------VNYQPAKYTRLLAEKVGCNEDDTLELIECLQSKNYKELI--EQNITPAKYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGYKFVDGILDSEDRVTSNDFEFAISEFVDHLYGYPEGKDTLRETIKFMYTDW-------ADRENPEMRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSDMKPAWA------DSSHGDELPYVFGIPMIGPTDL--FNCNFSKNDIMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKIAFWLELVPH 573          
BLAST of Neuroligin 4-like vs. Ensembl Zebrafish
Match: nlgn2a (neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2])

HSP 1 Score: 183.726 bits (465), Expect = 2.353e-48
Identity = 149/609 (24.47%), Postives = 261/609 (42.86%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-------------------YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL--QLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP +      ++GI    +   L  +  Y G+ YA        TAP  + RFQ   A   +++    R    F PVCPQN+          +   W    + +   ++++Q+E+CL LN+YVP ++                      + +  V++F+HG  +  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P      +     ++   + +T   L+  L+  N  E++   Q ++  +      P+    +   + + +    + L+ DL +GV +    K+ +   T ++  ++   F   + N V+ L        IL   ++  YT+W       +     +MR      L  D  ++APAI     H+  Q+     TF+H              ++A   D++   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  I  N   +   FW E +PH
Sbjct:   46 YPTVTTNYGKLRGIKKELNNEILGPVEQYLGVPYA--------TAPIGDRRFQPPEAPGSWQE---VRNATQFAPVCPQNVHGVLP---EIMLPVWFTDSLDVAATYIQNQSEDCLYLNVYVPTEDGPLTKKHDESTLNRPRDEDIRDRRKKPVMLFIHGGSYMEGTGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSAISSWSISYQPLKY---TKILARKVGCTYGET-ADLVDCLRRKNFRELV--DQDIQPARYHIAFGPVMDGDVVPDDPEILMQQGEFLNYDLLIGVNQGEGLKFVDDGGTESEEGISAAAFDYTISNFVDNLYGYPKGKDILRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAIATAKLHADYQSPVYFYTFYHHCQT----ETRPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKND----IMLSAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGL-----KPRIRDNYRANKVAFWLELVPH 614          
BLAST of Neuroligin 4-like vs. Ensembl Xenopus
Match: nlgn4x (neuroligin 4 X-linked [Source:NCBI gene;Acc:100329189])

HSP 1 Score: 179.874 bits (455), Expect = 6.253e-47
Identity = 151/595 (25.38%), Postives = 263/595 (44.20%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVPKKN--YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +PI+      I+G         L  +  Y G+ YAS     P T  E RFQ          ++G +    F PVCPQ L   S    N +   W    +  +  +++DQNE+CL LNIYVP ++  +   N+  V++++HG  +  GTGN  D S+L+S+G++I +T+NYRLG+LGFL+  +    GN+ L D   A+ W++ +I  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P  +    +     ++L   +     L+  L+  N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ M  +E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+R  +   T+F+ F      ++ P  A      ++   D++   FG P+  P  L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y    + ++H        K  +  +       FW E +PH
Sbjct:   45 HPIVPTNYGKIRGTRTPLPIEILGPVEQYLGVPYAS-----PPTG-ERRFQPPEPP---SSWTGIKNATQFAPVCPQFLDERSLL--NDMLPIWFTANLDTVVSYVQDQNEDCLYLNIYVPTEDDIHDPNNKKPVMVYIHGGSYMEGTGNMIDGSILASHGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCDMLDTID-----LVECLRDKNYKELI--QQSITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGMVDNEDGVSLSDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHARYGS--PTYFYAFYHHCQSEMKPTWA------DSAHGDEVPYVFGIPMIGPTEL--FNCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKPNRFEEVAWSKYDPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1000758])

HSP 1 Score: 170.244 bits (430), Expect = 1.109e-43
Identity = 139/586 (23.72%), Postives = 258/586 (44.03%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYAS--VGK---LKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLL---VSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G  +      L  +  Y G+ YA+  VG+   L P   P +              SG R    F PVCPQN+ N      + +   W   ++  +  +L++Q+E+CL LNIYVP ++         V++++HG  +  G+GN  D SVL+SYG+++ +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  ++  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P  +    +      +L   +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +  +E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R     + F+ F+        +L+    ++A   D++   FG P+  P +L P N    + +L  S ++M+  + F K+G+PN        F+   A++ +  +W  Y+   + ++H        K  +  +       FW   +PH
Sbjct:   45 LRGTRVPLPSEILGPVDQYLGVPYAAPPVGEKRFLPPEPPPSW--------------SGIRNATHFSPVCPQNIQNAVP---DIMMPVWFTSNLDTVTGYLQEQSEDCLYLNIYVPTEDDIRDTGAKPVMVYIHGGSYMEGSGNMIDGSVLASYGNVVVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENVAFFGGDPHRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTRLLAEKVGCNVLDTVD-----MVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVENVVDAEDGVSGSDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARY-GSPTYFYAFYH----HCQSLMKPAWADAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGL-----KPRVRDHYRATKVAFWKHLVPH 584          
BLAST of Neuroligin 4-like vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1000758])

HSP 1 Score: 162.925 bits (411), Expect = 2.829e-41
Identity = 139/606 (22.94%), Postives = 260/606 (42.90%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYAS--VGK---LKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFA---------------------VLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLL---VSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G  +      L  +  Y G+ YA+  VG+   L P   P +              SG R    F PVCPQN+ N      + +   W   ++  +  +L++Q+E+CL LNIYVP ++  +  +                       V++++HG  +  G+GN  D SVL+SYG+++ +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  ++  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P  +    +      +L   +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +  +E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R     + F+ F+        +L+    ++A   D++   FG P+  P +L P N    + +L  S ++M+  + F K+G+PN        F+   A++ +  +W  Y+   + ++H        K  +  +       FW   +PH
Sbjct:   44 LRGTRVPLPSEILGPVDQYLGVPYAAPPVGEKRFLPPEPPPSW--------------SGIRNATHFSPVCPQNIQNAVP---DIMMPVWFTSNLDTVTGYLQEQSEDCLYLNIYVPTEDGPSAKKQGEELSDNDEDEEGDIRDTGAKPVMVYIHGGSYMEGSGNMIDGSVLASYGNVVVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENVAFFGGDPHRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTRLLAEKVGCNVLDTVD-----MVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVENVVDAEDGVSGSDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARY-GSPTYFYAFYH----HCQSLMKPAWADAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGL-----KPRVRDHYRATKVAFWKHLVPH 603          
BLAST of Neuroligin 4-like vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1000758])

HSP 1 Score: 162.925 bits (411), Expect = 3.029e-41
Identity = 139/603 (23.05%), Postives = 258/603 (42.79%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYAS--VGK---LKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFA---------------------VLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G  +      L  +  Y G+ YA+  VG+   L P   P +              SG R    F PVCPQN+ N      + +   W   ++  +  +L++Q+E+CL LNIYVP ++  +  +                       V++++HG  +  G+GN  D SVL+SYG+++ +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  ++  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P  +    +      +L   +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +  +E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R  +   T+F+ F            ++A   D++   FG P+  P +L P N    + +L  S ++M+  + F K+G+PN        F+   A++ +  +W  Y+   + ++H        K  +  +       FW   +PH
Sbjct:   45 LRGTRVPLPSEILGPVDQYLGVPYAAPPVGEKRFLPPEPPPSW--------------SGIRNATHFSPVCPQNIQNAVP---DIMMPVWFTSNLDTVTGYLQEQSEDCLYLNIYVPTEDGPSAKKQGEELSDNDEDEEGDIRDTGAKPVMVYIHGGSYMEGSGNMIDGSVLASYGNVVVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENVAFFGGDPHRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTRLLAEKVGCNVLDTVD-----MVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVENVVDAEDGVSGSDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGS--PTYFYAFYHHCQSLMKPAWADAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGL-----KPRVRDHYRATKVAFWKHLVPH 604          
BLAST of Neuroligin 4-like vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1000758])

HSP 1 Score: 154.836 bits (390), Expect = 1.516e-38
Identity = 139/623 (22.31%), Postives = 256/623 (41.09%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYAS--VGK---LKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKNY-----------------------------------------HTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G  +      L  +  Y G+ YA+  VG+   L P   P +              SG R    F PVCPQN+ N      + +   W   ++  +  +L++Q+E+CL LNIYVP ++                                                 V++++HG  +  G+GN  D SVL+SYG+++ +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  ++  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P  +    +      +L   +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +  +E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R  +   T+F+ F            ++A   D++   FG P+  P +L P N    + +L  S ++M+  + F K+G+PN        F+   A++ +  +W  Y+   + ++H        K  +  +       FW   +PH
Sbjct:   45 LRGTRVPLPSEILGPVDQYLGVPYAAPPVGEKRFLPPEPPPSW--------------SGIRNATHFSPVCPQNIQNAVP---DIMMPVWFTSNLDTVTGYLQEQSEDCLYLNIYVPTEDVKRISKECVRKPNKKICRKGGPSAKKQGEELSDNDEDEEGDIRDTGAKPVMVYIHGGSYMEGSGNMIDGSVLASYGNVVVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENVAFFGGDPHRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTRLLAEKVGCNVLDTVD-----MVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVENVVDAEDGVSGSDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGS--PTYFYAFYHHCQSLMKPAWADAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGL-----KPRVRDHYRATKVAFWKHLVPH 624          
BLAST of Neuroligin 4-like vs. Ensembl Mouse
Match: Nlgn2 (neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835])

HSP 1 Score: 164.851 bits (416), Expect = 5.693e-42
Identity = 152/623 (24.40%), Postives = 268/623 (43.02%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHV------KMIQPFLKDQNEECLTLNIYVP--------KKNYHTQN----------QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDK-LAPMFSSQLF---------NFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLL-VSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +P++      ++G+    +   L  +  + G+ YA+     P  A  ++  ++ AS+      G R      P CPQNL       +  L +  + V      +    ++++Q+E+CL LN+YVP        K++  T N          +  V++F+HG  +  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P         +   +       R+         +S+E +   ++  S +L+D+ + P      F           + + +    + L+ D+ +GV   N G+    VE   +SE  ++   F   + N V+ L    + K +L   ++  YT+W       +     +MR      L  D  ++APA+     H+  Q+     TF+H       QA      ++A   D+L   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   41 FPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYAT----PPLGARRFQPPEAPASW-----PGVRNATTLPPACPQNL-------HGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPL-------KYTRLLAAKVGCDRE---------DSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGV---NQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHH-----CQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKND----VMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 607          
BLAST of Neuroligin 4-like vs. Ensembl Mouse
Match: Nlgn2 (neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835])

HSP 1 Score: 164.851 bits (416), Expect = 5.693e-42
Identity = 152/623 (24.40%), Postives = 268/623 (43.02%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHV------KMIQPFLKDQNEECLTLNIYVP--------KKNYHTQN----------QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDK-LAPMFSSQLF---------NFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLL-VSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +P++      ++G+    +   L  +  + G+ YA+     P  A  ++  ++ AS+      G R      P CPQNL       +  L +  + V      +    ++++Q+E+CL LN+YVP        K++  T N          +  V++F+HG  +  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P         +   +       R+         +S+E +   ++  S +L+D+ + P      F           + + +    + L+ D+ +GV   N G+    VE   +SE  ++   F   + N V+ L    + K +L   ++  YT+W       +     +MR      L  D  ++APA+     H+  Q+     TF+H       QA      ++A   D+L   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   41 FPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYAT----PPLGARRFQPPEAPASW-----PGVRNATTLPPACPQNL-------HGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPL-------KYTRLLAAKVGCDRE---------DSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGV---NQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHH-----CQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKND----VMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 607          
BLAST of Neuroligin 4-like vs. Ensembl Mouse
Match: Nlgn3 (neuroligin 3 [Source:MGI Symbol;Acc:MGI:2444609])

HSP 1 Score: 160.614 bits (405), Expect = 1.299e-40
Identity = 138/600 (23.00%), Postives = 255/600 (42.50%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYW--MHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFA---------------------VLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLL---VSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G  +      L  +  Y G+ YA         AP    ++ +       +SG R    F PVCPQN+          +   W   ++ ++  ++++ NE+CL LN+YVP ++     +                       V++++HG  +  GTGN  D SVL+SYG++I +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  +I  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P    + S   D+    + +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +   E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R     + F+ F+        +L+    S+A   D++   FG P+  P +L P N    + +L  S ++M+  + F K+G+PN        F+   A++ +  +W  Y+   + ++H        K  +  +       FW   +PH
Sbjct:   48 LRGARVPLPSEILGPVDQYLGVPYA---------APPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVP---EVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPV--KYTSLLADKVGCNVLDTV--DMVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARY-GSPTYFYAFYH----HCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGL-----KPRVRDHYRATKVAFWKHLVPH 607          
BLAST of Neuroligin 4-like vs. Ensembl Mouse
Match: Nlgn3 (neuroligin 3 [Source:MGI Symbol;Acc:MGI:2444609])

HSP 1 Score: 153.295 bits (386), Expect = 4.125e-38
Identity = 138/620 (22.26%), Postives = 255/620 (41.13%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYW--MHVKMIQPFLKDQNEECLTLNIYVPKKNY-----------------------------------------HTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLV---SEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            ++G  +      L  +  Y G+ YA         AP    ++ +       +SG R    F PVCPQN+          +   W   ++ ++  ++++ NE+CL LN+YVP ++                                                 V++++HG  +  GTGN  D SVL+SYG++I +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  +I  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P    + S   D+    + +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +   E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R  +  + F+ F+        +L+    S+A   D++   FG P+  P +L P N    + +L  S ++M+  + F K+G+PN        F+   A++ +  +W  Y+   + ++H        K  +  +       FW   +PH
Sbjct:   48 LRGARVPLPSEILGPVDQYLGVPYA---------APPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVP---EVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPV--KYTSLLADKVGCNVLDTV--DMVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGS-PTYFYAFYH----HCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGL-----KPRVRDHYRATKVAFWKHLVPH 627          
BLAST of Neuroligin 4-like vs. Ensembl Mouse
Match: Nlgn3 (neuroligin 3 [Source:MGI Symbol;Acc:MGI:2444609])

HSP 1 Score: 148.288 bits (373), Expect = 1.440e-37
Identity = 120/488 (24.59%), Postives = 216/488 (44.26%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYW--MHVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLL---VSEADFLDDLALFFGAPLAYPENLDPFN 1452
            ++G  +      L  +  Y G+ YA         AP    ++ +       +SG R    F PVCPQN+          +   W   ++ ++  ++++ NE+CL LN+YVP ++         V++++HG  +  GTGN  D SVL+SYG++I +T+NYR+G+LGFL+  +    GN+ L D   A+ WV  +I  F GDP  I++ G G GA  +   T S     LFQ   + S   L        P    + S   D+    + +     ++  L+  ++ E++  +Q ++  +      P+    +   + + +    + L+ D+ +GV   N G+    VE +   E  ++   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++ P++   + H+R     + F+ F+        +L+    S+A   D++   FG P+  P +L P N
Sbjct:   48 LRGARVPLPSEILGPVDQYLGVPYA---------APPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVP---EVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPV--KYTSLLADKVGCNVLDTV--DMVDCLRQKSAKELV--EQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGV---NQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARY-GSPTYFYAFYH----HCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCN 502          
BLAST of Neuroligin 4-like vs. UniProt/SwissProt
Match: sp|Q8NFZ3|NLGNY_HUMAN (Neuroligin-4, Y-linked OS=Homo sapiens OX=9606 GN=NLGN4Y PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.096e-46
Identity = 154/594 (25.93%), Postives = 267/594 (44.95%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVP-KKNYHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ   +      ++G R    F  VCPQ+L     F  + +   W    +  +  +++DQNE+CL LNIYVP + + H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  LK+ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIQGLRTPLPSEILGPVEQYLGVPYAS-----PPTG-ERRFQPPESP---SSWTGIRNATQFSAVCPQHLD--ERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLKNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. UniProt/SwissProt
Match: sp|Q8N0W4|NLGNX_HUMAN (Neuroligin-4, X-linked OS=Homo sapiens OX=9606 GN=NLGN4X PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.111e-46
Identity = 152/592 (25.68%), Postives = 265/592 (44.76%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP++      I+G+        L  +  Y G+ YAS     P T  E RFQ          ++G R    F  VCPQ+L   S         +  ++  +  +++DQNE+CL LNIYVP ++  H QN +  V++++HG  +  GTGN  D S+L+SYG++I +TINYRLGILGFL+  +    GN+ L D   A+ W++ ++  F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P    +     D+    + + T   ++  L++ N  E++  QQ +          P+    +   + Q +    + L+ D+ +GV   N G+    V+ +  +E  +T   F   + N V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P  L  F+   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   45 YPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYAS-----PPTG-ERRFQPPEPP---SSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP--AKYTRILADKVGCNMLDTT--DMVECLRNKNYKELI--QQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTEL--FSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. UniProt/SwissProt
Match: sp|Q69ZK9|NLGN2_MOUSE (Neuroligin-2 OS=Mus musculus OX=10090 GN=Nlgn2 PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 3.982e-41
Identity = 152/623 (24.40%), Postives = 268/623 (43.02%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHV------KMIQPFLKDQNEECLTLNIYVP--------KKNYHTQN----------QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDK-LAPMFSSQLF---------NFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLL-VSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +P++      ++G+    +   L  +  + G+ YA+     P  A  ++  ++ AS+      G R      P CPQNL       +  L +  + V      +    ++++Q+E+CL LN+YVP        K++  T N          +  V++F+HG  +  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P         +   +       R+         +S+E +   ++  S +L+D+ + P      F           + + +    + L+ D+ +GV   N G+    VE   +SE  ++   F   + N V+ L    + K +L   ++  YT+W       +     +MR      L  D  ++APA+     H+  Q+     TF+H       QA      ++A   D+L   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   41 FPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYAT----PPLGARRFQPPEAPASW-----PGVRNATTLPPACPQNL-------HGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPL-------KYTRLLAAKVGCDRE---------DSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGV---NQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHH-----CQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKND----VMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 607          
BLAST of Neuroligin 4-like vs. UniProt/SwissProt
Match: sp|Q62888|NLGN2_RAT (Neuroligin-2 OS=Rattus norvegicus OX=10116 GN=Nlgn2 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.433e-40
Identity = 151/623 (24.24%), Postives = 267/623 (42.86%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHV------KMIQPFLKDQNEECLTLNIYVP--------KKNYHTQN----------QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDK-LAPMFSSQLF---------NFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLL-VSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +P++      ++G+    +   L  +  + G+ YA+     P  A  ++  ++ AS+      G R      P CPQNL       +  L +  + V      +    ++++Q+E+CL LN+YVP        K++  T N          +  V++F+HG  +  GTGN +D SVL++YG++I  T+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P         +   +       R+         +S+E +   ++  S +L+D+ + P      F           + + +    + L+ D+ +GV   N G+    VE   +SE  ++   F   + N V+ L    + K +L   ++  YT+W       +     +MR      L  D  ++APA+     H+  Q+     TF+H       QA      ++A   D+L   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   41 FPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYAT----PPLGARRFQPPEAPASW-----PGVRNATTLPPACPQNL-------HGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPL-------KYTRLLAAKVGCDRE---------DSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGV---NQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHH-----CQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKND----VMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 607          
BLAST of Neuroligin 4-like vs. UniProt/SwissProt
Match: sp|Q8NFZ4|NLGN2_HUMAN (Neuroligin-2 OS=Homo sapiens OX=9606 GN=NLGN2 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.622e-40
Identity = 151/623 (24.24%), Postives = 267/623 (42.86%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHV------KMIQPFLKDQNEECLTLNIYVP--------KKNYHTQN----------QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDK-LAPMFSSQLF---------NFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLL-VSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +P++      ++G+    +   L  +  + G+ YA+     P  A  ++  ++ AS+      G R      P CPQNL       +  L +  + V      +    ++++Q+E+CL LN+YVP        K++  T N          +  V++F+HG  +  GTGN +D SVL++YG++I  T+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P         +   +       R+         +S+E +   ++  S +L+D+ + P      F           + + +    + L+ D+ +GV   N G+    VE   +SE  ++   F   + N V+ L    + K +L   ++  YT+W       +     +MR      L  D  ++APA+     H+  Q+     TF+H       QA      ++A   D+L   FG P+    +L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   41 FPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYAT----PPLGARRFQPPEAPASW-----PGVRNATTLPPACPQNL-------HGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPL-------KYTRLLAAKVGCDRE---------DSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDMLIGV---NQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHH-----CQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKND----VMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 607          
BLAST of Neuroligin 4-like vs. TrEMBL
Match: A0A2C9KC18 (COesterase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106056486 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.881e-60
Identity = 155/551 (28.13%), Postives = 264/551 (47.91%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFF--------TKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTR-----KSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSS-QLFNFNEQKMTND--NKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFV 1611
            ++G+++ F    L  + AY+G+RY   G L  G     RF         E ++G R     +PVCPQ + +   +      +   H++ I P+L DQ E+CLTLN++VPK+ ++     AV++FVHGE ++TGTGNAY+ SVL+S+GD+I VT+NYRLG+LGFL+  +    GN+AL D+  A+LW+K +I  FNGDP+ ++L G+G GA  ++           +  +FQ   + S            P +         E++    N +R     K L+  L+    S++        + K     AP   S  +      K+  +  +K   + +  GV +N A  Y N+ +   +  ++E +   +++  V+ +     + +  I++H YT+W+      S          +  +LL+D  F+AP ++M N HS   +     F +      Q  N    +    D+L   FG+PL   + + PF     N+   +S  +M+  + F K+GNPN        F EK +++     WP Y+   + ++
Sbjct:   50 VRGLEVTFPGNKLRPVEAYFGLRY---GDLDGGG---MRFMPPKNP--KEQWNGIRVAMKHQPVCPQPVKHEQEYSKQLPEARVAHLRNITPYLTDQKEDCLTLNLFVPKQEWNDTAPMAVMVFVHGESYQTGTGNAYEGSVLASFGDVIVVTLNYRLGVLGFLSTGDQSAMGNYALLDVIQALLWLKENIPSFNGDPQRVTLFGHGTGAAIVNLLLLSPFVYDLRGNIFQRAIIQSGSASSTWAMSYDPKW-------CTEKLAIKVNCSRHIANTKDLVHCLR--ERSDVTLVNSTPNAPKYYSCFAPSIDSWTVLTHEVDKLLREPNSKFSTVPVMFGVTKNEAYAYLNQDD--IRKGISEFRKAQIIRTYVQNVFRYHRQKIYAILDHLYTDWTRPPDPKSNR-------DSILELLSDGQFVAPLVQMANIHSETADTYLYSFAYSTQSETQNENEEDVQGIHGDELPYVFGSPLV--DGVSPFPTSYTNAERMLSEAVMTYWTNFAKTGNPNDPRNQTSVFGEKVSNRFVDLKWPKYTKDKQEYL 572          
BLAST of Neuroligin 4-like vs. TrEMBL
Match: A0A1S3KB75 (neuroligin-4, X-linked isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180277 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.104e-60
Identity = 158/523 (30.21%), Postives = 262/523 (50.10%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS--------KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEI-LKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQ--LFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFL--DDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN 1536
            I+  +   ++G+ +     +L  + AY+G++YAS+         ++RF   V S   E + GTR +   + VCPQ  ++ +        +   H   + PFL+DQ EECL LNIYVP++  +      V++++HG+ +  G+GNAYD SVL+SYG +I +T+N+RLGILGFL+  + +  GN+A++D+ AA++W+K +I+ F GD + ++L G+G GA  ++    S         LFQ    +S   L        PF   H +    E +      Q    L++ LK+T   E+L A+  + ++K      P+      L +  E  MTN+  L  IDL  GV++N  G  F       K  +TE     +++  V  +     + +  I+ H Y++W        +   +++R  N  +LL D  F+AP I     H+ L NR ST+F+ F+ P ++        A+ +  D+L   FGAP+A    ++PF          +S  +M   + F K+GNPN
Sbjct:   57 IVTTQYGKLRGLLLEIPNPHLVPVEAYFGLQYASL------QGGDHRFM--VCSSPTEKWDGTRIVYGKRAVCPQRAIDEAELRKTMPYARVQHFLRLMPFLEDQTEECLNLNIYVPQRVKNDTTPLPVMVYIHGDSYSVGSGNAYDGSVLASYGGVIVITLNFRLGILGFLSSGDAEAPGNYAIWDIQAALVWIKNNIEPFGGDAQRVTLFGHGYGAALLNILMVSPVSRLQGKPLFQRAITLSGSALSTWGLSRHPF---HYTLKLAERVNCSHAVQNSAELVACLKNTPVEELLEAE--MPAHKYFTSFGPVVDGMAILPSSVEDLMTNNRGLSQIDLLTGVVKNE-GLVFCDQNQFEKG-ITELTQMKIVRTYVRNVYDYHKQKIYDILLHQYSDW-------DRPEDNEIRRDNTMELLGDGQFVAPTIDFAKRHAGL-NR-STYFYTFNYPTVRLEGSTRRWANSVHGDELLYIFGAPVA--NGVEPFADSYGRQDRMLSEAVMRYWTNFAKTGNPN 553          
BLAST of Neuroligin 4-like vs. TrEMBL
Match: A0A504YR79 (Neuroligin-4 X-linked protein OS=Fasciola gigantica OX=46835 GN=FGIG_05066 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 9.523e-60
Identity = 113/253 (44.66%), Postives = 157/253 (62.06%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVG--KLKPGTAPE------------------YRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVP--KKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQ 699
            I L + + + G++IH S  +L+ I+AY+GIRYAS+G   L PGT P                   +RF QSVASF+YE  SGT+      PVCPQ   N S         ++  +  ++ F+++Q+E+CLTLNIY P  K N        VL+FVHGE +  G+GNAYD+SVL+ +   I VT+NYRLGILGFL++ +G  +GNFAL+DL AAI+W++ ++  F GDPE I+LMGY  GA  +H F+ SK+ Q
Sbjct:   35 ITLADGQKLTGLNIHLSISDLNQIKAYFGIRYASLGIAHLSPGTRPAETSTTIQSKPEVTVPASPHRFSQSVASFFYEAPSGTQAKTVLPPVCPQPQWNLSQIKSKIPKPFYDRLVRLKAFMREQSEDCLTLNIYAPQIKHNLIPSKPLPVLLFVHGESYEHGSGNAYDLSVLAGFTKCIAVTMNYRLGILGFLSLRDGQSNGNFALFDLHAAIMWLRNNVASFGGDPEQITLMGYRHGAALVHLFSLSKMAQ 287          

HSP 2 Score: 66.6254 bits (161), Expect = 1.934e-7
Identity = 47/150 (31.33%), Postives = 70/150 (46.67%), Query Frame = 1
Query: 1219 RITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQS---------------TFFHFFDIPPIQANNL---LVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLK-RFSWPNYSHSTKHFV 1611
            R+    +LL+D  F+APAI+ V  H  L+  +S               T+F  F   P+ + +L   L       +DLA +FGAPL  P  L+PF +  + S   IS  ++   S FI SGNPN      +  K    WP Y + T+ ++
Sbjct:  538 RLKEIIELLSDGLFLAPAIQTVQLHHTLKTMESRGRKPNTGASDREPRTYFTVFRHFPVASTDLSPGLKRNLQTDEDLACYFGAPLVSPSRLEPFAETYSKSYKRISFKILQLFSNFIHSGNPNRHNLWPTMSKPSVYWPEYDNKTESYL 687          
BLAST of Neuroligin 4-like vs. TrEMBL
Match: A0A1S3KAM1 (neuroligin-4, X-linked isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180277 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.002e-59
Identity = 158/523 (30.21%), Postives = 263/523 (50.29%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS--------KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEI-LKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQ--LFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFL--DDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN 1536
            I+  +   ++G+ +     +L  + AY+G++YAS   L+ G   ++RF   V S   E + GTR +   + VCPQ  ++ +        +   H   + PFL+DQ EECL LNIYVP++  +      V++++HG+ +  G+GNAYD SVL+SYG +I +T+N+RLGILGFL+  + +  GN+A++D+ AA++W+K +I+ F GD + ++L G+G GA  ++    S         LFQ    +S   L        PF   H +    E +      Q    L++ LK+T   E+L A+  + ++K      P+      L +  E  MTN+  L  IDL  GV++N  G  F       K  +TE     +++  V  +     + +  I+ H Y++W        +   +++R  N  +LL D  F+AP I     H+ L   +ST+F+ F+ P ++        A+ +  D+L   FGAP+A    ++PF          +S  +M   + F K+GNPN
Sbjct:   57 IVTTQYGKLRGLLLEIPNPHLVPVEAYFGLQYAS---LQGG---DHRFM--VCSSPTEKWDGTRIVYGKRAVCPQRAIDEAELRKTMPYARVQHFLRLMPFLEDQTEECLNLNIYVPQRVKNDTTPLPVMVYIHGDSYSVGSGNAYDGSVLASYGGVIVITLNFRLGILGFLSSGDAEAPGNYAIWDIQAALVWIKNNIEPFGGDAQRVTLFGHGYGAALLNILMVSPVSRLQGKPLFQRAITLSGSALSTWGLSRHPF---HYTLKLAERVNCSHAVQNSAELVACLKNTPVEELLEAE--MPAHKYFTSFGPVVDGMAILPSSVEDLMTNNRGLSQIDLLTGVVKNE-GLVFCDQNQFEKG-ITELTQMKIVRTYVRNVYDYHKQKIYDILLHQYSDW-------DRPEDNEIRRDNTMELLGDGQFVAPTIDFAKRHAGLN--RSTYFYTFNYPTVRLEGSTRRWANSVHGDELLYIFGAPVA--NGVEPFADSYGRQDRMLSEAVMRYWTNFAKTGNPN 553          
BLAST of Neuroligin 4-like vs. TrEMBL
Match: E2I9N2 (Neuroligin OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 4.112e-58
Identity = 159/586 (27.13%), Postives = 280/586 (47.78%), Query Frame = 1
Query:   31 IKGIDIHFSKYNLSMIRAYYGIRYASV--GKLK--PGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFF--------TKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTR-----KSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPM---FSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFV----------HYHSQRTIPKVSISSNLMPDI 1674
            ++GI + F   NL  + AY G+RYA +  G ++  P   P+            + ++G R     +PVCPQ   +    +          ++ I PF+ +Q E+CLTLN+YVPK+ ++     AV++FVHGE ++TGTGNAYD SVLSS+GD+I VT+NYRLG+LGFL   +    GN+A+ D+  A+LW++ +I  FNGDP+ ++L G+G GA  ++           + K FQ   L S            P +         E++    N +R     K+L+  L+  + +E+++      + K     AP    ++      ++     ++K   + +  G+ +N A  Y  + E   +  +++ +   +++  V+ +     + +  I++H YT+W   + +S Q +  D    N  +LL+D  ++AP +K+   H+   +   T+ + F     Q       +    D+L   FG+PL   +   PF     N+   +S  +M+  + F KSGNPN          +K  ++     WP Y+  T+ ++          HY +Q    K+++  +L+P I
Sbjct:   66 VRGILVQFENKNLKSVEAYLGLRYADLDGGGMRFMPPKNPK------------DQWNGIRVAISHQPVCPQPTTHERELNQQLPKGRVDQLRNITPFITEQKEDCLTLNLYVPKQEWNETKPMAVMVFVHGESYQTGTGNAYDGSVLSSFGDVIVVTLNYRLGVLGFLTTEDHAAMGNYAMLDITQALLWLRENIASFNGDPQRVTLFGHGTGAAIVNLLLLSPFISEDRGKYFQRAILQSGSASSSWAVSYDPRWCT-------EKLAMNVNCSRHLANSKALIHCLRERSWAELVS--NVPXAPKYYSCFAPSIDHYTVLPSEVDQMIKERNSKFASVPVMFGITKNEAYSYLKQQE--IRKGISDNRKTQIIRTYVQNVFRFHRQKIYEILDHHYTDW---THSSDQISNRD----NILELLSDGQYVAPLVKVAGLHA---DTADTYLYSFAY-STQTEASGDVQGIHGDELPYVFGSPLV--DGSSPFPSSYTNTEKMLSEAVMTYWTNFAKSGNPNEPRNQTSVHGDKVNNRFVDLKWPKYTRDTQEYLPIGRRPSIRHHYRAQ----KLALWLDLIPKI 611          
BLAST of Neuroligin 4-like vs. Ensembl Cavefish
Match: nlgn2a (neuroligin 2 [Source:NCBI gene;Acc:103033407])

HSP 1 Score: 182.956 bits (463), Expect = 2.987e-48
Identity = 149/589 (25.30%), Postives = 261/589 (44.31%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YP +      ++GI    +   L  +  Y G+ YA        TAP  + RFQ   A   +++    R    F PVCPQNL          +   W    + +   ++++Q+E+CL LN+YVP ++    + +  V++F+HG  +  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  I+    S     LFQ     S   +   +    P      +     ++   + +T   L+  L+  N  E++   Q ++  +      P+    +   + + +    + L+ DL +GV +    K+ +   + ++  ++   F   + N V+ L    + K IL   ++  YT+W       +     +MR      L  D  ++APA+     H+  Q+     TF+H              ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  I  N   +   FW E +PH
Sbjct:   46 YPTVTTNYGKLRGIKKDLNNEILGPVEQYLGVPYA--------TAPIGDRRFQPPEAPGSWQE---VRNATQFAPVCPQNLHGVLP---EIMLPVWFTDSLDVAATYIQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGTGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGATCINLLILSHHSEGLFQRAIAQSGSAISSWSINYQPLKY---TKILARKVGCTYGET-ADLVDCLRRKNFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDLLIGVNQGEGLKFVDDGGSESEEGISAAAFDYTISNFVDNLYGYPEGKDILRETIKFMYTDW-------ADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQT----ETRPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGL-----KPRIRDNYRANKVAFWLELVPH 596          
BLAST of Neuroligin 4-like vs. Ensembl Cavefish
Match: nlgn2b (neuroligin 2b [Source:ZFIN;Acc:ZDB-GENE-090918-3])

HSP 1 Score: 181.415 bits (459), Expect = 1.621e-47
Identity = 148/587 (25.21%), Postives = 257/587 (43.78%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YPI+      ++GI    +   L  +  Y G+ YA        TAP  E RFQ   A   ++D    R    F PVCPQN+          +   W   ++     ++++Q+E+CL LN+YVP ++    + +  V++F+HG  +  G GN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GD E I++ G G GA  ++    S     LFQ     S   +   +    P       +    + +   N     L+  L+  +  E++   Q ++  +      P+    +   + + +    + L+ D+ +GV +    K+ +  E   +  ++   F   + N V+ L    D K IL   ++  YT+W       +     DMR      L  D  ++APA+     H+  Q+    +F+ F            ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  +S   K ++H        K  +  N   +   FW E +PH
Sbjct:   46 YPIVTTSYGKVRGIRKELNNEILGPVDEYLGVPYA--------TAPVGERRFQPPEAPGSWQDI---RNATQFAPVCPQNIHGVLP---EIMLPVWFTDNLDAAAAYVQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGAGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDQERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSAISSWSVNYRPL----DYTKILAKKVGCSNSDTADLVDCLRRKSFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDILLGVNQGEGLKFVDDSE--GEDGISAASFDYTISNFVDNLYGYPDGKDILRETIKFMYTDW-------ADRDNGDMRRKTLLALFTDHQWVAPAVATAKLHAEFQS--PVYFYTFHHHCQTEARPEWADAAHGDEIPYVFGVPMVGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNVPVPQDTKFIHTKPNRFEEVIWTKFSSKDKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 594          
BLAST of Neuroligin 4-like vs. Ensembl Cavefish
Match: nlgn4xa (neuroligin-4, X-linked [Source:NCBI gene;Acc:103022482])

HSP 1 Score: 180.259 bits (456), Expect = 3.216e-47
Identity = 153/595 (25.71%), Postives = 265/595 (44.54%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVPKKN-YHTQNQF-AVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPF-FNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +PI+      ++G+        L  +  Y GI YA      P T  E RFQ          + G R    F  VCPQ L +   F  N +   W    +  +  +++DQ+E+CL LNIYVP ++  H +N    V++++HG  +  GTGN  D S+L+SYG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+K +I+ F GDP+ +++ G G GA  +   T S     LFQ   + S   L        P  +    +      +L   +     L+  L+  N  E++  +Q +   K      P+    +   + Q +    + L+ D+ +GV   N G+ F  V+ +  SE  ++   F   + + V+ L    + K  L   ++  YT+W       +     + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P +L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   47 HPIVTTNYGKLRGLKTALPNEILGPVEQYLGIPYA-----LPPTG-ERRFQPPEPPM---SWPGIRNATQFAAVCPQFLED--RFLLNDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYVPTEDDIHDENGLRPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVNYQPAKYTRMLAEKVGCNMLDTID-----LVECLQKKNHKELI--EQYITQAKYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGFKFVDGIVDSEDGVSANDFDFAVSDFVDHLYGYPEGKDTLRETIKFMYTDW-------ADKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTDL--FNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 598          
BLAST of Neuroligin 4-like vs. Ensembl Cavefish
Match: nlgn2b (neuroligin 2b [Source:ZFIN;Acc:ZDB-GENE-090918-3])

HSP 1 Score: 180.644 bits (457), Expect = 3.587e-47
Identity = 148/592 (25.00%), Postives = 258/592 (43.58%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS---------KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YPI+      ++GI    +   L  +  Y G+ YA        TAP  E RFQ   A   ++D    R    F PVCPQN+          +   W   ++     ++++Q+E+CL LN+YVP ++    + +  V++F+HG  +  G GN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GD E I++ G G GA  ++    S         +LFQ     S   +   +    P       +    + +   N     L+  L+  +  E++   Q ++  +      P+    +   + + +    + L+ D+ +GV +    K+ +  E   +  ++   F   + N V+ L    D K IL   ++  YT+W       +     DMR      L  D  ++APA+     H+  Q+    +F+ F            ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  +S   K ++H        K  +  N   +   FW E +PH
Sbjct:   48 YPIVTTSYGKVRGIRKELNNEILGPVDEYLGVPYA--------TAPVGERRFQPPEAPGSWQDI---RNATQFAPVCPQNIHGVLP---EIMLPVWFTDNLDAAAAYVQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGAGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDQERITIFGSGAGASCVNLLILSHHSEGEWSYRLFQRAIAQSGSAISSWSVNYRPL----DYTKILAKKVGCSNSDTADLVDCLRRKSFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDILLGVNQGEGLKFVDDSE--GEDGISAASFDYTISNFVDNLYGYPDGKDILRETIKFMYTDW-------ADRDNGDMRRKTLLALFTDHQWVAPAVATAKLHAEFQS--PVYFYTFHHHCQTEARPEWADAAHGDEIPYVFGVPMVGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNVPVPQDTKFIHTKPNRFEEVIWTKFSSKDKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 601          
BLAST of Neuroligin 4-like vs. Ensembl Cavefish
Match: nlgn4xa (neuroligin-4, X-linked [Source:NCBI gene;Acc:103022482])

HSP 1 Score: 179.874 bits (455), Expect = 4.651e-47
Identity = 149/599 (24.87%), Postives = 270/599 (45.08%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKM--IQPFLKDQNEECLTLNIYVPKKN-YHTQNQF-AVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS------KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQT---RKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +PI+      ++G+        L  +  Y GI YA    L P    E RFQ          + G R    F  VCPQ L +   F  N +   W    +  +  +++DQ+E+CL LNIYVP ++  H +N    V++++HG  +  GTGN  D S+L+SYG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+K +I+ F GDP+ +++ G G GA  +   T S      + F++++ +  + +I        +  N+  + +   + +           L+  L+  N  E++  +Q +   K      P+    +   + Q +    + L+ D+ +GV   N G+ F  V+ +  SE  ++   F   + + V+ L    + K  L   ++  YT+W+            + R      L  D  ++APA+   + H+  Q    T+F+ F      ++ P  A      ++   D++   FG P+  P +L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW E +PH
Sbjct:   47 HPIVTTNYGKLRGLKTALPNEILGPVEQYLGIPYA----LPP--TGERRFQPPEPPM---SWPGIRNATQFAAVCPQFLED--RFLLNDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYVPTEDDIHDENGLRPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEGDRWFESRSYLFQKAIIQSGTALSSWAVNYQPAKYTRMLAEKVGCNMLDTIDLVECLQKKNHKELI--EQYITQAKYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGV---NQGEGFKFVDGIVDSEDGVSANDFDFAVSDFVDHLYGYPEGKDTLRETIKFMYTDWA-------DKENPETRRKTLVALFTDHQWVAPAVATADLHA--QYGSPTYFYAFYHHCQSEMKPSWA------DSAHGDEVPYVFGIPMIGPTDL--FNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGL-----KPRVRDHYRATKVAFWLELVPH 607          
BLAST of Neuroligin 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002735.1 (pep scaffold:Pmarinus_7.0:GL485913:3796:8263:-1 gene:ENSPMAG00000002501.1 transcript:ENSPMAT00000002735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 3.980e-30
Identity = 62/183 (33.88%), Postives = 97/183 (53.01%), Query Frame = 1
Query:  184 FSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKD-QNEECLTLNIYVPKKNYHT----QNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILG-FLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQN 702
            +SG R+     P CPQ + N  H  +  L  +    + +  +L   Q+EECL L++Y+P ++  +    +   AV++F+HG  F  G G  YD S L+++GD+I V + YRLG+LG F +  +    GN+ L D   A+ WV+ ++ HF GD   ++L+G G GA        S     LFQ 
Sbjct:   28 WSGEREAATRGPPCPQPVPN--HRGWGMLPVWEAGNERLATWLSSKQSEECLNLDVYIPGRDGESIPGERPPLAVMVFLHGGSFLDGAGGLYDGSALAAHGDVIVVIVTYRLGVLGSFFSTGDSLARGNYGLLDQVMALRWVRENVGHFGGDQGRVTLVGAGTGAACASLLALSHHAEGLFQR 208          
BLAST of Neuroligin 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007813.1 (pep scaffold:Pmarinus_7.0:GL477731:150595:158527:1 gene:ENSPMAG00000007070.1 transcript:ENSPMAT00000007813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 4.656e-23
Identity = 57/188 (30.32%), Postives = 97/188 (51.60%), Query Frame = 1
Query:   76 IRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISL 639
            + A+ GI YA     KP    + RF++ V     E + G      F P C Q         +   + +              +E+CL LN+++P+    ++N+ AV++++HG  +R GT   Y+   L++ G +I VT+NYRLG LG+L+  +    GN+ L+D  AA++WVK +I+ F GD   +++
Sbjct:   64 VEAFVGIPYA-----KPPIG-DLRFRKPVP---LEKWDGVYNATTFSPACYQKPWFLEEISFGKFDHF--------------DEDCLYLNVFIPEV---SENKMAVMVWIHGGAYRYGTAEEYEGRFLAAAG-VILVTVNYRLGPLGWLSTGDEQSRGNYGLWDQHAALMWVKHNIESFGGDANRVTI 224          
BLAST of Neuroligin 4-like vs. Ensembl Sea Lamprey
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 84.3445 bits (207), Expect = 6.885e-17
Identity = 46/110 (41.82%), Postives = 62/110 (56.36%), Query Frame = 1
Query:  322 NEECLTLNIYVPKKNYHTQNQFAVLIFVHGED--FRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMG 645
            +E+CL LNI+VPK   H     +VL+F HG D  F        D S L++ GDII VT NYRLG+ GFL+  +    GN+ L D  AA+ WV+ H   F G    +++ G
Sbjct: 2288 SEDCLYLNIFVPKVKPHNA---SVLVFFHGGDNSFGGSAQGPLDPSYLAALGDIIVVTANYRLGLFGFLSTGDEAAAGNWGLLDQQAALRWVRDHAALFGGSAGAVTVAG 2394          
BLAST of Neuroligin 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007921.1 (pep scaffold:Pmarinus_7.0:GL476391:291925:322499:1 gene:ENSPMAG00000007162.1 transcript:ENSPMAT00000007921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 6.836e-9
Identity = 70/338 (20.71%), Postives = 137/338 (40.53%), Query Frame = 1
Query:  823 KSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDP--FNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIP-----HTCLSFKSSNITQPVPKDPP 1761
            + ++  L+S +  E++   Q +K  +      P+    +   + Q +    + L+ D+ +G+   N G+    VE+M   +  ++   F  ++ N V+ L    + K  L   ++  YT+W+           ++ R      L  D  ++APA+   + H+  Q    T+ + F      ++ P  A      +A   D+    FG P+  P  L P  F+K D    + +S ++M+  + F K+G+PN        F+    ++ +  +W  YS   +H++H        K  +  +       FW E +P     H    + S+    P P   P
Sbjct:   49 QDVVECLRSRSFRELV--NQDIKPMRYHVAFGPVIDGDVIPDDPQILMEQGEFLNYDVMLGI---NQGEGLKFVESMVDIDDGVSAANFDNIVSNFVDNLYGYPEGKDELRATIKFMYTDWA-------DRNNAETRRKTLVALFTDHQWVAPAMATADLHA--QYGSPTYVYAFYHHCQSEMKPAWA------DAAHGDETPYVFGVPMVGPTLLFPCNFSKND----VMLSAVVMTYWTNFAKTGDPNAPVPQDTKFIHNKPNRYEEMAWSKYSPKDQHYLHIGL-----KPRVREHYRATKVAFWLELVPHLHNLHDMFQYTSTTTKAPSPYATP 357          
BLAST of Neuroligin 4-like vs. Ensembl Nematostella
Match: EDO35372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM2])

HSP 1 Score: 163.31 bits (412), Expect = 4.614e-43
Identity = 125/463 (27.00%), Postives = 216/463 (46.65%), Query Frame = 1
Query:  322 NEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKL--APMFSSQLFNFNEQKMTNDNKLLDID-LWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIP 1701
            +E+CL LN++ P     T++   V++F+HG  +  G+G+ YD + L++Y D+I VT+NYRLG+LGFL++A  D+ GN+A+YD   A+ WV+ HI  F GDP  ++L G   G   +   T S L +     +I             +  +P+++    I +L     K +L+ L+S +  EIL A Q +    L+  +   P         +   M  + ++  +D + VGV  N  G +++ V     S+ +   F+  + N V   +  D  I+   + + YTN       +  ++  ++ + N+ +L+ +  F APAI+M   + +     + F+HF            V    F D++   FG P   P        K  +    +S ++M     F  +G+P    KA    +  +WP YS   + ++    Q     +S+   L PD   FWNEF+P
Sbjct:  113 SEDCLFLNVFRPAGTKATKD-LPVMVFIHGGGYYRGSGDVYDGTPLAAYNDVIVVTMNYRLGLLGFLHVAGTDVTGNYAMYDQILALKWVQQHIGCFGGDPSQVTLFGQSAGGASVLLLTLSPLSKGLFKRAILESPTET------YGTYPTNNTKVYIDRLGCHGEK-VLACLQSKSLEEILKA-QGIADFLLLGIVFPVPAVDGSFLGKDPDVMIAEGQVHPLDAVIVGVNSNEGGFHWHGVMETPDSQPSVSMFKESIVN-VSFTKQGDCDIVKEAIMYRYTN------HTEPFSPHNL-LHNWQRLVTEYRFFAPAIRMAQAYVK-AGIPTYFYHFSHWSTFSKRPKSVGVVHF-DEIPYVFGLPWK-PNKGIQVATKYTDVERGLSTMVMRMWGEFAYTGSPM---KAGDSPQNVTWPLYSTEQEEYLDIGLQ-----LSVHRKLRPDGMAFWNEFVP 547          
BLAST of Neuroligin 4-like vs. Ensembl Nematostella
Match: EDO47082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN68])

HSP 1 Score: 156.377 bits (394), Expect = 1.229e-40
Identity = 142/565 (25.13%), Postives = 244/565 (43.19%), Query Frame = 1
Query:   76 IRAYYGIRYAS--VGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQT-----RKSLLSYLKSTNSSEILAAQQKLK-SNKLIDKL--APMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL----QLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVN-----DHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFN---KKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTK-HFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIP 1701
            +R +  I YA   VGKL        RF    A    + +SG R      PVCPQ        ++  +    +        +++ NE+CLT+++Y P+ N     Q AV++F+HG  F +G    YD SVL +  D+I VTINYRLG+LGF N+ + +  GN+ L D   A+ WV+ +I  F G+P+++++ G   G + +     S L  +K L         + +   F  ++  ++    +L++F++         L+  L+ T+S ++ AAQ  +   N +  +L   P+          +++  + ++   D+ +GV  N             +  +T ++   +++  ++       +C   I     +H   N   +S+T+ Q          +  L +D+ FIAPAI   N      H+    +      FF +PP  A+   +       D+   FG PL   E+   F    ++ +     +SM MM   + F K G+PN    A        WP Y+ + + H V  H  R      +      +   FWNEFIP
Sbjct:   31 VRQFRAIPYAQPPVGKL--------RF---AAPLPAKPWSGVRDATQHGPVCPQ----LPDEEFGKMLGLDLPPGKT---IENSNEDCLTISVYTPQ-NSDPDKQRAVMVFIHGGGFTSGASRDYDPSVLVALNDVIVVTINYRLGVLGFFNIPDTEYKGNYGLLDQVLALQWVQQNIASFGGNPKSVTIFGESAGGMSVSLHLLSPL--SKGLFHRVIAQSGSAVTDSFVGHYVKTT---ALLEVFSKAVGCPFDDKLVDCLRITSSEDVFAAQSNVSYPNNVGAQLLTTPVIDKHFLPDKARRLLGEGRVNKADVMLGVTANEGALLAMMTPGRIEGGLTLQELHQVIEYGLDTCPPDNTMCKEAIKFEYQDHRDPN---NSVTNRQL---------YMDLYSDSMFIAPAIFEANALASAGHATFVYKFENLPDFFALPPYCASVHGI-------DIPYTFGFPLTLGESSPLFASLVRRHSEREKGLSMYMMKTWADFAKHGDPNHDGDAP-----VPWPRYNTTAQAHLVIAHEPR------VEYKFRAEKVAFWNEFIP 541          
BLAST of Neuroligin 4-like vs. Ensembl Nematostella
Match: EDO36346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIV4])

HSP 1 Score: 128.257 bits (321), Expect = 3.158e-31
Identity = 143/565 (25.31%), Postives = 249/565 (44.07%), Query Frame = 1
Query:   79 RAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQF-AVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSS-----FDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKL---APMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLL---NDAFFIAPAIKMVNDHSRLQNR-QSTFFHFFD-IPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDAN-SLLN--ISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTI---PKVSISSNLMP--DIAQFWNEFIP 1701
            R +  IRYA         AP  + RF +S        ++G +      P+CPQ                 + ++M+   + + +E+CLTL+IY P+   HT  +  AV+++VHG  F +G+   +D SVL +  D+I VTINYRLG+LGF N+ + D+ GN+ L+D   A+ WV+ +I  F G+P+++++ G   G + +     S +  +K L         +     F  +  +S+     F + I   FN    SL+  L++ +  E+  AQ+ + + +   K+    P+   +    + +++  + K+   D+ +GV  N  G +        K+ + ++Q    ++ S++     ++  L  +   +  N  ++             ITN   L+    D  F+APA   V +   L N  Q+ FF+ F+ +P        +S    L DL    G P +   N         N S ++  +S+ MM   + F K G+PN      +Q     WP ++ +      + S   I   P+V      MP  D   FWNEF P
Sbjct:   27 RQFRAIRYAE--------APIGDLRFAKSKP---VRSWNGVKDATQHGPICPQEKDE-------------VFIRMLNIDIPEGSEDCLTLSIYTPQ---HTSPKLRAVMVWVHGGGFSSGSSRGFDPSVLVALHDVIVVTINYRLGVLGFFNIPDTDVKGNYGLFDQSLALQWVQQNIASFGGNPQSVTIFGESVGGMSVSAHLLSPI--SKGLFHRVIAQSGSASFDSFVGHEANSAGLVKVFADAIGCEFN---ASLVVCLRTKSVKEVFEAQRNVTAPQNSGKMLLTTPVVDGEFLTGSTKQLLREGKINKADVMLGVNANEGGFFALLFPGHLKNGLPQQQLHAAMETSLKSFTGMNTIALEAVKFEYQDNKKLND-----------NITNRQMLMEFGTDYMFLAPA---VFEAIALANAGQAPFFYVFEHLPDFYHVGPWLSSMHGL-DLLFMTGVPFSPGHNAKLLQALVGNYSAMDKGLSLYMMELWTNFAKYGDPNH-----TQSTPVVWPRFNAT------FQSHLIISLNPRV----EQMPRADKMAFWNEFFP 529          
BLAST of Neuroligin 4-like vs. Ensembl Nematostella
Match: EDO25969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD84])

HSP 1 Score: 116.701 bits (291), Expect = 1.154e-30
Identity = 52/124 (41.94%), Postives = 80/124 (64.52%), Query Frame = 1
Query:  322 NEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKL 693
            +E+CL LN++ P     T++   V++F+HG  +  G+G+ YD + L++Y D+I VT+NYRLG+LGFL++A  D+ GN+A+YD   A+ WV+ HI  F GDP  ++L G   G   +   T S L
Sbjct:    2 SEDCLFLNVFRPAGTKATKD-LPVMVFIHGGGYYRGSGDVYDGTPLAAYNDVIVVTMNYRLGLLGFLHVAGTDVTGNYAMYDQILALKWVQQHIGCFGGDPSQVTLFGQSAGGASVLLLTLSPL 124          
BLAST of Neuroligin 4-like vs. Ensembl Nematostella
Match: EDO46992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV3])

HSP 1 Score: 117.087 bits (292), Expect = 2.388e-27
Identity = 114/499 (22.85%), Postives = 211/499 (42.28%), Query Frame = 1
Query:  322 NEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFN-------FNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEM----TEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWS-VDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFD-IPPIQANNLLVSEADFL------DDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPHTCLSFKSSNITQPVPKDPP 1761
            +E CLTLN+Y P    ++     VL+F+HG  F   + +  D S+L++   I+ VTINYRLGILGFL   +GDI  N  L D   A+ WV+ +I+ F GD   +++ G   G         S L                       +   ++    E+L   +  ++ +   L+  +++EI++A Q +       K AP     +              +    +L  +++ +G   +      +    +++ ++    + + F   ++N  +      +  +S  +E  YT+WS  D+   ++ +  D        ++ D + + P +  +   ++   R  TFF+FF+  PP++     +++A          D +  FG  L      D   K D       +    + ++ F+K+G+PN            +WP ++   + +V   SQ     +S+ SNL  D   FWN+F+P    S  SS+   P  ++PP
Sbjct:   98 DENCLTLNVYKPSATRNSS--LPVLVFIHGGAFMRFSAHEDDPSLLATEQGIMVVTINYRLGILGFL--CSGDIKENLGLLDQIYALKWVQNNIERFGGDRSQVTIGGLSAGGESASILMLSPLATGLFTGVFAMSGTPVPTLEGRKDVETAARRVAEVLGCIDVGQR-ITDCLREKSTAEIVSAMQNVSM-----KFAPCVDGHVIPSFWIRHLIGTSALGESRELKKLNVMMGATNDEGSFQLHVSPDLSRQDLDHGISRQTFTQYIRN--QTWITGQTNQVSHAIEQVYTDWSNEDNANKTRESLVD--------VITDHWIVVPTVTTLRACAKAGAR--TFFYFFEKKPPVERKIKGITQAPGWFRATHGADNSYLFGGDLDMTWVNDSL-KADR----EFAKRFRTFIANFVKTGDPNGATVP-------TWPQFTPVHQQYVSMDSQ-----ISLGSNLRADKVHFWNKFLP----SLTSSD---PPSQEPP 550          
BLAST of Neuroligin 4-like vs. Ensembl Medaka
Match: ENSORLT00000020295.2 (neuroligin-4, X-linked [Source:NCBI gene;Acc:101168332])

HSP 1 Score: 184.111 bits (466), Expect = 1.122e-48
Identity = 158/611 (25.86%), Postives = 268/611 (43.86%), Query Frame = 1
Query:    4 PIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVP-KKNYHTQN-QFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSE--MTEEQFRVLLKNSVEELQLC--DSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFF------DIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH-----TCLSFKSSNITQPVPKD 1755
            P+I      I+GI        L  +  Y G+ YA     +P T  + RFQ          + G R +  F PVCPQ+L   S      +   W+  ++ +   +L  Q+E+CL LNIYVP +++ H +  Q  V+++VHG  +  GTGN  D SVL+SYG++I +T+NYRLG+LGFL+  +    GN+ L D   A+ WVK +I  F GDP  +++ G G GA  +   T S   ++    +I +           +     +    E +         L++ L+  +  E++  +Q +   K     AP+    +   + Q +    + L+ D+ +GV   N G+    VE +  SE  +T E F   + + V+ L         L   +   YT+W       +    ++ R      L  D  ++APAI   + H+  Q    T+F+ F      D  P  A++         D++   FG P+  P +L  FN   + + + +S ++M+  + F K+G+PN        F+    ++ +  +W  Y+   + ++H        K  +  +       FW + +PH       L   SS    P P+D
Sbjct:   39 PVISTAQGRIRGILTPLPSDLLGPVIQYLGVPYA-----RPPTG-DRRFQPPEPP---LPWPGIRNVTQFAPVCPQSLDERSML--VDMMPSWLTANLDIAATYLTHQSEDCLYLNIYVPTEEDIHEEGGQRPVMVYVHGGSYTEGTGNMMDGSVLASYGNVIVITLNYRLGVLGFLSTGDQTAKGNYGLLDQIQALRWVKENIAAFGGDPSRVTVFGSGAGASCVSLLTLSHYSEDLFHRAIIQSGSALASWAVNYQPSKYARILGERVGCGIDDSTQLVACLQGRSYRELV--EQNITPAKYHTAFAPVIDGDVIPDDPQILMEQGEFLNYDVMLGV---NQGEGVKFVEGIVDSEDGVTAEDFDFAVSDFVDSLYGYPEGRDTLRESIRFMYTDW-------ADRDNAETRRKTLVALFTDHQWVAPAIATADLHA--QYGSPTYFYSFYHHCQSDATPPWADSA------HGDEVPYVFGVPMVGPTDL--FNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYTPKEQLYLHIGL-----KPRVRDHYRATKISFWLQLVPHLHHVNELLQSVSSFTHSPSPQD 611          
BLAST of Neuroligin 4-like vs. Ensembl Medaka
Match: nlgn2 (neuroligin 2b [Source:NCBI gene;Acc:100529174])

HSP 1 Score: 181.8 bits (460), Expect = 9.804e-48
Identity = 150/587 (25.55%), Postives = 261/587 (44.46%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YPI+      ++GI    +   L  +  + G+ YA        TAP  E RFQ   A   +++    R    F PVCPQN+          +   W   ++     ++++Q+E+CL LNIYVP ++    + +  V++F+HG  +  G+GN +D SVLS+YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P      +    +++   F      L+  L+  +  E++   Q ++  +      P+    +   + + +    + L+ D+ +GV +    K+ +  E   +  ++   F   + N V+ L    D K IL   ++  YT+W       +    SDMR      L  D  ++APA+     H+  Q+    +F+ F            ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  +S   K ++H        K  +  N   +   FW E +PH
Sbjct:   52 YPIVSTVYGKVRGIRKELNNEILGPVEQFLGVPYA--------TAPVGERRFQPPEAPGSWQEI---RNATQFAPVCPQNVHGVLP---EIMLPVWFTDNLDAAATYVQNQSEDCLYLNIYVPTEDDVRDRRKKPVMLFIHGGSYMEGSGNMFDGSVLSAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGAACVNLLILSHHSEGLFQRAIAQSGSAISSWSVNYRPLMY---TKILAKKVGCSFGDM-ADLVDCLRRKSFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDILLGVNQGEGLKFVDDSE--GEDGISAASFDYTISNFVDNLYGYPDGKDILRETIKFMYTDW-------ADRDNSDMRRKTLLALFTDHQWVAPAVATAKLHAEFQS--PVYFYTFHHHCQTEARPDWADAAHGDEIPYVFGIPMVGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNLPVPQDTTFIHTKPNRFEEVIWTKFSSKDKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 600          
BLAST of Neuroligin 4-like vs. Ensembl Medaka
Match: nlgn2 (neuroligin 2b [Source:NCBI gene;Acc:100529174])

HSP 1 Score: 181.8 bits (460), Expect = 1.047e-47
Identity = 150/587 (25.55%), Postives = 261/587 (44.46%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            YPI+      ++GI    +   L  +  + G+ YA        TAP  E RFQ   A   +++    R    F PVCPQN+          +   W   ++     ++++Q+E+CL LNIYVP ++    + +  V++F+HG  +  G+GN +D SVLS+YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LFQ     S   +   +    P      +    +++   F      L+  L+  +  E++   Q ++  +      P+    +   + + +    + L+ D+ +GV +    K+ +  E   +  ++   F   + N V+ L    D K IL   ++  YT+W       +    SDMR      L  D  ++APA+     H+  Q+    +F+ F            ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  +S   K ++H        K  +  N   +   FW E +PH
Sbjct:   51 YPIVSTVYGKVRGIRKELNNEILGPVEQFLGVPYA--------TAPVGERRFQPPEAPGSWQEI---RNATQFAPVCPQNVHGVLP---EIMLPVWFTDNLDAAATYVQNQSEDCLYLNIYVPTEDDVRDRRKKPVMLFIHGGSYMEGSGNMFDGSVLSAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGAACVNLLILSHHSEGLFQRAIAQSGSAISSWSVNYRPLMY---TKILAKKVGCSFGDM-ADLVDCLRRKSFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDILLGVNQGEGLKFVDDSE--GEDGISAASFDYTISNFVDNLYGYPDGKDILRETIKFMYTDW-------ADRDNSDMRRKTLLALFTDHQWVAPAVATAKLHAEFQS--PVYFYTFHHHCQTEARPDWADAAHGDEIPYVFGIPMVGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNLPVPQDTTFIHTKPNRFEEVIWTKFSSKDKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 599          
BLAST of Neuroligin 4-like vs. Ensembl Medaka
Match: nlgn2a (neuroligin 2 [Source:NCBI gene;Acc:100529173])

HSP 1 Score: 177.178 bits (448), Expect = 3.240e-46
Identity = 150/589 (25.47%), Postives = 259/589 (43.97%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +PI+      I+GI    +   L  +  Y G+ YA        TAP  + RFQ   A   +++    R    F PVCPQN+          +   W   ++ +   ++++Q+E+CL LNIYVP ++    + +  V++F+HG  F  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LF      S   +   +    P      +     ++   ++ T   L+  L+     E++   Q ++  +      P+    +   + + +    + L+ D+ +GV +    K+ +  E      +T   F   + N V+ L    + K IL   ++  YT+W       +     DMR      L  D  ++APAI     H+  Q+     TF+H              ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   43 HPIVNTNYGKIRGIKKDLNNEILGPVEQYLGVPYA--------TAPIGDRRFQPPEAPGSWQEI---RNATQFAPVCPQNIHGVLP---EIMLPVWFTDNLDVAAGYIQNQSEDCLYLNIYVPTEDDIRDRRKKPVMMFIHGGSFMEGTGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFHRAIAQSGTAISSWSVNYQPLKY---TKILARKVGCTYSDT-VDLVDCLRRKTFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDILIGVNQGEGLKFVDDSE--DNDGITAAAFDYTISNFVDNLYGYPEGKDILRETIKFMYTDW-------ADRDNGDMRRKTLLALFTDHQWVAPAIATAKLHAEFQSPVYFYTFYHHCQT----ETRPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 591          
BLAST of Neuroligin 4-like vs. Ensembl Medaka
Match: nlgn2a (neuroligin 2 [Source:NCBI gene;Acc:100529173])

HSP 1 Score: 177.178 bits (448), Expect = 3.492e-46
Identity = 150/589 (25.47%), Postives = 259/589 (43.97%), Query Frame = 1
Query:    1 YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAP--EYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWM--HVKMIQPFLKDQNEECLTLNIYVPKKN-YHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKS----KLFQNKXXXXXXXXXXXXXXXXPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEEL-QLCDSK-ILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQ--STFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPN--------FVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPH 1704
            +PI+      I+GI    +   L  +  Y G+ YA        TAP  + RFQ   A   +++    R    F PVCPQN+          +   W   ++ +   ++++Q+E+CL LNIYVP ++    + +  V++F+HG  F  GTGN +D SVL++YG++I VT+NYRLG+LGFL+  +    GN+ L D   A+ W+  +I HF GDPE I++ G G GA  ++    S     LF      S   +   +    P      +     ++   ++ T   L+  L+     E++   Q ++  +      P+    +   + + +    + L+ D+ +GV +    K+ +  E      +T   F   + N V+ L    + K IL   ++  YT+W       +     DMR      L  D  ++APAI     H+  Q+     TF+H              ++A   D++   FG P+    +L P N    + +L  S ++M+  + F K+G+PN        F+    ++ +   W  ++   K ++H        K  +  N   +   FW E +PH
Sbjct:   49 HPIVNTNYGKIRGIKKDLNNEILGPVEQYLGVPYA--------TAPIGDRRFQPPEAPGSWQEI---RNATQFAPVCPQNIHGVLP---EIMLPVWFTDNLDVAAGYIQNQSEDCLYLNIYVPTEDDIRDRRKKPVMMFIHGGSFMEGTGNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFHRAIAQSGTAISSWSVNYQPLKY---TKILARKVGCTYSDT-VDLVDCLRRKTFRELV--DQDIQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLNYDILIGVNQGEGLKFVDDSE--DNDGITAAAFDYTISNFVDNLYGYPEGKDILRETIKFMYTDW-------ADRDNGDMRRKTLLALFTDHQWVAPAIATAKLHAEFQSPVYFYTFYHHCQT----ETRPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDVML--SAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGL-----KPRVRDNYRANKVAFWLELVPH 597          
BLAST of Neuroligin 4-like vs. Planmine SMEST
Match: SMESG000077711.1 (SMESG000077711.1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 448/450 (99.56%), Postives = 448/450 (99.56%), Query Frame = 1
Query:  754 PFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPHTCLSFKSSNITQPVPKDPPIKLVIRYIDVPNEHSLTTYSSGEIKQFSESSTIPRDFSDKFXXXXXXXXXXXXXXXXXXXFLGIFYQARKIRTMNLNISRQKSQNAIGDIQRNIFVNNNHVAFGHQESIPLSIK 2103
            PFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEIL AQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKN VEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPHTCLSFKSSNITQPVPKDPPIKLVIRYIDVPNEHSLTTYSSGEIKQFSESSTIPRDFSDKFILILTIIIGSSLLILNVLIFLGIFYQARKIRTMNLNISRQKSQNAIGDIQRNIFVNNNHVAFGHQESIPLSIK
Sbjct:   27 PFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILVAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNFVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQYAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPIQANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMSQLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSISSNLMPDIAQFWNEFIPHTCLSFKSSNITQPVPKDPPIKLVIRYIDVPNEHSLTTYSSGEIKQFSESSTIPRDFSDKFILILTIIIGSSLLILNVLIFLGIFYQARKIRTMNLNISRQKSQNAIGDIQRNIFVNNNHVAFGHQESIPLSIK 476          
BLAST of Neuroligin 4-like vs. Planmine SMEST
Match: SMESG000077713.1 (SMESG000077713.1)

HSP 1 Score: 448.743 bits (1153), Expect = 2.975e-155
Identity = 210/211 (99.53%), Postives = 211/211 (100.00%), Query Frame = 1
Query:   73 MIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNK 705
            MIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQ+K
Sbjct:    1 MIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQSK 211          
BLAST of Neuroligin 4-like vs. Planmine SMEST
Match: SMESG000042617.1 (SMESG000042617.1)

HSP 1 Score: 259.225 bits (661), Expect = 4.817e-79
Identity = 159/379 (41.95%), Postives = 229/379 (60.42%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYN--TLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFN-NHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTN---DNKLL--DIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQ 1119
            I   + + + GI I+ S  N   +R Y+GIRYAS+GK+K     E RF   VASF+YE+F+G    + F PVCPQNL N + FD N    NSYW H+K I PFL+ Q+EECLTLNIYVP+ N HT   F VL+F+HGE F  G+GNAYD+S L+SYG II +T+NYRLG+LGFL   +    GN+A YD+FAA+ W+  +I  FNGD   ++LMG+G GA  +H F+ SK+ ++       RLI++NG GL  ++ +  S  +   + K  N + K L   LK    + IL A +     K   ++ P  S+QLF +  +   N    NK    ++D+ VG+  +NAG +FN    +  ++ +E +F++ L+N++  L 
Sbjct:   30 IDFGDGRFLSGIPINLSS-NSPPVRGYFGIRYASLGKIKNTVYTENRFNPPVASFFYEEFTGDFIQDKFAPVCPQNLPNMTDFDKNKDNYNSYWHHIKRILPFLEHQDEECLTLNIYVPENN-HTS-PFPVLLFIHGESFEIGSGNAYDVSKLASYGQIIGITLNYRLGLLGFLKSDDNLAQGNYAFYDIFAALQWISTNIYKFNGDSNKVTLMGHGHGAALVHLFSLSKMLKDMKKKLFHRLIIINGNGLSGWSWSQFSHMYMNALGKYMNVSSKLLFRQLKREPITNILKASEFTPKLKFSSRIGPTISNQLFTYASKLSRNLVPSNKEFYRELDVLVGLNGDNAGFFFNAPLLLKNNDFSELKFQINLRNTLSPLH 405          
BLAST of Neuroligin 4-like vs. Planmine SMEST
Match: SMESG000042617.1 (SMESG000042617.1)

HSP 1 Score: 259.225 bits (661), Expect = 4.976e-79
Identity = 159/379 (41.95%), Postives = 229/379 (60.42%), Query Frame = 1
Query:    7 IILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYN--TLNSYWMHVKMIQPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKXXXXXXXXXXXXXXXXPFFN-NHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNKLIDKLAPMFSSQLFNFNEQKMTN---DNKLL--DIDLWVGVMRNNAGKYFNKVETMTKSEMTEEQFRVLLKNSVEELQ 1119
            I   + + + GI I+ S  N   +R Y+GIRYAS+GK+K     E RF   VASF+YE+F+G    + F PVCPQNL N + FD N    NSYW H+K I PFL+ Q+EECLTLNIYVP+ N HT   F VL+F+HGE F  G+GNAYD+S L+SYG II +T+NYRLG+LGFL   +    GN+A YD+FAA+ W+  +I  FNGD   ++LMG+G GA  +H F+ SK+ ++       RLI++NG GL  ++ +  S  +   + K  N + K L   LK    + IL A +     K   ++ P  S+QLF +  +   N    NK    ++D+ VG+  +NAG +FN    +  ++ +E +F++ L+N++  L 
Sbjct:   33 IDFGDGRFLSGIPINLSS-NSPPVRGYFGIRYASLGKIKNTVYTENRFNPPVASFFYEEFTGDFIQDKFAPVCPQNLPNMTDFDKNKDNYNSYWHHIKRILPFLEHQDEECLTLNIYVPENN-HTS-PFPVLLFIHGESFEIGSGNAYDVSKLASYGQIIGITLNYRLGLLGFLKSDDNLAQGNYAFYDIFAALQWISTNIYKFNGDSNKVTLMGHGHGAALVHLFSLSKMLKDMKKKLFHRLIIINGNGLSGWSWSQFSHMYMNALGKYMNVSSKLLFRQLKREPITNILKASEFTPKLKFSSRIGPTISNQLFTYASKLSRNLVPSNKEFYRELDVLVGLNGDNAGFFFNAPLLLKNNDFSELKFQINLRNTLSPLH 408          
BLAST of Neuroligin 4-like vs. Planmine SMEST
Match: SMESG000005630.1 (SMESG000005630.1)

HSP 1 Score: 97.4413 bits (241), Expect = 8.636e-21
Identity = 70/229 (30.57%), Postives = 113/229 (49.34%), Query Frame = 1
Query:   46 IHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRFQQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMIQPFLKDQNEECLTLNIYVP--------KKNYHTQNQFAVLIFVHGEDFRTGTGN--AYDMSVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGHIKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQN 702
            + ++  + + +  YYGI YA +  +K       RF++ V   + E        +  KP C Q    ++   Y       M V  I PF    +E+CL LNI+VP        K N  T ++ AV+++++G  F +G      Y+   L++  ++I V++NYRLG  GF+ + NG I GN  L+D   A+ WVK +I+ F GD + I++ G   G+V +     S   QN
Sbjct:   42 VEWNDRSATTVHIYYGIPYA-IPPVK-----NLRFKKPVP--FPEISEKVVNAQTHKPSCHQ----YNDTSYLNTAGARMWVSPI-PF----DEDCLYLNIWVPQNPAPDVHKMNQKTTDKLAVMVWIYGGSFASGAAGLEVYEGRYLAARQNVIVVSMNYRLGPFGFIYLKNGLIPGNMGLWDQRLALKWVKENIEFFGGDSDKITIFGESAGSVSVSAHVISPWSQN 253          
The following BLAST results are available for this feature:
BLAST of Neuroligin 4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NLGN4Y2.282e-4725.93neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4Y2.282e-4725.93neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4X8.560e-4725.68neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4X8.560e-4725.68neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4X8.560e-4725.68neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlg-17.219e-3725.32Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
nlg-19.314e-3725.32Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
nlg-11.086e-3625.20Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
nlg-11.155e-3625.32Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
nlg-11.461e-3625.20Neuroligin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nlg38.519e-3835.14gene:FBgn0083963 transcript:FBtr0333927[more]
Nlg38.519e-3835.14gene:FBgn0083963 transcript:FBtr0301072[more]
Nlg22.279e-3534.71gene:FBgn0031866 transcript:FBtr0307033[more]
Nlg22.279e-3534.71gene:FBgn0031866 transcript:FBtr0079344[more]
Nlg22.279e-3534.71gene:FBgn0031866 transcript:FBtr0343867[more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlgn2a1.232e-5025.21neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2][more]
nlgn4xb2.559e-4926.49neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-... [more]
nlgn4xb2.559e-4926.49neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-... [more]
nlgn4xb2.559e-4926.49neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-... [more]
nlgn2a2.353e-4824.47neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2][more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlgn4x6.253e-4725.38neuroligin 4 X-linked [Source:NCBI gene;Acc:100329... [more]
ddx171.109e-4323.72DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1... [more]
ddx172.829e-4122.94DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1... [more]
ddx173.029e-4123.05DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1... [more]
ddx171.516e-3822.31DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nlgn25.693e-4224.40neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835][more]
Nlgn25.693e-4224.40neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835][more]
Nlgn31.299e-4023.00neuroligin 3 [Source:MGI Symbol;Acc:MGI:2444609][more]
Nlgn34.125e-3822.26neuroligin 3 [Source:MGI Symbol;Acc:MGI:2444609][more]
Nlgn31.440e-3724.59neuroligin 3 [Source:MGI Symbol;Acc:MGI:2444609][more]
back to top
BLAST of Neuroligin 4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NFZ3|NLGNY_HUMAN1.096e-4625.93Neuroligin-4, Y-linked OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8N0W4|NLGNX_HUMAN4.111e-4625.68Neuroligin-4, X-linked OS=Homo sapiens OX=9606 GN=... [more]
sp|Q69ZK9|NLGN2_MOUSE3.982e-4124.40Neuroligin-2 OS=Mus musculus OX=10090 GN=Nlgn2 PE=... [more]
sp|Q62888|NLGN2_RAT1.433e-4024.24Neuroligin-2 OS=Rattus norvegicus OX=10116 GN=Nlgn... [more]
sp|Q8NFZ4|NLGN2_HUMAN1.622e-4024.24Neuroligin-2 OS=Homo sapiens OX=9606 GN=NLGN2 PE=1... [more]
back to top
BLAST of Neuroligin 4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KC182.881e-6028.13COesterase domain-containing protein OS=Biomphalar... [more]
A0A1S3KB759.104e-6030.21neuroligin-4, X-linked isoform X2 OS=Lingula ungui... [more]
A0A504YR799.523e-6044.66Neuroligin-4 X-linked protein OS=Fasciola gigantic... [more]
A0A1S3KAM11.002e-5930.21neuroligin-4, X-linked isoform X1 OS=Lingula ungui... [more]
E2I9N24.112e-5827.13Neuroligin OS=Aplysia californica OX=6500 PE=2 SV=... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nlgn2a2.987e-4825.30neuroligin 2 [Source:NCBI gene;Acc:103033407][more]
nlgn2b1.621e-4725.21neuroligin 2b [Source:ZFIN;Acc:ZDB-GENE-090918-3][more]
nlgn4xa3.216e-4725.71neuroligin-4, X-linked [Source:NCBI gene;Acc:10302... [more]
nlgn2b3.587e-4725.00neuroligin 2b [Source:ZFIN;Acc:ZDB-GENE-090918-3][more]
nlgn4xa4.651e-4724.87neuroligin-4, X-linked [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002735.13.980e-3033.88pep scaffold:Pmarinus_7.0:GL485913:3796:8263:-1 ge... [more]
ENSPMAT00000007813.14.656e-2330.32pep scaffold:Pmarinus_7.0:GL477731:150595:158527:1... [more]
tg6.885e-1741.82thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
ENSPMAT00000007921.16.836e-920.71pep scaffold:Pmarinus_7.0:GL476391:291925:322499:1... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuroligin 4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353724.614e-4327.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470821.229e-4025.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363463.158e-3125.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259691.154e-3041.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469922.388e-2722.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuroligin 4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020295.21.122e-4825.86neuroligin-4, X-linked [Source:NCBI gene;Acc:10116... [more]
nlgn29.804e-4825.55neuroligin 2b [Source:NCBI gene;Acc:100529174][more]
nlgn21.047e-4725.55neuroligin 2b [Source:NCBI gene;Acc:100529174][more]
nlgn2a3.240e-4625.47neuroligin 2 [Source:NCBI gene;Acc:100529173][more]
nlgn2a3.492e-4625.47neuroligin 2 [Source:NCBI gene;Acc:100529173][more]
back to top
BLAST of Neuroligin 4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077711.10.000e+099.56SMESG000077711.1[more]
SMESG000077713.12.975e-15599.53SMESG000077713.1[more]
SMESG000042617.14.817e-7941.95SMESG000042617.1[more]
SMESG000042617.14.976e-7941.95SMESG000042617.1[more]
SMESG000005630.18.636e-2130.57SMESG000005630.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027655 ID=SMED30027655|Name=Neuroligin 4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2103bp
TATCCAATTATTTTAGATGAAGATAAAATAATAAAAGGAATTGATATACA
TTTTTCGAAATACAACTTGAGCATGATTAGAGCCTATTATGGGATTCGAT
ACGCTTCTGTTGGTAAATTAAAACCCGGAACTGCGCCTGAATATCGGTTT
CAACAATCTGTGGCTTCATTTTATTATGAGGACTTTTCCGGAACTCGTCA
ACTTGAGGATTTTAAACCGGTTTGTCCACAAAACTTGGTTAACTTTTCAC
ATTTCGATTACAACACTCTCAACTCGTATTGGATGCATGTGAAAATGATT
CAACCTTTTCTCAAAGATCAAAATGAAGAATGCTTGACTTTGAATATTTA
TGTTCCTAAAAAAAATTATCACACTCAAAATCAATTTGCAGTTTTAATAT
TTGTCCATGGAGAAGATTTTCGTACTGGAACTGGCAATGCTTATGATATG
AGTGTACTGAGCAGTTATGGTGACATCATTTGCGTTACTATAAATTACAG
GCTGGGAATACTGGGATTTCTAAATATGGCTAATGGAGATATTGATGGGA
ATTTTGCGTTGTACGATTTATTTGCTGCTATTCTCTGGGTAAAAGGCCAT
ATTAAACATTTCAACGGAGATCCGGAAAATATAAGTTTAATGGGCTACGG
AGACGGAGCAGTTTTCATACATTTCTTTACGAAATCAAAACTTTTTCAAA
ATAAAAACTTAATCTCAATAAGAAGATTGATCTTACTGAACGGAATTGGA
TTGCCATTTTTCAATAATCATCCCAGCTCATCTTTCGACGAAGAAATTCT
CAAATTGTTTAATCAAACTCGAAAGTCATTACTTAGCTATTTAAAATCCA
CAAATTCCTCAGAAATTCTTGCTGCCCAACAAAAATTGAAATCCAATAAA
TTAATTGACAAACTGGCACCGATGTTTTCAAGTCAACTTTTCAATTTCAA
TGAACAAAAAATGACAAACGACAACAAACTTTTAGACATTGACTTATGGG
TCGGCGTCATGAGAAACAATGCCGGGAAATATTTCAATAAAGTTGAAACA
ATGACAAAATCAGAAATGACTGAAGAACAATTTCGTGTGTTGCTAAAGAA
TTCTGTCGAAGAACTTCAGCTTTGCGATTCAAAGATTTTAAGTGGAATAG
TTGAGCATTTCTACACAAACTGGTCAGTTGATAGCATGACCTCGTCACAA
TACGCTCAATCTGATATGCGGATCACTAATTTTAACAAACTTCTCAATGA
TGCATTTTTTATTGCTCCGGCTATCAAAATGGTAAATGATCATTCTCGGT
TACAAAACCGTCAGTCAACTTTCTTTCATTTTTTCGACATTCCACCAATT
CAAGCCAACAATCTATTAGTTTCAGAAGCTGATTTCTTGGATGATTTGGC
TTTATTTTTTGGAGCTCCACTAGCATATCCTGAAAATCTTGATCCATTCA
ACAAAAAGGATGCAAATTCTTTACTCAATATATCAATGCTCATGATGAGC
CAGTTATCAGCTTTTATCAAGTCTGGCAATCCAAATTTCGTTGAAAAAGC
TGCGAGTCAACTGAAAAGGTTTTCGTGGCCCAATTATTCTCATTCTACAA
AGCACTTTGTACATTATCATTCACAAAGAACTATTCCAAAAGTCTCGATA
TCCTCCAATCTCATGCCTGATATAGCTCAGTTTTGGAATGAATTCATTCC
TCATACGTGTTTAAGTTTCAAATCATCAAACATTACTCAACCCGTTCCGA
AAGATCCTCCGATCAAGCTTGTTATTCGATACATTGATGTACCGAATGAA
CATAGTTTAACCACTTACAGTTCTGGTGAAATAAAACAGTTTTCAGAATC
TTCAACCATTCCAAGAGACTTTTCCGACAAATTTATTCTGATACTAACAA
TTATTATCGGTAGTTCTTTACTGATTTTAAATGTTTTGATATTCCTTGGA
ATATTCTATCAAGCAAGAAAGATTCGAACAATGAATCTCAACATTAGCCG
ACAAAAGTCACAGAATGCCATTGGAGATATTCAGAGAAACATTTTTGTGA
ACAACAATCATGTTGCTTTTGGCCACCAAGAGTCTATTCCTTTATCAATC
AAA
back to top

protein sequence of SMED30027655-orf-1

>SMED30027655-orf-1 ID=SMED30027655-orf-1|Name=SMED30027655-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=701bp
YPIILDEDKIIKGIDIHFSKYNLSMIRAYYGIRYASVGKLKPGTAPEYRF
QQSVASFYYEDFSGTRQLEDFKPVCPQNLVNFSHFDYNTLNSYWMHVKMI
QPFLKDQNEECLTLNIYVPKKNYHTQNQFAVLIFVHGEDFRTGTGNAYDM
SVLSSYGDIICVTINYRLGILGFLNMANGDIDGNFALYDLFAAILWVKGH
IKHFNGDPENISLMGYGDGAVFIHFFTKSKLFQNKNLISIRRLILLNGIG
LPFFNNHPSSSFDEEILKLFNQTRKSLLSYLKSTNSSEILAAQQKLKSNK
LIDKLAPMFSSQLFNFNEQKMTNDNKLLDIDLWVGVMRNNAGKYFNKVET
MTKSEMTEEQFRVLLKNSVEELQLCDSKILSGIVEHFYTNWSVDSMTSSQ
YAQSDMRITNFNKLLNDAFFIAPAIKMVNDHSRLQNRQSTFFHFFDIPPI
QANNLLVSEADFLDDLALFFGAPLAYPENLDPFNKKDANSLLNISMLMMS
QLSAFIKSGNPNFVEKAASQLKRFSWPNYSHSTKHFVHYHSQRTIPKVSI
SSNLMPDIAQFWNEFIPHTCLSFKSSNITQPVPKDPPIKLVIRYIDVPNE
HSLTTYSSGEIKQFSESSTIPRDFSDKFILILTIIIGSSLLILNVLIFLG
IFYQARKIRTMNLNISRQKSQNAIGDIQRNIFVNNNHVAFGHQESIPLSI
K
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR002018CarbesteraseB
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 7..574
e-value: 2.4E-90
score: 305.9
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 25..568
IPR002018Carboxylesterase, type BPFAMPF00135COesterasecoord: 11..544
e-value: 3.8E-79
score: 266.9
NoneNo IPR availablePANTHERPTHR43903FAMILY NOT NAMEDcoord: 13..671
NoneNo IPR availableTMHMMTMhelixcoord: 630..652