SMED30027652

Overview
NameSMED30027652
Smed IDSMED30027652
Length (bp)1606
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027652 (SMED30027652) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027652 (SMED30027652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027652 (SMED30027652) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027652 (SMED30027652) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027652SMESG000009812.1 SmedASXL_015814SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027652SMESG000009812.1 SmedASXL_015814SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30027652SMESG000009812.1 dd_Smed_v4_7797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027652SMESG000009812.1 SMED_07865_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027652SMESG000009812.1 SMED_07865_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027652SMESG000009812.1 SMED_24660_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027652SMESG000009812.1 SMED_24660_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027652SMESG000009812.1 SmWIOct06_014582GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027652SMESG000009812.1 SmWIOct06_021681GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027652 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003740:57930..60116 +7760
Homology
BLAST of SMED30027652 vs. Ensembl Human
Match: DDX55 (DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:20085])

HSP 1 Score: 314.309 bits (804), Expect = 1.869e-99
Identity = 157/348 (45.11%), Postives = 230/348 (66.09%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     ++S ++L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVR+SVK K G  +      P  + NYYM+ + + K + LV FL + K +K L+F +TC  V+YY   L +L++    +  H K+K KR KIF  F++++SG+++CTDVMARGIDIP++NWV+Q+DPP +A+ FVHRCGRTAR    G  L+ L   E++Y++FL  NQ   ++E K   +   +     +++ + +ADR ++EK + +F++YV  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   DV+  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSVKEK-GVAASSAQKTPSRLENYYMVCKADEKFNQLVHFLRNHKQEKHLVFFSTCACVEYYGKALEVLVKGVKIMCIHGKMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEESYINFLAINQKCPLQEMKPQRNTADLLP---KLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDK 489          
BLAST of SMED30027652 vs. Ensembl Human
Match: DDX55 (DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:20085])

HSP 1 Score: 239.965 bits (611), Expect = 1.638e-71
Identity = 136/348 (39.08%), Postives = 200/348 (57.47%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     ++S ++L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVR+SVK K G  +      P  + NYYM+ + + K + LV FL + K +K L+F +TC  V+YY   L +L++    +  H K+K KR KIF  F++++S                                FVHRCGRTAR    G  L+ L   E++Y++FL  NQ   ++E K   +   +     +++ + +ADR ++EK + +F++YV  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   DV+  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSVKEK-GVAASSAQKTPSRLENYYMVCKADEKFNQLVHFLRNHKQEKHLVFFSTCACVEYYGKALEVLVKGVKIMCIHGKMKYKRNKIFMEFRKLQSA-------------------------------FVHRCGRTARIGHGGSALVFLLPMEESYINFLAINQKCPLQEMKPQRNTADLLP---KLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDK 458          
BLAST of SMED30027652 vs. Ensembl Human
Match: DDX18 (DEAD-box helicase 18 [Source:HGNC Symbol;Acc:HGNC:2741])

HSP 1 Score: 191.045 bits (484), Expect = 1.393e-52
Identity = 109/311 (35.05%), Postives = 183/311 (58.84%), Query Frame = -1
Query:  518 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRN-PVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARC-EQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL 1441
            K+ + L++DEADR+L++GFE++L  IIK LP +R T LFSATQT +VE+L R  L+  P+ + V      + D  +     +   Y++   E +  +L  FL+  + KK+++F ++C SV Y+  +L+ +      LA H K K  +       F    SG +LCTDV ARG+DIP+++W+VQ+DPP     ++HR GRTAR     G  LL+LR  E  ++ +L++++ V + EF   F   +I   +++++ L   +  L++ +  ++ +Y+  Y  H LK IF ++NLN+ ++A SFG  ++P   +L
Sbjct:  325 KNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYVGV------DDDKANATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKYHYELLNYI--DLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSK-VPLSEF--DFSWSKISDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFG-FKVPPFVDL 623          
BLAST of SMED30027652 vs. Ensembl Human
Match: DDX10 (DEAD-box helicase 10 [Source:HGNC Symbol;Acc:HGNC:2735])

HSP 1 Score: 179.874 bits (455), Expect = 1.842e-48
Identity = 112/318 (35.22%), Postives = 174/318 (54.72%), Query Frame = -1
Query:  527 DEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNP--VRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXX-KLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1471
            DE V F  +    ++L+LDEADR+L+MGF D +  +I++LPK+R T LFSATQT  V++L R  L+NP  V +  K K+   + L  N        Y++ E + KI +L  FL     KK ++F ++C  V Y   +   L      LA H + +  R       F   ++ V+  TD+ ARG+D P +NWV+QFD P+ A  ++HR GRTAR ++ GE LL+L  SE   V  L + + V +KE K   + E++   + +++ +   D+ L E++   F++YV        K +F +S L I + A S GL   P++
Sbjct:  206 DETVSFHAT--DLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHEKAKYSTPATLEQN--------YIVCELQQKISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILLPSEKAMVQQLLQ-KKVPVKEIK--INPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRV 510          
BLAST of SMED30027652 vs. Ensembl Human
Match: DDX10 (DEAD-box helicase 10 [Source:HGNC Symbol;Acc:HGNC:2735])

HSP 1 Score: 179.874 bits (455), Expect = 5.646e-48
Identity = 112/318 (35.22%), Postives = 174/318 (54.72%), Query Frame = -1
Query:  527 DEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNP--VRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXX-KLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1471
            DE V F  +    ++L+LDEADR+L+MGF D +  +I++LPK+R T LFSATQT  V++L R  L+NP  V +  K K+   + L  N        Y++ E + KI +L  FL     KK ++F ++C  V Y   +   L      LA H + +  R       F   ++ V+  TD+ ARG+D P +NWV+QFD P+ A  ++HR GRTAR ++ GE LL+L  SE   V  L + + V +KE K   + E++   + +++ +   D+ L E++   F++YV        K +F +S L I + A S GL   P++
Sbjct:  206 DETVSFHAT--DLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHEKAKYSTPATLEQN--------YIVCELQQKISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILLPSEKAMVQQLLQ-KKVPVKEIK--INPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRV 510          
BLAST of SMED30027652 vs. Ensembl Celegans
Match: ZK512.2 (Probable ATP-dependent RNA helicase DDX55 homolog [Source:UniProtKB/Swiss-Prot;Acc:P34640])

HSP 1 Score: 242.276 bits (617), Expect = 2.642e-73
Identity = 132/342 (38.60%), Postives = 200/342 (58.48%), Query Frame = -1
Query:  452 EKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXX-XXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK-ASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL-KGVDLSDFHKRDVDLKTLIYKD 1468
            EK    + +++ ++L++DEADR  E+ FED +  I+  +PKQR T LFSATQ  E ++L+  GLRN  ++ V        + N   P  + NYY+    + K  + ++F+  + DKKILIF  +C+SV Y+  I    L KR   A H K     R    K F +  +GVM+ TDVMARGIDI DI+WV+QFD P+ ++ FVHR GRTARC + G  L+L+ S +  YV+FL  ++ V++ E K  + +  + E    +M  + ++DR + E    +F+++V  Y KHD   I  L +LN+  LANS+ LLR+P+M EL +  DL  F +  ++   + Y D
Sbjct:   83 EKTLIARKMRTLQLLVIDEADRFNEIQFEDHMREILSCIPKQRRTGLFSATQVKEEDDLMVFGLRNAKQVKV------AQERNSAAPSTLKNYYVECRADEKTSVCLEFIRQRTDKKILIFFPSCNSVRYFYKIFERCLGKRPLFAVHGKCSNPHRASQIKAFSDSTNGVMISTDVMARGIDISDIDWVIQFDLPKHSSWFVHRAGRTARCGREGNALILIASEQLAYVNFLDNHEKVKLDEIKVPTNNSRKSEELRQKMIKIQVSDRAILEAGTRAFVSHVESYAKHDCHLICSLDDLNVVGLANSYALLRLPKMRELSQRKDLDMFDRSAIETSEIKYAD 418          
BLAST of SMED30027652 vs. Ensembl Celegans
Match: ZK512.2 (Probable ATP-dependent RNA helicase DDX55 homolog [Source:UniProtKB/Swiss-Prot;Acc:P34640])

HSP 1 Score: 241.891 bits (616), Expect = 1.387e-72
Identity = 132/342 (38.60%), Postives = 200/342 (58.48%), Query Frame = -1
Query:  452 EKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXX-XXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK-ASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL-KGVDLSDFHKRDVDLKTLIYKD 1468
            EK    + +++ ++L++DEADR  E+ FED +  I+  +PKQR T LFSATQ  E ++L+  GLRN  ++ V        + N   P  + NYY+    + K  + ++F+  + DKKILIF  +C+SV Y+  I    L KR   A H K     R    K F +  +GVM+ TDVMARGIDI DI+WV+QFD P+ ++ FVHR GRTARC + G  L+L+ S +  YV+FL  ++ V++ E K  + +  + E    +M  + ++DR + E    +F+++V  Y KHD   I  L +LN+  LANS+ LLR+P+M EL +  DL  F +  ++   + Y D
Sbjct:  149 EKTLIARKMRTLQLLVIDEADRFNEIQFEDHMREILSCIPKQRRTGLFSATQVKEEDDLMVFGLRNAKQVKV------AQERNSAAPSTLKNYYVECRADEKTSVCLEFIRQRTDKKILIFFPSCNSVRYFYKIFERCLGKRPLFAVHGKCSNPHRASQIKAFSDSTNGVMISTDVMARGIDISDIDWVIQFDLPKHSSWFVHRAGRTARCGREGNALILIASEQLAYVNFLDNHEKVKLDEIKVPTNNSRKSEELRQKMIKIQVSDRAILEAGTRAFVSHVESYAKHDCHLICSLDDLNVVGLANSYALLRLPKMRELSQRKDLDMFDRSAIETSEIKYAD 484          
BLAST of SMED30027652 vs. Ensembl Celegans
Match: B0511.6 (RNA helicase [Source:UniProtKB/TrEMBL;Acc:O61815])

HSP 1 Score: 172.94 bits (437), Expect = 3.018e-47
Identity = 103/329 (31.31%), Postives = 198/329 (60.18%), Query Frame = -1
Query:  467 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLR-NPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTAR-CEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKT 1444
            +++ + LI+DEADR+L++GFE ++  +++ LPKQR + LFSAT + +V+ L++  L  NPVR+SV  K  EE+ +     + +   Y++   + ++ +L  FL+  K KK+++F ++C+SV ++  +L+ +      ++ H K K ++       F + ++G++LCTDV ARG+DIP ++W+VQ+DP      ++HR GRTAR     G+ LL+LR  E  ++ +L+  + V + EF+  F   ++ + ++++++L   +  L + +  ++  Y+  Y  H LK IF ++N+++  ++ SFG   +P       VDL   +K  V++++
Sbjct:  213 VRNMKCLIIDEADRILDIGFEIEMQQVLRHLPKQRQSMLFSATHSPKVDELVKLALHSNPVRVSVHEK-AEEATV-----EGLQQGYIVAPSDKRLLLLFTFLKKNKTKKVMVFFSSCNSVKFHHELLNYI--DIPCMSIHGKQKQQKRTTTFFQFCQAETGILLCTDVAARGLDIPAVDWIVQYDPTDEPREYIHRVGRTARGTNGSGKALLVLRPEELGFLRYLKAAK-VTLNEFE--FSWSKVANIQSQLENLISKNYYLNKSAKEAYKCYLRAYDSHSLKDIFDVTNMDLTAVSKSFG-FSVPPF-----VDLPISNKPKVEIRS 524          
BLAST of SMED30027652 vs. Ensembl Celegans
Match: Y23H5B.6 (RNA helicase [Source:UniProtKB/TrEMBL;Acc:A0A061ACL9])

HSP 1 Score: 171.4 bits (433), Expect = 1.135e-45
Identity = 100/308 (32.47%), Postives = 171/308 (55.52%), Query Frame = -1
Query:  527 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLA-FHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1447
            S  S ++L+LDEADR+L+MGF  QL +II +LP +R T LFSATQT  V++L R    +PV +SV        + +   P N+   Y++VE+E+KI+ L  F+E  + KK L+F+++C    +     S L      +  +    + KR + F  F E K+ V++ TDV +RG+D   I+WV+Q D P    +++HR GR+AR +  G +LL++  S++  +    E  ++ ++E K   D   +     +++ +    + L E +  S +AY+        K +F +  ++   LA+SFGL+ +P++
Sbjct:  219 SCDSLQVLVLDEADRMLDMGFSKQLNSIINNLPAERQTLLFSATQTRNVKDLCRVCTNDPVFVSV------HENASAATPDNLKQSYVIVEEEHKINALWSFIEAHRKKKSLVFVSSCKQARFLTEAFSQLRPGLPVMGLWGTMNQKKRIETFTKFDESKAAVLIATDVASRGLDFEHIDWVIQVDCPAQIDDYIHRVGRSARMDDSGNSLLMVSPSQEEAMIGKLEKHSIPIEELKIHPDA--MSDVRVKLRAILAESQELKEYAQKSIVAYLRSIYTMKDKKVFDVEAIDAAALADSFGLVSVPRV 518          
BLAST of SMED30027652 vs. Ensembl Celegans
Match: T26G10.1 (Putative ATP-dependent RNA helicase T26G10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34580])

HSP 1 Score: 128.257 bits (321), Expect = 1.020e-31
Identity = 74/207 (35.75%), Postives = 115/207 (55.56%), Query Frame = -1
Query:  827 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFG 1447
            +LK+ + LI+DEADR+L M FE +L  I+K +P++R T LFSAT T +V  L RA LR+P R+SV  ++            N+  +Y+ V  + K   LV  L +      ++F ATC +      +L  L  + + L      + +   + K FK     +++CTDV ARG+DIP ++ V+ +D P  + ++VHR GRTAR  + G
Sbjct:  184 NLKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLERASLRDPARVSVSSRY--------KTVDNLKQHYIFVPNKYKETYLVYLLNEHAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNK-FKSKAREILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSG 381          
BLAST of SMED30027652 vs. Ensembl Fly
Match: CG9630 (gene:FBgn0037561 transcript:FBtr0081866)

HSP 1 Score: 279.641 bits (714), Expect = 1.842e-86
Identity = 149/357 (41.74%), Postives = 221/357 (61.90%), Query Frame = -1
Query:  452 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKD--KKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEF------KASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKR--DVDLKTLIYKD 1492
            E   ++  + +     +KS E L+LDEADRLL++GF+  +  I+  LP+QR T LFSATQTTEV +LIRAGLRNPV +SVK K       + N P  + N+Y +VE E K   L++FL        K+++F  TC  V+Y+   L  LL KR  L  H K+K+KR  + + F+     V+LCTDV+ARG+D+P+I WVVQ+DPP +A++FVHR GRTAR    G  L+ L  SED YVHFL+ NQ VE+ +        A  + +++ +   ++  L  AD+ +Y+K + +F+++V  Y KH+   I +L +L++GK+A ++GLL++P+M ELK      +     +VDL  L YK+
Sbjct:  148 EDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSATQTTEVTDLIRAGLRNPVLVSVKEKA------SVNTPARLQNFYRIVEPELKFVALLEFLSSPATVIGKVMVFFPTCACVEYWAEALPPLLPKRTVLGIHGKMKNKRANVVEKFRNTPQAVLLCTDVLARGLDVPEIEWVVQWDPPSTASSFVHRVGRTARQGNEGNALVFLLPSEDAYVHFLKINQKVELTKLLTEEAEDADREKKKLPAVLDQLHRLQAADKGVYDKGMRAFVSHVRAYTKHECSAILRLKDLDLGKMATAYGLLQLPRMPELKNYQGGGYVAPAFEVDLSKLTYKN 498          
BLAST of SMED30027652 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0084174)

HSP 1 Score: 188.348 bits (477), Expect = 7.693e-52
Identity = 109/311 (35.05%), Postives = 180/311 (57.88%), Query Frame = -1
Query:  515 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQF-GETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELK 1441
            K+ + LI+DE DR+LE+GFE++L  II  LPK+R T LFSATQT  +E L +  L++   I V V   +++   D L +     Y++   E ++ +L  FL+  + KK+++F ++C SV Y+  + + +       + H K K  +       F   +SG++LCTDV ARG+DIP ++W+VQ+DPP     ++HR GRTAR     G  LLL+R  E  ++ +L+  + V + EF+  F  ++I   + +++ L   +  L + +  +F +YV  Y  H LK IF ++ L++  +A SFG L +P + +LK
Sbjct:  333 KNLQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEP-IYVGVHDNQDTATVDGLEQG----YIVCPSEKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYI--DLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAK-VPLNEFE--FSWQKIADIQLQLEKLIAKNYFLNQSAKEAFKSYVRAYDSHQLKQIFNVNTLDLQAVAKSFGFL-VPPVVDLK 632          
BLAST of SMED30027652 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0346345)

HSP 1 Score: 188.348 bits (477), Expect = 7.693e-52
Identity = 109/311 (35.05%), Postives = 180/311 (57.88%), Query Frame = -1
Query:  515 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQF-GETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELK 1441
            K+ + LI+DE DR+LE+GFE++L  II  LPK+R T LFSATQT  +E L +  L++   I V V   +++   D L +     Y++   E ++ +L  FL+  + KK+++F ++C SV Y+  + + +       + H K K  +       F   +SG++LCTDV ARG+DIP ++W+VQ+DPP     ++HR GRTAR     G  LLL+R  E  ++ +L+  + V + EF+  F  ++I   + +++ L   +  L + +  +F +YV  Y  H LK IF ++ L++  +A SFG L +P + +LK
Sbjct:  333 KNLQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEP-IYVGVHDNQDTATVDGLEQG----YIVCPSEKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYI--DLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAK-VPLNEFE--FSWQKIADIQLQLEKLIAKNYFLNQSAKEAFKSYVRAYDSHQLKQIFNVNTLDLQAVAKSFGFL-VPPVVDLK 632          
BLAST of SMED30027652 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0084175)

HSP 1 Score: 188.348 bits (477), Expect = 7.693e-52
Identity = 109/311 (35.05%), Postives = 180/311 (57.88%), Query Frame = -1
Query:  515 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQF-GETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELK 1441
            K+ + LI+DE DR+LE+GFE++L  II  LPK+R T LFSATQT  +E L +  L++   I V V   +++   D L +     Y++   E ++ +L  FL+  + KK+++F ++C SV Y+  + + +       + H K K  +       F   +SG++LCTDV ARG+DIP ++W+VQ+DPP     ++HR GRTAR     G  LLL+R  E  ++ +L+  + V + EF+  F  ++I   + +++ L   +  L + +  +F +YV  Y  H LK IF ++ L++  +A SFG L +P + +LK
Sbjct:  333 KNLQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEP-IYVGVHDNQDTATVDGLEQG----YIVCPSEKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYI--DLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAK-VPLNEFE--FSWQKIADIQLQLEKLIAKNYFLNQSAKEAFKSYVRAYDSHQLKQIFNVNTLDLQAVAKSFGFL-VPPVVDLK 632          
BLAST of SMED30027652 vs. Ensembl Fly
Match: CG5800 (gene:FBgn0030855 transcript:FBtr0074453)

HSP 1 Score: 154.066 bits (388), Expect = 1.769e-39
Identity = 102/319 (31.97%), Postives = 166/319 (52.04%), Query Frame = -1
Query:  527 EILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDN----------LPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTY-VHFLRENQNVEMK----EFKASFDIE-QIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1432
            E+L+LDEADR L+MGF+  L +II++ P  R T LFSATQT  V++L R  L++PV +        E                +P+ +   Y+++  E+KI +L  F+++   +KI++F+A+C    Y   I   L      LA +  +   R       F      VM  TDV +RG+D P +NWVVQ D P+  + ++HR GR+AR +  GE LL+L  SE+ Y +  L+E  N++++    + K  F    +IE++  +  +L    R   +++  S+I  V   R    K +F + +L++   A S GL   P++
Sbjct:  220 EMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEYMISALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLAQFPEL----RATAQRAFLSYIKSVFLMRN---KRLFNVFSLDLDAFAQSLGLAVTPRV 531          
BLAST of SMED30027652 vs. Ensembl Zebrafish
Match: ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:NCBI gene;Acc:286745])

HSP 1 Score: 307.76 bits (787), Expect = 2.969e-97
Identity = 154/349 (44.13%), Postives = 226/349 (64.76%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +    ++KS ++L+LDEADRLL+MGFE  L TI+  LPKQR T LFSATQT E+E L+RAGLRNPVRI+VK K    S +    P  ++NYY +   E K + LV FL   K +K L+F +TC  V+Y+   L +L++       H K+K KR KIF  F+ +KSG+++CTDVMARGIDIP++NWV+Q+DPP SA++FVHRCGRTAR    G  L+ L   E++YV+FL  NQ   ++ F +  D+  +     +++ + + DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  F L+R+P+M EL+G    DF    +D  T+ +KDK+
Sbjct:  146 EDMFRRKADGLDLATAVKSLDVLVLDEADRLLDMGFEASLNTILGYLPKQRRTGLFSATQTQELEKLVRAGLRNPVRITVKEKGVAASSVQKT-PAKLSNYYTMCRAEEKFNTLVAFLRQHKHEKQLVFFSTCACVEYFGKALEVLVKNVSIHCIHGKMKHKRNKIFADFRALKSGILVCTDVMARGIDIPEVNWVLQYDPPSSASSFVHRCGRTARIGNQGNALVFLLPMEESYVNFLSINQKCPLQSFSSVKDVVDVLP---KLKAMALGDRAMFEKGMRAFVSYVQAYAKHECSLIFRIKDLDFAALARGFALVRLPKMPELRGKTFPDFKAEAIDTDTIRFKDKN 490          
BLAST of SMED30027652 vs. Ensembl Zebrafish
Match: ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:ZFIN;Acc:ZDB-GENE-030131-9685])

HSP 1 Score: 192.2 bits (487), Expect = 2.824e-53
Identity = 119/342 (34.80%), Postives = 194/342 (56.73%), Query Frame = -1
Query:  443 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLR-NPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARC-EQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL-----KGVDLSDFHKRDVDLKTLIYKDKSV 1444
             K+ + LI+DEADR+LE+GFE++L  IIK LPK+R + LFSATQT +VE+L R  L+  P+ + V      + + +    + +   Y++   E +  +L  FL+  + KK+++F ++C SV ++  +L+ +      +A H K K  +       F    SG++LCTDV ARG+DIP+++W+VQFDPP     ++HR GRTAR     G  LL+LR  E  ++ FL++ + V + EF+  F   +I   ++++  L   +  L++ +  ++ +YV  Y  H LK I+ +  L++ K+A SFG  ++P   +L     KGV L   HKR         K K+V
Sbjct:  306 FKNLQCLIIDEADRILEVGFEEELKQIIKLLPKKRQSMLFSATQTRKVEDLARISLKKEPLYVGV------DDNKDTATVEGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKFHYELLNYI--DLPVMAIHGKQKQTKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQFDPPDDPKEYIHRVGRTARGINGRGHALLILRPEELGFLRFLKQAK-VPLSEFE--FSWTKISDIQSQLDKLIEKNYYLHKSAQEAYKSYVRAYDSHSLKQIYNVETLDLPKVAMSFG-FKVPPFVDLNVHSSKGVKL---HKRGGGGGFGYQKSKNV 632          
BLAST of SMED30027652 vs. Ensembl Zebrafish
Match: ddx10 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-071022-2])

HSP 1 Score: 165.236 bits (417), Expect = 4.252e-43
Identity = 101/302 (33.44%), Postives = 162/302 (53.64%), Query Frame = -1
Query:  527 ILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1429
            +L+LDEADR+L+MGF D L  I+++LPK R T LFSATQT  V++L R  L++P  + V     E++  +   P  +   Y++ E   K+++L  FL     KKI++F A C  V Y   I   L      LA H K +  +       F    S V+  TD+ ARG+D P +NWV+QFD P+ A  ++HR GRTAR ++ GE LL+L  SE+  +    + + V +   K   + E++ S + +++     ++   E++   F++Y+        K +F +  L + + A S GL   P++
Sbjct:  219 MLVLDEADRILDMGFADTLNAIVENLPKSRQTLLFSATQTRSVKDLARLSLKDPEYVWVH----EQAKFS--TPATLEQNYVVCELHQKVNMLYSFLRSHLQKKIIVFFACCKEVQYLFRIFCRLRPGISVLALHGKQQQMKRVEVYNDFVRKTSAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRVGRTARYKEGGEALLVLLPSEEKGMISQLQEKKVPIN--KIQVNPEKLMSVQQKLEAFLAQEKEQKERAQRCFVSYLRSVYLMKNKDVFDVLQLKLPEYAMSLGLAVAPRV 512          
BLAST of SMED30027652 vs. Ensembl Zebrafish
Match: ddx31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Source:ZFIN;Acc:ZDB-GENE-030131-3973])

HSP 1 Score: 137.887 bits (346), Expect = 5.895e-34
Identity = 105/363 (28.93%), Postives = 179/363 (49.31%), Query Frame = -1
Query:  530 LILDEADRLLEMGFEDQLMTIIKSL---PKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEE-----------SDLNDN--LPKNMTNYYMLVEKENKIDILVKFLEDK----KDKKILIFMATCDSVDYYKSILSMLL---------RKRIFLAFHXXXXXXXXXXXK----LFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK-----------------ASFDIEQ-IESYETRMQDLCIADRLLYEKSVNSF--------IAYVMFYRKH-----DLKYIFKLSNLNIGKLANSFGLLRIPQ 1426
            LILDEADR+L++GFE  L  I+ +L      R   L SAT T  +  L    +++PV  SV V  G E             L+D+  +P+ +  + ++V  +  +  L  F+  K    + +K++IF+++C++V++  ++ + +L         +    L F++   + R++        F + K+G++LCTDV ARG+D+P + W+VQ++PP SA  +VHR GRTAR    G +LL L  SE  +V  L  N N+ + E K                   +D ++  +++E  +++     +  +E  V++          A   F R +      LK+IF +  L++G  A SFGL   PQ
Sbjct:  309 LILDEADRILDLGFEKDLTVILNALNAAGPDRQNVLLSATITEGLSRLASISMKDPV--SVHVSEGSEETVEACPQAAPQALSDSYAVPERLQQHVVVVPSKLHLVCLAAFILAKCKFEQRQKLIIFISSCEAVEFLLNLFTAVLCEIPSNTSSKSTSCLNFYRLHGNMRQEERTEVFQEFSQCKTGILLCTDVAARGLDLPQVTWIVQYNPPVSAAEYVHRVGRTARIGAQGSSLLFLTPSETAFVDVL-ANHNISLSEMKMVDILSTLMKDERFKGRGKWDSKRSADAFEQEVRERATLLQTDFENYVHASNESLQTAKSALQCFLRAYTTYPSSLKHIFHIRMLHLGHAAKSFGLRDAPQ 668          
BLAST of SMED30027652 vs. Ensembl Zebrafish
Match: CR381654.1 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Source:NCBI gene;Acc:325248])

HSP 1 Score: 137.502 bits (345), Expect = 7.088e-34
Identity = 105/363 (28.93%), Postives = 179/363 (49.31%), Query Frame = -1
Query:  530 LILDEADRLLEMGFEDQLMTIIKSL---PKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEE-----------SDLNDN--LPKNMTNYYMLVEKENKIDILVKFLEDK----KDKKILIFMATCDSVDYYKSILSMLL---------RKRIFLAFHXXXXXXXXXXXK----LFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK-----------------ASFDIEQ-IESYETRMQDLCIADRLLYEKSVNSF--------IAYVMFYRKH-----DLKYIFKLSNLNIGKLANSFGLLRIPQ 1426
            LILDEADR+L++GFE  L  I+ +L      R   L SAT T  +  L    +++PV  SV V  G E             L+D+  +P+ +  + ++V  +  +  L  F+  K    + +K++IF+++C++V++  ++ + +L         +    L F++   + R++        F + K+G++LCTDV ARG+D+P + W+VQ++PP SA  +VHR GRTAR    G +LL L  SE  +V  L  N N+ + E K                   +D ++  +++E  +++     +  +E  V++          A   F R +      LK+IF +  L++G  A SFGL   PQ
Sbjct:  297 LILDEADRILDLGFEKDLTVILNALNTAGPDRQNVLLSATITEGLSRLASISMKDPV--SVHVSEGSEETVEACPQAAPQALSDSYAVPERLQQHVVVVPSKLHLVCLAAFILAKCKFEQRQKLVIFISSCEAVEFLLNLFTAVLCEIPSNTSSKSTSCLNFYRLHGNMRQEERTEVFQEFSQCKTGILLCTDVAARGLDLPQVTWIVQYNPPVSAAEYVHRVGRTARIGAQGSSLLFLTPSETAFVDVL-ANHNISLSEMKMVDILSTLMKDERFKGRGKWDSKRSADAFEQEVRERATLLQTDFENYVHASNESLQTAKSALQCFLRAYTTYPSSLKHIFHIRMLHLGHAAKSFGLRDAPQ 656          
BLAST of SMED30027652 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 313.923 bits (803), Expect = 6.219e-100
Identity = 160/352 (45.45%), Postives = 231/352 (65.62%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV---EMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +  +  +K+ ++LILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT E+ENL+RAGLRNPVRI+VK K G  +      P  + NYYM+ + + K + LV FL+ +K +K L+F +TC  V+YY   L  LL+    +  H K+K KR +IF  F+++ SG+++CTDVMARGIDIP++NWVVQ+DPP SA+ FVHRCGRTAR    G  L+ L   E++YV FL  NQ     EM E  ++ D+        +++ +  +DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M EL+G + SDF    +D  ++ YKDK+
Sbjct:  120 EDMFRRQADGLDLVSYVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQTQELENLVRAGLRNPVRIAVKEK-GVAATCTQKTPIRLQNYYMICKADEKFNKLVAFLQQRKQEKHLVFFSTCACVEYYGKALEALLKNVKVMCIHGKMKHKRNRIFTEFRKLNSGILVCTDVMARGIDIPEVNWVVQYDPPSSASAFVHRCGRTARIGHHGSALVFLLPMEESYVSFLSINQKCPLQEMTELISAVDL------LPKLKSMAESDRAVFEKGMKAFVSYVQAYAKHECNLIFRVKDLDFSNLARGFGLLRMPRMPELRGKNFSDFVSTTIDTDSIPYKDKN 464          
BLAST of SMED30027652 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 314.694 bits (805), Expect = 6.918e-100
Identity = 160/352 (45.45%), Postives = 231/352 (65.62%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV---EMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +  +  +K+ ++LILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT E+ENL+RAGLRNPVRI+VK K G  +      P  + NYYM+ + + K + LV FL+ +K +K L+F +TC  V+YY   L  LL+    +  H K+K KR +IF  F+++ SG+++CTDVMARGIDIP++NWVVQ+DPP SA+ FVHRCGRTAR    G  L+ L   E++YV FL  NQ     EM E  ++ D+        +++ +  +DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M EL+G + SDF    +D  ++ YKDK+
Sbjct:  136 EDMFRRQADGLDLVSYVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQTQELENLVRAGLRNPVRIAVKEK-GVAATCTQKTPIRLQNYYMICKADEKFNKLVAFLQQRKQEKHLVFFSTCACVEYYGKALEALLKNVKVMCIHGKMKHKRNRIFTEFRKLNSGILVCTDVMARGIDIPEVNWVVQYDPPSSASAFVHRCGRTARIGHHGSALVFLLPMEESYVSFLSINQKCPLQEMTELISAVDL------LPKLKSMAESDRAVFEKGMKAFVSYVQAYAKHECNLIFRVKDLDFSNLARGFGLLRMPRMPELRGKNFSDFVSTTIDTDSIPYKDKN 480          
BLAST of SMED30027652 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 314.309 bits (804), Expect = 1.251e-99
Identity = 160/352 (45.45%), Postives = 231/352 (65.62%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV---EMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +  +  +K+ ++LILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT E+ENL+RAGLRNPVRI+VK K G  +      P  + NYYM+ + + K + LV FL+ +K +K L+F +TC  V+YY   L  LL+    +  H K+K KR +IF  F+++ SG+++CTDVMARGIDIP++NWVVQ+DPP SA+ FVHRCGRTAR    G  L+ L   E++YV FL  NQ     EM E  ++ D+        +++ +  +DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M EL+G + SDF    +D  ++ YKDK+
Sbjct:  149 EDMFRRQADGLDLVSYVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQTQELENLVRAGLRNPVRIAVKEK-GVAATCTQKTPIRLQNYYMICKADEKFNKLVAFLQQRKQEKHLVFFSTCACVEYYGKALEALLKNVKVMCIHGKMKHKRNRIFTEFRKLNSGILVCTDVMARGIDIPEVNWVVQYDPPSSASAFVHRCGRTARIGHHGSALVFLLPMEESYVSFLSINQKCPLQEMTELISAVDL------LPKLKSMAESDRAVFEKGMKAFVSYVQAYAKHECNLIFRVKDLDFSNLARGFGLLRMPRMPELRGKNFSDFVSTTIDTDSIPYKDKN 493          
BLAST of SMED30027652 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 314.309 bits (804), Expect = 1.299e-99
Identity = 160/352 (45.45%), Postives = 231/352 (65.62%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV---EMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +  +  +K+ ++LILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT E+ENL+RAGLRNPVRI+VK K G  +      P  + NYYM+ + + K + LV FL+ +K +K L+F +TC  V+YY   L  LL+    +  H K+K KR +IF  F+++ SG+++CTDVMARGIDIP++NWVVQ+DPP SA+ FVHRCGRTAR    G  L+ L   E++YV FL  NQ     EM E  ++ D+        +++ +  +DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M EL+G + SDF    +D  ++ YKDK+
Sbjct:  146 EDMFRRQADGLDLVSYVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQTQELENLVRAGLRNPVRIAVKEK-GVAATCTQKTPIRLQNYYMICKADEKFNKLVAFLQQRKQEKHLVFFSTCACVEYYGKALEALLKNVKVMCIHGKMKHKRNRIFTEFRKLNSGILVCTDVMARGIDIPEVNWVVQYDPPSSASAFVHRCGRTARIGHHGSALVFLLPMEESYVSFLSINQKCPLQEMTELISAVDL------LPKLKSMAESDRAVFEKGMKAFVSYVQAYAKHECNLIFRVKDLDFSNLARGFGLLRMPRMPELRGKNFSDFVSTTIDTDSIPYKDKN 490          
BLAST of SMED30027652 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 314.309 bits (804), Expect = 1.313e-99
Identity = 160/352 (45.45%), Postives = 231/352 (65.62%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV---EMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +  +  +K+ ++LILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT E+ENL+RAGLRNPVRI+VK K G  +      P  + NYYM+ + + K + LV FL+ +K +K L+F +TC  V+YY   L  LL+    +  H K+K KR +IF  F+++ SG+++CTDVMARGIDIP++NWVVQ+DPP SA+ FVHRCGRTAR    G  L+ L   E++YV FL  NQ     EM E  ++ D+        +++ +  +DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M EL+G + SDF    +D  ++ YKDK+
Sbjct:  146 EDMFRRQADGLDLVSYVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQTQELENLVRAGLRNPVRIAVKEK-GVAATCTQKTPIRLQNYYMICKADEKFNKLVAFLQQRKQEKHLVFFSTCACVEYYGKALEALLKNVKVMCIHGKMKHKRNRIFTEFRKLNSGILVCTDVMARGIDIPEVNWVVQYDPPSSASAFVHRCGRTARIGHHGSALVFLLPMEESYVSFLSINQKCPLQEMTELISAVDL------LPKLKSMAESDRAVFEKGMKAFVSYVQAYAKHECNLIFRVKDLDFSNLARGFGLLRMPRMPELRGKNFSDFVSTTIDTDSIPYKDKN 490          
BLAST of SMED30027652 vs. Ensembl Mouse
Match: Ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:MGI Symbol;Acc:MGI:1915098])

HSP 1 Score: 312.768 bits (800), Expect = 4.816e-99
Identity = 160/348 (45.98%), Postives = 229/348 (65.80%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     +KS ++L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVRISVK K G  +      P  + N+YM+ + + K + LV FL  ++ +K L+F +TC  V+YY   L  LL+K   L  H K+K KR KIF  F++++SG+++CTDVMARGIDIP++NWV+Q+DPP +A+ FVHRCGRTAR    G  L+ L   E+ Y++FL  NQ   ++E   S     I+    +++ + +ADR ++EK + +F+++V  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   D+D  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVKSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRISVKEK-GVAASSTQKTPSRLENHYMICKADEKFNQLVHFLRSRQQEKHLVFFSTCACVEYYGKALEALLKKVKILCIHGKMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEEAYINFLAINQKCPLQEM--SLQRNTIDLL-PKLRAMALADRAVFEKGMKAFVSFVQAYAKHECSLIFRLKDLDFAGLARGFALLRMPRMPELRGKQFPDFVPVDIDTDTIPFKDK 489          
BLAST of SMED30027652 vs. Ensembl Mouse
Match: Ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:MGI Symbol;Acc:MGI:1915098])

HSP 1 Score: 311.227 bits (796), Expect = 1.386e-98
Identity = 160/348 (45.98%), Postives = 229/348 (65.80%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     +KS ++L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVRISVK K G  +      P  + N+YM+ + + K + LV FL  ++ +K L+F +TC  V+YY   L  LL+K   L  H K+K KR KIF  F++++SG+++CTDVMARGIDIP++NWV+Q+DPP +A+ FVHRCGRTAR    G  L+ L   E+ Y++FL  NQ  EM   + + D+        +++ + +ADR ++EK + +F+++V  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   D+D  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVKSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRISVKEK-GVAASSTQKTPSRLENHYMICKADEKFNQLVHFLRSRQQEKHLVFFSTCACVEYYGKALEALLKKVKILCIHGKMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEEAYINFLAINQK-EMSLQRNTIDL------LPKLRAMALADRAVFEKGMKAFVSFVQAYAKHECSLIFRLKDLDFAGLARGFALLRMPRMPELRGKQFPDFVPVDIDTDTIPFKDK 485          
BLAST of SMED30027652 vs. Ensembl Mouse
Match: Ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:MGI Symbol;Acc:MGI:1914192])

HSP 1 Score: 189.889 bits (481), Expect = 2.190e-52
Identity = 109/310 (35.16%), Postives = 184/310 (59.35%), Query Frame = -1
Query:  518 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARC-EQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL 1441
            K+ + L++DEADR+L++GFE++L  IIK LP +R T LFSATQT +VE+L R  L+    + V V   +E    D L +     Y++   E +  +L  FL+  + KK+++F ++C SV Y+  +L+ +      LA H K K  +       F    SG++LCTDV ARG+DIP+++W+VQ+DPP     ++HR GRTAR     G  LL+LR  E  ++ +L++++ V + +F   F   ++   +++++ L   +  L++ +  ++ +Y+  Y  H LK IF ++NLN+ ++A SFG  ++P   +L
Sbjct:  315 KNLQCLVIDEADRILDVGFEEELKQIIKLLPARRQTMLFSATQTRKVEDLARISLKKEP-LYVGVDDDKEVATVDGLEQG----YVVCPSEKRFLLLFTFLKKNRKKKVMVFFSSCMSVKYHYELLNYI--DLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSK-VPLNQF--DFSWSKVSDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFG-FKVPPFVDL 613          
BLAST of SMED30027652 vs. Ensembl Mouse
Match: Ddx10 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 [Source:MGI Symbol;Acc:MGI:1924841])

HSP 1 Score: 173.326 bits (438), Expect = 8.184e-46
Identity = 105/305 (34.43%), Postives = 166/305 (54.43%), Query Frame = -1
Query:  527 EILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNP--VRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXX-KLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1432
            ++L+LDEADR+L+MGF D +  II++LPK+R T LFSATQT  V++L R  L++P  V +  K K+   + L  N        Y++ E   KI +L  FL     KK ++F ++C  V Y   +   L      LA H + +  R       F   ++ V+  TD+ ARG+D P +NWV+QFD P+ A  ++HR GRTAR ++ GE LL+L  SE+  +      + V +KE K   + E++   + +++     D+ L E++   F++Y+        K +F +S L I + A S GL   P++
Sbjct:  217 QMLVLDEADRILDMGFADTMNAIIENLPKKRQTLLFSATQTKSVKDLARLSLKDPEYVWVHEKAKYSTPATLEQN--------YIICELHQKISVLFSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGISILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILLPSEEQGMVQQLLQKKVPVKEIK--INPEKLIDVQKKLESFLAQDQDLKERAQRCFVSYIRSVYLMKDKEVFNVSKLPITEYALSLGLAVAPRI 511          
BLAST of SMED30027652 vs. Ensembl Mouse
Match: Ddx31 (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31 [Source:MGI Symbol;Acc:MGI:2682639])

HSP 1 Score: 139.428 bits (350), Expect = 1.215e-34
Identity = 107/380 (28.16%), Postives = 182/380 (47.89%), Query Frame = -1
Query:  485 LILDEADRLLEMGFEDQLMTIIKSLP---KQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESD--------LND-NLPKNMTNYYMLVEKENKIDILVKFLEDK----KDKKILIFMATCDSVDYYKSIL--SMLLRKRIFLAFHXXXXXXXXXXXKL---------------FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVH--------------------------FLRENQNVEMKEFKASFDI-EQIESYETRMQDLCIADRLLY---EKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQ---MAELKGVDLSDFHKR 1426
            LI+DEADR+L++GFE  +  I+ ++    ++R   L SAT T  V  L+   L NPV ISV  K+  + +        LN   +P+++  + +LV  + ++  L  F+  K    K++K+++F ++C+ V+++ S+   ++L       + H    S   K  +L               F   ++GV+LCTDV +RG+D+P + W+VQ+  P S   ++HR GRTAR    G +LL+L  SE  YV+                          F R  +  +        +I E+    +T  +D   + + +    +K++ SFI     Y K +LK IF +  L++G +A SFGL   P+   ++ +K   L   H R
Sbjct:  258 LIVDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLVDISLHNPVSISVLDKNCNQPNPKEVASIQLNSFAIPESLDQHVVLVPSKLRLVCLAAFILQKCKFEKNQKMIVFFSSCELVEFHYSLFLHTLLCHSGTPTSEHLPSASWPLKFLRLHGNMEQEERTSVFHEFSHSETGVLLCTDVASRGLDLPQVTWIVQYSAPSSPAEYIHRIGRTARIGCHGSSLLILAPSEAEYVNSLASHKINVGEIKMEDILAVLAKDDCFKRRQRGAQKSRASGPQEIRERATVLQTVFEDYVHSSQRMVSWAKKALQSFIRAYATYPK-ELKSIFHVRALHLGHVAKSFGLRDAPRNLSVSAVKKASLKRPHPR 636          
BLAST of SMED30027652 vs. UniProt/SwissProt
Match: sp|Q8NHQ9|DDX55_HUMAN (ATP-dependent RNA helicase DDX55 OS=Homo sapiens OX=9606 GN=DDX55 PE=1 SV=3)

HSP 1 Score: 314.309 bits (804), Expect = 8.976e-99
Identity = 157/348 (45.11%), Postives = 230/348 (66.09%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     ++S ++L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVR+SVK K G  +      P  + NYYM+ + + K + LV FL + K +K L+F +TC  V+YY   L +L++    +  H K+K KR KIF  F++++SG+++CTDVMARGIDIP++NWV+Q+DPP +A+ FVHRCGRTAR    G  L+ L   E++Y++FL  NQ   ++E K   +   +     +++ + +ADR ++EK + +F++YV  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   DV+  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSVKEK-GVAASSAQKTPSRLENYYMVCKADEKFNQLVHFLRNHKQEKHLVFFSTCACVEYYGKALEVLVKGVKIMCIHGKMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEESYINFLAINQKCPLQEMKPQRNTADLLP---KLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDK 489          
BLAST of SMED30027652 vs. UniProt/SwissProt
Match: sp|Q6ZPL9|DDX55_MOUSE (ATP-dependent RNA helicase DDX55 OS=Mus musculus OX=10090 GN=Ddx55 PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 3.369e-98
Identity = 160/348 (45.98%), Postives = 229/348 (65.80%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     +KS ++L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVRISVK K G  +      P  + N+YM+ + + K + LV FL  ++ +K L+F +TC  V+YY   L  LL+K   L  H K+K KR KIF  F++++SG+++CTDVMARGIDIP++NWV+Q+DPP +A+ FVHRCGRTAR    G  L+ L   E+ Y++FL  NQ   ++E   S     I+    +++ + +ADR ++EK + +F+++V  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   D+D  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVKSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRISVKEK-GVAASSTQKTPSRLENHYMICKADEKFNQLVHFLRSRQQEKHLVFFSTCACVEYYGKALEALLKKVKILCIHGKMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEEAYINFLAINQKCPLQEM--SLQRNTIDLL-PKLRAMALADRAVFEKGMKAFVSFVQAYAKHECSLIFRLKDLDFAGLARGFALLRMPRMPELRGKQFPDFVPVDIDTDTIPFKDK 489          
BLAST of SMED30027652 vs. UniProt/SwissProt
Match: sp|Q2NL08|DDX55_BOVIN (ATP-dependent RNA helicase DDX55 OS=Bos taurus OX=9913 GN=DDX55 PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 1.106e-97
Identity = 157/348 (45.11%), Postives = 227/348 (65.23%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   ++  E +     ++S E+L+LDEADRLL+MGFE  + TI++ LPKQR T LFSATQT EVENL+RAGLRNPVRISVK K G  +      P  + N+YM+ + + K + LV FL + K +K L+F +TC  V+YY   L  L++    +  H K+K KR KIF  F++++SG+++CTDVMARGIDIP++NWV+Q+DPP +A+ FVHRCGRTAR    G  L+ L   E++Y+ FL  NQ   ++E K   +   +     +++ + + DR ++EK + +F++YV  Y KH+   IF+L +L+   LA  F LLR+P+M EL+G    DF   DV+  T+ +KDK
Sbjct:  146 EDMFRRKAEGLDLASCVRSLEVLVLDEADRLLDMGFETSINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRISVKEK-GVAASSTQKTPSRLENHYMVCKADEKFNQLVHFLRNHKQEKHLVFFSTCACVEYYGKALETLVKGVKIMCIHGKMKYKRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEESYISFLAINQKCPLQEMKLQKNTADLLP---KLKAMALGDRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDK 489          
BLAST of SMED30027652 vs. UniProt/SwissProt
Match: sp|Q6AZV7|DDX55_XENLA (ATP-dependent RNA helicase DDX55 OS=Xenopus laevis OX=8355 GN=ddx55 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 4.225e-97
Identity = 161/352 (45.74%), Postives = 229/352 (65.06%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV---EMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +  +  +K+ ++LILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT E+ENL+RAGLRNPVRI+VK K G  +      P  + NYYM+ + + K + L+ FL+ +K +K L+F +TC  V+YY   L MLL+    +  H K+K KR +IF  F+++ SG+++CTDVMARGIDI ++NWVVQ+DPP SA+ FVHRCGRTAR    G  L+ L   E++YV FL  NQ     EM E   S D+        +++ +   DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M ELKG + SDF    +D  ++ YKDK+
Sbjct:  146 EDMFRRQADGLDLVICVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQTQELENLVRAGLRNPVRIAVKEK-GVAATSTQKTPIRLQNYYMICKADEKFNKLIAFLQKRKQEKHLVFFSTCACVEYYGKALEMLLKPVKVMCIHGKMKHKRNRIFTEFRKINSGILVCTDVMARGIDIHEVNWVVQYDPPSSASAFVHRCGRTARIGHHGSALVFLLPMEESYVSFLSINQKCPLQEMTELIISVDL------LPKLKAMAETDRAVFEKGMKAFVSYVQAYAKHECNLIFRVKDLDFSSLARGFGLLRMPRMPELKGKNFSDFVSTLIDTDSIAYKDKN 490          
BLAST of SMED30027652 vs. UniProt/SwissProt
Match: sp|Q8JHJ2|DDX55_DANRE (ATP-dependent RNA helicase DDX55 OS=Danio rerio OX=7955 GN=ddx55 PE=2 SV=2)

HSP 1 Score: 309.301 bits (791), Expect = 6.171e-97
Identity = 155/349 (44.41%), Postives = 226/349 (64.76%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +    ++KS ++L+LDEADRLL+MGFE  L TI+  LPKQR T LFSATQT E+E L+RAGLRNPVRI+VK K    S +    P  ++NYY +   E K + LV FL   K +K L+F +TC  V+Y+   L +L++       H K+K KR KIF  F+ +KSG+++CTDVMARGIDIP++NWV+Q+DPP SA++FVHRCGRTAR    G  L+ L   E++YV+FL  NQ   ++ F +  D+  +     +++ + + DR ++EK + +F++YV  Y KH+   IF++ +L+   LA  F LLR+P+M EL+G    DF    +D  T+ +KDK+
Sbjct:  146 EDMFRRKADGLDLATAVKSLDVLVLDEADRLLDMGFEASLNTILGYLPKQRRTGLFSATQTQELEKLVRAGLRNPVRITVKEKGVAASSVQKT-PAKLSNYYTMCRAEEKFNTLVAFLRQHKHEKQLVFFSTCACVEYFGKALEVLVKNVSIHCIHGKMKHKRNKIFADFRALKSGILVCTDVMARGIDIPEVNWVLQYDPPSSASSFVHRCGRTARIGNQGNALVFLLPMEESYVNFLSINQKCPLQSFSSVKDVVDVLP---KLKAMALGDRAMFEKGMRAFVSYVQAYAKHECSLIFRIKDLDFAALARGFALLRLPKMPELRGKTFPDFKAEAIDTDTIRFKDKN 490          
BLAST of SMED30027652 vs. TrEMBL
Match: A0A433T881 (RNA helicase OS=Elysia chlorotica OX=188477 GN=EGW08_014456 PE=3 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 3.897e-108
Identity = 170/334 (50.90%), Postives = 232/334 (69.46%), Query Frame = -1
Query:  446 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1447
            S+KS +ILILDEADRLL+MGFE  + TI+  LPKQR T LFSATQT EVE LIRAGLRNP++I+VK K   E++     P ++ NYYML+E + K   LV+FL  ++ +K+++F +TC  VDY+   L ++L+K    A H K+KSKR  IF  F++ KSGV++CTDVMARG+DIP++NWV+Q+DPP SA+ FVHRCGRTAR    G  L++L  SED YV F+  NQ V ++E      +E+     T +Q L I DR +YEK V +F++Y+  Y KH+   I +L +L+ GKLA  FGLL +P+M ELKG  + +F   +VDL T+ +KDK+
Sbjct:   53 SVKSLQILILDEADRLLDMGFEASITTILGYLPKQRRTGLFSATQTDEVEKLIRAGLRNPMQITVKEK-SREANGGQRTPSSLKNYYMLMEADQKFSQLVQFLSSRRKEKVMVFFSTCACVDYFSKCLEIILKKIQIFAIHSKMKSKRNHIFSTFRKQKSGVLICTDVMARGVDIPEVNWVIQYDPPSSASAFVHRCGRTARIGNTGNALVMLLPSEDAYVKFIEINQRVPLQELP---KVEEAPEMCTVLQTLAINDRAVYEKGVRAFVSYIQSYVKHECNMILRLKDLDFGKLAQGFGLLHLPKMPELKGKRVVNFEPIEVDLSTIPFKDKA 382          
BLAST of SMED30027652 vs. TrEMBL
Match: A0A0X3NVN8 (RNA helicase (Fragment) OS=Schistocephalus solidus OX=70667 GN=DDX55 PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 5.510e-107
Identity = 165/366 (45.08%), Postives = 252/366 (68.85%), Query Frame = -1
Query:  443 IKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVK-----VKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSIL--SMLLRKRIFLAF--HXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDI---EQIE-------SYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSV 1483
            +  N  +   ++ L+S EIL+LDEADRLL+MGFE QL +I+  LPKQR T LFSATQTT++++L+RAGLRNP+RI V+     VK G++  L    P  + N++++VE  +K+ +LV FL    ++K+L+F A+C +V+Y+  +L   +L + +  L +  H +++ KR + +  F++ ++GV+LCTDVMARGIDIP++NWV+Q+DPP  A+ FVHRCGRTARC   G  +L L  +E TY+ FL+ NQNV + E  +  DI    Q++       +  T++Q +C ADRLLYEKS+ ++++++ FYRKH+   +FK+  L+ G LAN++GLLR+PQM E++  ++S F    VD+ TL Y++KSV
Sbjct:  113 LSTNQSQNPILRGLRSLEILVLDEADRLLDMGFEAQLNSILSLLPKQRRTGLFSATQTTQLDDLLRAGLRNPLRIVVREKDTVVKKGKKLALQQRTPSTLENFFLVVEPNDKLSLLVSFLRGHAEEKVLVFFASCAAVEYFTRLLRQGLLPKSQTALVYGLHGRMRQKRSREYAAFRDARNGVLLCTDVMARGIDIPNVNWVIQWDPPSRASFFVHRCGRTARCGTAGRAVLFLNPNELTYIDFLKINQNVSLTEV-SPVDIIPAGQLKDPGLSSTAVHTKVQKICCADRLLYEKSIKAYVSFIQFYRKHECTLLFKVKELDFGGLANAYGLLRLPQMPEMRDANISGFLNSGVDVSTLKYREKSV 477          
BLAST of SMED30027652 vs. TrEMBL
Match: A0A068XVZ8 (RNA helicase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000346000 PE=3 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 1.776e-106
Identity = 175/349 (50.14%), Postives = 238/349 (68.19%), Query Frame = -1
Query:  443 IKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKD-KKILIFMATCDSVDYYKSIL-SMLLRKR---IFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV-----EMKEFKASFDIEQI--ESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSV 1453
            ++ L+S +ILILDEADRLL+MGFE QL  I+  LPKQR T LFSATQT ++++L+RAGLRNPVR+ VK K           P  + NY+M+V+  +K   LV FL      +KI++F+ATC +VDY+  +L + LL  R   +  A H+K++ KR   F  F+ ++ GV+LCTDVMARGID+P +NWV+Q+DPP +A  FVHRCGRTARC   G  +L L  +E  YV FLR NQNV     ++ E   +  +E+I  ES   ++Q +CI DRLLYEKS+ +F+++  FYRKHD + +FK+  L+ G LAN++GLLR+PQM ELKGV +  F   DVDL TL YK+KS+
Sbjct:  172 VRGLRSLKILILDEADRLLDMGFESQLNAILGMLPKQRRTGLFSATQTNQLDDLLRAGLRNPVRVVVKEKDVASIVHQQRTPSTLENYFMVVDPADKFRALVAFLRSHASTEKIIVFLATCAAVDYFSRLLRNGLLPPRQASLVHALHRKMRLKRVAEFDKFRSIERGVLLCTDVMARGIDVPGVNWVLQWDPPSNANFFVHRCGRTARCGAEGRAVLFLAPTEVAYVDFLRINQNVTLVERDLPELADASILEEITSESIRAKVQQVCIKDRLLYEKSIKAFVSFAQFYRKHDCRLLFKIQELDWGSLANAYGLLRLPQMPELKGVSIDSFISSDVDLTTLKYKEKSI 520          
BLAST of SMED30027652 vs. TrEMBL
Match: A0A2T7PD15 (RNA helicase OS=Pomacea canaliculata OX=400727 GN=C0Q70_06728 PE=3 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 2.509e-105
Identity = 166/334 (49.70%), Postives = 230/334 (68.86%), Query Frame = -1
Query:  446 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1447
            S+K+ EIL+LDEADRLLEMGFE  + T++ +LPK R T LFSATQT EVENLIRAGLRNP+RI+VK K  + ++ +   P ++ NYYM+ + + K   L++FL D   +K+L+F +TC  VDY+   L  +L+K   LA H K+K KR K+F+ F+ M SG+++CTDVMARG+DIPD+ WV+Q+DPP SA+ FVHRCGRTAR    G  L++L  +EDTYV F++ NQ V + E     D    ES   R++ L + DR  +EK V +F++++  Y KH+   IF+L +L+ GKLA  FGLLRIP+M EL+G  +  F   DVD   + +KDK+
Sbjct:  157 SVKALEILVLDEADRLLEMGFEASINTVLGNLPKLRRTGLFSATQTDEVENLIRAGLRNPMRITVKEKK-QATEADQRTPASLKNYYMIADADEKFSQLLRFLRDHYQEKLLLFFSTCACVDYFSRCLQAILKKMTVLAIHSKMKQKRNKVFETFRSMSSGLLVCTDVMARGVDIPDVQWVIQYDPPSSASAFVHRCGRTARIGNTGNALVMLLPAEDTYVEFIKINQKVPLSEMDKYSD---AESAAERLKSLALKDRDFFEKGVRAFVSFIQSYSKHECNMIFRLKDLDYGKLATGFGLLRIPKMPELRGKTVGSFTPADVDFDAIPFKDKT 486          
BLAST of SMED30027652 vs. TrEMBL
Match: A0A068WUS9 (RNA helicase OS=Echinococcus granulosus OX=6210 GN=EgrG_000346000 PE=3 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 5.863e-105
Identity = 175/359 (48.75%), Postives = 238/359 (66.30%), Query Frame = -1
Query:  443 IKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKD-KKILIFMATCDSVDYYKSIL-SMLLRKR---IFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNV-----EMKEFKASFDIEQI--ESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSV 1483
            I  N      ++ L+S EILILDEADRLL+MGFE QL  I+  LPKQR T LFSATQT ++++L+RAGLRNPVR+ VK K           P  + NY+++V+  +K   LV FL      +KI++F+ATC +VDY+  +L + LL  R   +  A H+K++ KR   F  F+ ++ GV+LCTDVMARGID+P +NWV+Q+DPP +A  FVHRCGRTARC   G  +L L  +E  YV FLR NQNV     ++ E   +  +E+I  ES   ++Q +CI DRLLYEKS+ +F+++  FYRKHD + +FK+  L+ G L N++GLLR+PQM ELKGV +  F   DVDL  L YK+KS+
Sbjct:  162 ISNNQTFNPVVRGLRSLEILILDEADRLLDMGFEPQLNAILGMLPKQRRTGLFSATQTNQLDDLLRAGLRNPVRVVVKEKDVASIVHQQRTPSTLENYFLVVDPADKFRALVTFLRSHASTEKIIVFLATCAAVDYFSRLLRNGLLPPRQASLVHALHRKMRLKRVAEFDKFRSIERGVLLCTDVMARGIDVPGVNWVLQWDPPSNANFFVHRCGRTARCGAEGRAVLFLAPTEVAYVDFLRINQNVTLVERDLPELADASILEEITSESIRAKVQQVCIKDRLLYEKSIKAFVSFAQFYRKHDCRLLFKIQELDWGSLGNAYGLLRLPQMPELKGVSIDSFIPSDVDLTKLKYKEKSI 520          
BLAST of SMED30027652 vs. Ensembl Cavefish
Match: ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:NCBI gene;Acc:286745])

HSP 1 Score: 221.861 bits (564), Expect = 7.470e-65
Identity = 130/349 (37.25%), Postives = 193/349 (55.30%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  + +     +K+ ++L+LDEADRLL+MGFE  L TI+  LPKQR T LFSATQT E+E L+RAGLRNPVRI+VK K G  +      P  + NYY +   E K + LV FL     +K L+F +TC  V+Y+   L  L++    L  H K+K KR KIF  F+++KS                               +FVHRCGRTAR    G  L+ L   E++YV+FL  NQ   ++ + A  D+E +      ++ L + DR ++E+ + +F++++  Y KH+   IF++ +L+   LA  F LLR+P+M EL+G     F +   D  ++ YKDK+
Sbjct:  146 EDMFRRKADGLDLASCMKALDVLVLDEADRLLDMGFEASLNTILGFLPKQRRTGLFSATQTQELEKLVRAGLRNPVRITVKEK-GVAASSAQKTPARLENYYTICRTEEKFNTLVAFLRQHTHEKQLVFFSTCACVEYFGKALEFLVKNVTILCIHGKMKDKRNKIFSEFRQLKS-------------------------------SFVHRCGRTARIGNRGSALVFLLPMEESYVNFLSINQKCPLQLYPAVKDVENVLP---DLKVLALGDRAVFERGMRAFVSFIQAYAKHECSLIFRVKDLDFASLARGFALLRMPKMPELRGKSFPGFEEVP-DTDSIRYKDKN 458          
BLAST of SMED30027652 vs. Ensembl Cavefish
Match: ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:ZFIN;Acc:ZDB-GENE-030131-9685])

HSP 1 Score: 190.66 bits (483), Expect = 2.045e-52
Identity = 115/320 (35.94%), Postives = 188/320 (58.75%), Query Frame = -1
Query:  503 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARC-EQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL-----KGVDL 1441
            K+ + LI+DEADR+LE+GFE++L  IIK LPK+R T LFSATQT +VE+L R  L+    + V V   +E+   + L +     Y++   E +  +L  FL+  + KK+++F ++C SV ++  +L+ +      +A H K K  +       F    SG++LCTDV ARG+DIP+++W+VQ+DPP     ++HR GRTAR     G  LL+LR  E  ++ FL++ + V + EF+  F   +I   +++++ L   +  L++ +  ++ +YV  Y  H LK I+ +  LN+ ++A SFG  ++P   +L     KGV L
Sbjct:  372 KNLQCLIIDEADRILEVGFEEELKQIIKLLPKKRQTMLFSATQTRKVEDLARISLKKEP-LYVGVDDNKETATVEGLEQG----YVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKFHYELLNYI--DLPVMAIHGKQKQTKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGINGIGHALLILRPEELGFLRFLKQAK-VPLSEFE--FSWSKISDIQSQLEKLIEKNYYLHKSAQEAYKSYVRAYDSHSLKQIYNVQTLNLPQVALSFG-FKVPPYVDLNVHSSKGVKL 680          
BLAST of SMED30027652 vs. Ensembl Cavefish
Match: ddx10 (DEAD-box helicase 10 [Source:NCBI gene;Acc:103036294])

HSP 1 Score: 170.244 bits (430), Expect = 9.434e-45
Identity = 102/302 (33.77%), Postives = 163/302 (53.97%), Query Frame = -1
Query:  527 ILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1429
            +L+LDEADR+L+MGF D L  I+++LPK R T LFSATQT  V++L R  L+NP  + V     E++  +   P  +   YM+ E   K+++L  FL     KKI++F A C  V Y   +   L      LA H K +  +       F   K+ V+  TD+ ARG+D P +NWVVQFD P+ A  ++HR GRTAR ++ GE LL+L  SE+  +    + + V +   K   + E++ S + +++     ++   E++   F++Y+        K +F +  + + + A S GL   P++
Sbjct:  215 MLVLDEADRILDMGFADTLNAIVENLPKSRQTLLFSATQTKSVKDLARLSLKNPEYVWVH----EQAKFS--TPATLEQSYMVCELHQKVNMLFSFLRSHLHKKIIVFFACCKEVQYLFRVFCRLRPGISVLALHGKQQQMKRVEVYNDFVRKKAAVLFATDIAARGLDFPAVNWVVQFDCPEDANTYIHRVGRTARYKEGGEALLILLPSEEKGMTTQLQEKKVPIN--KIQVNPEKLVSVQQKLEAFLAQEKEQKERAQRCFVSYLRSVYLMKNKDVFDVFQIKLLEYAMSLGLAVAPRV 508          
BLAST of SMED30027652 vs. Ensembl Cavefish
Match: ddx10 (DEAD-box helicase 10 [Source:NCBI gene;Acc:103036294])

HSP 1 Score: 169.859 bits (429), Expect = 9.436e-45
Identity = 102/302 (33.77%), Postives = 163/302 (53.97%), Query Frame = -1
Query:  527 ILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1429
            +L+LDEADR+L+MGF D L  I+++LPK R T LFSATQT  V++L R  L+NP  + V     E++  +   P  +   YM+ E   K+++L  FL     KKI++F A C  V Y   +   L      LA H K +  +       F   K+ V+  TD+ ARG+D P +NWVVQFD P+ A  ++HR GRTAR ++ GE LL+L  SE+  +    + + V +   K   + E++ S + +++     ++   E++   F++Y+        K +F +  + + + A S GL   P++
Sbjct:  162 MLVLDEADRILDMGFADTLNAIVENLPKSRQTLLFSATQTKSVKDLARLSLKNPEYVWVH----EQAKFS--TPATLEQSYMVCELHQKVNMLFSFLRSHLHKKIIVFFACCKEVQYLFRVFCRLRPGISVLALHGKQQQMKRVEVYNDFVRKKAAVLFATDIAARGLDFPAVNWVVQFDCPEDANTYIHRVGRTARYKEGGEALLILLPSEEKGMTTQLQEKKVPIN--KIQVNPEKLVSVQQKLEAFLAQEKEQKERAQRCFVSYLRSVYLMKNKDVFDVFQIKLLEYAMSLGLAVAPRV 455          
BLAST of SMED30027652 vs. Ensembl Cavefish
Match: ddx10 (DEAD-box helicase 10 [Source:NCBI gene;Acc:103036294])

HSP 1 Score: 169.474 bits (428), Expect = 1.038e-44
Identity = 102/302 (33.77%), Postives = 163/302 (53.97%), Query Frame = -1
Query:  527 ILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1429
            +L+LDEADR+L+MGF D L  I+++LPK R T LFSATQT  V++L R  L+NP  + V     E++  +   P  +   YM+ E   K+++L  FL     KKI++F A C  V Y   +   L      LA H K +  +       F   K+ V+  TD+ ARG+D P +NWVVQFD P+ A  ++HR GRTAR ++ GE LL+L  SE+  +    + + V +   K   + E++ S + +++     ++   E++   F++Y+        K +F +  + + + A S GL   P++
Sbjct:  212 MLVLDEADRILDMGFADTLNAIVENLPKSRQTLLFSATQTKSVKDLARLSLKNPEYVWVH----EQAKFS--TPATLEQSYMVCELHQKVNMLFSFLRSHLHKKIIVFFACCKEVQYLFRVFCRLRPGISVLALHGKQQQMKRVEVYNDFVRKKAAVLFATDIAARGLDFPAVNWVVQFDCPEDANTYIHRVGRTARYKEGGEALLILLPSEEKGMTTQLQEKKVPIN--KIQVNPEKLVSVQQKLEAFLAQEKEQKERAQRCFVSYLRSVYLMKNKDVFDVFQIKLLEYAMSLGLAVAPRV 505          
BLAST of SMED30027652 vs. Ensembl Sea Lamprey
Match: ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:NCBI gene;Acc:286745])

HSP 1 Score: 306.99 bits (785), Expect = 1.590e-98
Identity = 156/348 (44.83%), Postives = 222/348 (63.79%), Query Frame = -1
Query:  449 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDK 1492
            E   K++DE +    ++++ ++L+LDEADRLL+MGFE  L TI+  LPKQR T LFSATQT E+E L+RAGLRNPVRI+VK +   ES      P  + N+Y++   E K + LV FL  +K +K L+F +TC  V+Y+   L MLL     ++ H K+K +R KIF  F+ + SG+++CTDVMARGIDIP+++WV+QFDPP SA+ FVHRCGRTAR    G  L+ L   E  YV+FL  NQ   + E     D+  +     R       DR +YEK + +F++ V  Y KH+   IF++ ++++G LA  F LLR+P+M EL+GV ++ F    +D  T+ Y+DK
Sbjct:   83 EDLFKRSDEGLDLRGAVRNLDVLVLDEADRLLDMGFEACLNTILSFLPKQRRTGLFSATQTQELEALVRAGLRNPVRIAVKERGAAESSTR-RTPARLDNFYVICRAEQKFNQLVAFLRARKQEKHLVFFSTCAGVEYFGKALQMLLHGVTVMSIHGKMKDRRNKIFATFRSLPSGLLVCTDVMARGIDIPEVDWVLQFDPPSSASAFVHRCGRTARIGNHGSALVFLLPMESAYVNFLSINQKCPLTERAIERDVVDVLPQVRRAAR---TDRAVYEKGMQAFVSCVQAYAKHECSLIFRIKDMDLGALARGFALLRLPRMPELRGVRVTGFVPDAIDTDTISYRDK 426          
BLAST of SMED30027652 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010109.1 (pep scaffold:Pmarinus_7.0:GL476492:615610:626431:-1 gene:ENSPMAG00000009147.1 transcript:ENSPMAT00000010109.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 2.658e-42
Identity = 88/237 (37.13%), Postives = 144/237 (60.76%), Query Frame = -1
Query:  740 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLR-NPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARC-EQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK 1441
            K+ + L++DEADR+LE+GFE+++  II+ LPK+R T LFSATQT ++E+L +  L+  P+ + V   H E + + D L +  +  Y++   E +  +L  FL+  + KKI++F ++C SV ++  + + +      +  H K K  +       F    SG +LCTDV ARG+DIP+++W+VQFDPP     ++HR GRTAR     G  LL+LR  E  ++ +L++ + V + EF+
Sbjct:  323 KNLQCLVIDEADRILEVGFEEEIKQIIRLLPKKRQTMLFSATQTRKIEDLAKISLKKEPLYVGVD-DHKETATV-DGLEQQRSTPYVVCPSEKRFLLLFTFLKKNRKKKIMVFFSSCMSVKFHYELFNYI--DLPVMGIHGKQKQTKRTTTFFQFCNADSGTLLCTDVAARGLDIPEVDWIVQFDPPDDPKEYIHRVGRTARGIGGQGHALLILRPEELGFLRYLKQAR-VPLSEFE 554          
BLAST of SMED30027652 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 1.107e-30
Identity = 72/213 (33.80%), Postives = 121/213 (56.81%), Query Frame = -1
Query:  818 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAF---HXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETL 1447
            ++++ + L++DEADR+L M FE ++  I+K +PK+R T LFSAT T +V+ L RA L+ PV+ SV  K+           + +  YY+ +  + K   LV  L +      +IF +TC++       +++LLR   F A     +  ++KR      FK     ++L TDV +RG+DIP ++ V+ FD P  + +++HR GRTAR  + G+++
Sbjct:  135 NIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKY--------QTVEKLQQYYVFIPAKFKDSYLVYILNELAGNSFIIFCSTCNNTQR----IALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSI 335          
BLAST of SMED30027652 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 104.375 bits (259), Expect = 1.396e-24
Identity = 73/222 (32.88%), Postives = 119/222 (53.60%), Query Frame = -1
Query:  785 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLED--KKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYV 1444
            L++ E ++ DEADRL EMGF +QL  II+ LP  R T LFSAT   ++    RAGL +PV I + V    +S L+D L       +M    ++K  +L+  L    K  ++ ++F+AT   V+Y + ++S       ++ +    +++R+     F   K+ +++ TDV ARGID P ++ V+ ++ P     F+HR GR AR  + G    L+   E  +V
Sbjct:  175 LQAMEYVVFDEADRLFEMGFAEQLTEIIRRLPDSRQTLLFSATLPKQLVEFARAGLSDPVLIRLDV----DSKLSDQL----KLAFMCSRADDKPCVLLHLLRTVVKPHEQTVVFVATKHHVEYLRELVSQAGMSCAYI-YSALDQTERKINVGKFVHKKTMLLIVTDVAARGID-PMLDNVINYNFPGKPKLFIHRVGRVARAGRSGTAYSLVAPDEMPFV 386          
BLAST of SMED30027652 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 96.2857 bits (238), Expect = 1.512e-21
Identity = 79/250 (31.60%), Postives = 121/250 (48.40%), Query Frame = -1
Query:  743 SLKSTEILILDEADRLLEMGFED--QLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVK--VKHGEESDLNDNLPKNMTNYYMLVEKENK----IDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIF--LAFHXXXXXXXX-XXXKLFKEMKSGVMLCTDV----MARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEF 1447
            SLK  + L++DEADRLLE G  D  + + +I +LP +R T LFSAT T  ++ L    L NP     K  V+  EE D            Y+LV  + K    + I+ K  +   D  I++F  TC +      +L+M+LR   F  +A H  ++          FK     +++ TDV     ARG+DIP +  V+  + P     ++HR GRTAR  + G  + ++   +   V  + E  N ++KEF
Sbjct:  145 SLKKIQFLVMDEADRLLEQGATDFTKDLQVILALPAKRQTLLFSATLTDTLQELRNLALTNPFFWESKEPVRTVEELD----------QRYILVADKVKDAYLVHIIQKIQDAHDDWSIIVFTNTCKNC----QVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSMFKILIATDVASSFWARGLDIPTVQVVLNHNTPSLPKTYIHRVGRTARAGRNGVAITIVTQYDIHLVQAIEETINTKLKEF 380          
BLAST of SMED30027652 vs. Ensembl Yeast
Match: SPB4 (Putative ATP-dependent RNA helicase; nucleolar protein required for synthesis of 60S ribosomal subunits at a late step in the pathway; sediments with 66S pre-ribosomes in sucrose gradients [Source:SGD;Acc:S000001894])

HSP 1 Score: 189.119 bits (479), Expect = 2.381e-53
Identity = 105/316 (33.23%), Postives = 175/316 (55.38%), Query Frame = -1
Query:  518 STEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFL------AFHX--XXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSS-EDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL 1438
            +  ++++DEADRLL+M F      I++ LPKQR T LFSAT  +   ++ + GLRNPVRI+V  K+   S L  N        Y +V    K+ +LV  L + K KK +++  TC SV Y+ S +  L ++ I +      + H   +  ++ + +      + + V+  TDV ARGIDIPD++ V+Q DPP +   F+HRCGRT R  + G+ +  L    E+ ++ F+ + +NVE++E            YE   ++  + DR  ++K V +++A++ +Y  H    IF+L +L+   +A  +GL R+P+M E+
Sbjct:  165 ACSMVVMDEADRLLDMSFIKDTEKILRLLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLN--------YCVVNPAEKLQLLVSILNNYKFKKCIVYFPTCVSVSYFYSFIQYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTDSLSNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLNEGREEDFIPFM-QVKNVELEELDLEVKGITTNFYED-FRNWILEDRDRFDKGVKAYVAFIKYYSNHSATSIFRLQSLDYVGIAKLYGLFRLPRMPEI 470          
BLAST of SMED30027652 vs. Ensembl Yeast
Match: HAS1 (ATP-dependent RNA helicase; involved in the biogenesis of 40S and 60S ribosome subunits; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000004903])

HSP 1 Score: 186.808 bits (473), Expect = 2.874e-53
Identity = 103/309 (33.33%), Postives = 190/309 (61.49%), Query Frame = -1
Query:  527 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQ-RLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQF-GETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1444
             K+ + LI+DEADR+LE+GFED++  IIK LP + R + LFSATQTT+VE+L R  LR P  + + V    ++   D L +     Y++ + + +  +L  FL+  + KKI++F+++C+SV YY  +L+ +      L  H K K ++       F   + G+++CTDV ARG+DIP ++W++QFDPP    +++HR GRTAR  +  G++L+ L  +E  ++ +L+ ++ V + E++  F   +I + +++++ L  ++  L++ + + + +Y+  Y  H LK ++++  L++ K+A S+G    P++
Sbjct:  187 FKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLR-PGPLFINVVPETDNSTADGLEQG----YVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYI--DLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKASK-VPLNEYE--FPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFPVPPKV 485          
BLAST of SMED30027652 vs. Ensembl Yeast
Match: HCA4 (DEAD box RNA helicase; component of the SSU; interacts with Bfr2p and Enp2p; high-copy number suppression of a U14 snoRNA processing mutant suggests an involvement in 18S rRNA synthesis [Source:SGD;Acc:S000003570])

HSP 1 Score: 129.413 bits (324), Expect = 4.348e-32
Identity = 91/310 (29.35%), Postives = 159/310 (51.29%), Query Frame = -1
Query:  509 EILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDY-YKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYV-MFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGV 1432
            ++L+LDEADR L+MGF+  L  I+ +L   R T LFSATQ+  V +L R  L +   +          +   + P+ +  +Y+ V   +K+DIL  F++     K+++F+++   V + Y++   M     +     ++ +  R +    F   +   +  TDV+ARGID P ++WVVQ D P+    ++HR GR AR  + G++L++L   E     FL+     +++  K +    + +S + ++Q L   D  L      +FI+YV   Y + D K +FK   L   + A S GL   P++ ++KG+
Sbjct:  189 QMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQSVADLARLSLTDYKTVGTHDVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQEQEA--FLKRLNARKIEPGKLNIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVRSIYVQKD-KQVFKFDELPTEEFAYSLGLPGAPKI-KMKGM 494          
BLAST of SMED30027652 vs. Ensembl Yeast
Match: DRS1 (Nucleolar DEAD-box protein required for ribosome assembly and function; including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000003931])

HSP 1 Score: 115.931 bits (289), Expect = 9.145e-28
Identity = 85/294 (28.91%), Postives = 151/294 (51.36%), Query Frame = -1
Query:  608 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDI-----LVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLL-RSSED-----TYVHFLRENQNV-EMKEFKASFDIEQIESYETRMQDL--CIADRLLYEKSVNSFIAYVMFYRKHD 1447
            ++ S EIL++DEADR+LE GF+D+L  I+  LP  R   LFSAT  +++++L+   L+ PVRI +        D        +T  ++ + K + +       L++ L+    K+I++F+A  ++    + I+  LL   +        + +R      FK ++  V++CTD+ +RG+DIP I  V+ +D P+S   ++HR GRTAR  + G ++  +  SS+D       +  + EN+++ + K    + D  QIE     ++ +   I D L+ EK     +   M  RK +
Sbjct:  375 NVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMI--------DPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLDPTGQKRIVVFVARKETAHRLRIIMG-LLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRAAIKSVEENKSLTQGKALGRNVDWVQIEETNKLVESMNDTIEDILVEEKEEKEILRAEMQLRKGE 659          
BLAST of SMED30027652 vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 110.923 bits (276), Expect = 1.731e-26
Identity = 75/218 (34.40%), Postives = 120/218 (55.05%), Query Frame = -1
Query:  809 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQ-RLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNL---PKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXK-LFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLL 1447
            SL+  + L++DEADRLL+M F   L  I+K +P Q R T LFSAT T++++ L RA L NPV+ +V  K+     L   L   P  + N Y+       I +L +F+     K ++IF  T  + +    + ++L  +    A H  +   +      LFK  K  +++ TDV ARG+DIP ++ VV +D P  + +++HR GRTAR  + G+++ L+
Sbjct:  221 SLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYL-------IYLLNEFI----GKTMIIFTRTKANAERLSGLCNLL--EFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLV 425          
BLAST of SMED30027652 vs. Ensembl Nematostella
Match: EDO41335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S3])

HSP 1 Score: 311.227 bits (796), Expect = 2.844e-99
Identity = 154/349 (44.13%), Postives = 226/349 (64.76%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E  + +  + +     LKS E+L+LDEADRLL+MGFE  + TI+  LPKQR T LFSATQT EVE L+RAGLRNPVR++V+ K  +  ++    P  + N+Y++     K   LV FL+ +KDKK ++F +TC  V+Y+   L+  L     +A H K+KS R KIF  F++++SG+++CTDVMARG+DIP++NWV+Q+DPP SA  FVHRCGRTAR    G  ++ L  +ED+YV F+  NQ V ++  +   D   I +   +++ L   DR L+EK   +F+++V  Y+KH+   IF+   L++G LA  FGLLR+P M EL+GV +  F   D+D   + Y++K+
Sbjct:  142 EDFLARQQDGINLASHLKSLEVLVLDEADRLLDMGFEASINTILGYLPKQRRTGLFSATQTDEVEALVRAGLRNPVRVTVREKLTKTKNVQ-RTPSTLQNFYLICRSHEKFSQLVAFLKARKDKKNMVFFSTCACVNYFSKALTKFLPNVHIMALHGKMKSNRHKIFDSFRKLESGILVCTDVMARGVDIPEVNWVIQYDPPSSANAFVHRCGRTARIGNEGNAVVFLLPTEDSYVDFISINQKVPLQALEPDKDAPNITA---KLKKLATKDRDLFEKGTKAFVSFVQAYKKHECSLIFRFKELDLGLLAEGFGLLRLPSMPELRGVTIDSFTPHDIDYDKIRYQEKA 486          
BLAST of SMED30027652 vs. Ensembl Nematostella
Match: EDO38731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC22])

HSP 1 Score: 185.652 bits (470), Expect = 1.478e-52
Identity = 106/309 (34.30%), Postives = 184/309 (59.55%), Query Frame = -1
Query:  524 KSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGL-RNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTAR-CEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMA 1441
            K+ + L++DEADR+LE+GFE+++  II+ LP +R T LFSATQT  VE+L +  L R+P+ + V   H E S +     + +   Y++V  E +  +L  FL+  + KK+++F ++C+SV Y+  +L+ +      L  H K K ++       F   KSG++LCTDV ARG+DIP+++W+VQ+DP      ++HR GRTAR  E  G  LL L   E  ++ +L+ +  V + E+   F   +I + +++++ L   +  L++ + +++ AY+  Y  H  K IF +++L++ ++A SFG    P ++
Sbjct:  147 KNLQCLVIDEADRILEIGFEEEMRQIIRILPSKRQTVLFSATQTKNVEDLAKLSLKRSPLYVGVD-DHKETSTV-----EGLEQGYIVVPSEKRFLVLFTFLKKNRSKKVMVFFSSCNSVKYHSELLNYI--DLPVLEIHGKQKQQKRTTTFFEFCNAKSGILLCTDVAARGLDIPEVDWIVQYDPADDPKEYIHRVGRTARGTEGKGHALLFLLPEELAFLRYLK-HAKVPLNEY--DFSSSKILNIQSQLERLIEKNYYLHKSAKDAYKAYIQAYASHQHKSIFNVNSLDLQRVALSFGFAVPPSVS 444          
BLAST of SMED30027652 vs. Ensembl Nematostella
Match: EDO41969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2R2])

HSP 1 Score: 163.31 bits (412), Expect = 1.757e-43
Identity = 109/330 (33.03%), Postives = 181/330 (54.85%), Query Frame = -1
Query:  461 STEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDY-YKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDV---DLKTLI 1438
            S +IL+LDEADR+L+MGF   L  II++LP +R T L+SATQT  V++L R  L+ P  IS      E+SD +   P  +T  Y++ E  +K++ L  F+ +    KIL+F+++C  V + Y+    +     +   + K+ + KR  I+  F +    V+  TD+ ARG+D P +NWV+Q D P+ A  ++HR GRTAR ++ G++LL+L  SE+  +    +++ V + E K   + +++ S +++++     D+ L   +  S I+YV        K IF  + L I + + S GL   P++  L+        KR     D +TLI
Sbjct:  196 SLQILVLDEADRILDMGFAPTLNAIIENLPSERQTLLYSATQTRSVKDLARLSLQEPTYISAH----EKSDTS--TPNRLTQSYVVCELPDKLNFLFSFIRNHLKSKILVFVSSCKQVKFIYEGFRRLQPGIPLMALYGKQKQLKRVAIYDEFCKKTQCVLFATDIAARGLDFPAVNWVIQLDCPEDANTYIHRAGRTARYQKDGQSLLVLLPSEEQEMIKALKDKKVPINEIKV--NPKKMSSIQSKLESFLAQDQELKHWAQKSIISYVRSVFLQSNKKIFDTTKLPIKEFSVSLGLSNAPRIRFLQSALTLSAQKRSTMYSDNQTLI 517          
BLAST of SMED30027652 vs. Ensembl Nematostella
Match: EDO36246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ72])

HSP 1 Score: 141.739 bits (356), Expect = 3.570e-36
Identity = 94/335 (28.06%), Postives = 172/335 (51.34%), Query Frame = -1
Query:  533 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTS------LFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDN--------------LPKNMTNYYMLVEKENKIDILVKFL----EDKKDKKILIFMATCDSVDYYKSILSMLL------RKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIP 1447
            + ++ + ++LDEADRLL+MGFE  +  I+K++  Q++ +      L SAT T  V+ L+   L NP  +S       ES LN                +P  +  Y+++V  + ++  L  F+    ++    K+++F+++ DSVD++  +    L      +  ++       +++R  +F  +   + G++L TDV ARG+D+P ++W++Q+D P SA ++VHR GRTAR    G+ LL L  +E  Y+  L E  N+  +E   S  ++ + S         I+ + + +  V S+  +        LK+IF ++NL++G +A +F L   P
Sbjct:  255 TFRNVQWIVLDEADRLLDMGFEKDVSAILKAIKDQQIKAMHRQAVLLSATLTQGVKQLVSIALSNPQFVS-------ESGLNQQVEKDGSLDESVLAQIPSQLKQYFVIVPSKMRLVSLASFILSKVQESPQNKMIVFLSSRDSVDFHYGLFDKCLGLGAGKKPELYKLHGSMSQTERTDVFTKYSSSQEGILLSTDVAARGLDLPRVSWIIQYDTPGSAVDYVHRVGRTARIGCEGQALLFLTPAEVKYLETLSEF-NIRPEELSVSKILQTLTS---------ISSKDVKKSFVRSYATF-----PASLKHIFHVNNLHLGHVAKAFALRDPP 567          
BLAST of SMED30027652 vs. Ensembl Nematostella
Match: EDO33593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU4])

HSP 1 Score: 114.775 bits (286), Expect = 1.344e-27
Identity = 68/210 (32.38%), Postives = 114/210 (54.29%), Query Frame = -1
Query:  818 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETL 1447
            SL++ + L++DEADR+L M FE ++  ++K +PK+R T LFSAT T +V+ L RA L+ PV++ V  K+     L  +        Y+ +  + K   LV  L +      ++F  TC++V     +L  L    + L        +   + K FK     +++ TDV +RG+DIP ++ V+ FD P  + +++HR GRTAR  + G ++
Sbjct:  154 SLRTLKYLVMDEADRILNMDFEKEVDKLLKVIPKERRTFLFSATMTKKVQKLQRASLQAPVKVEVATKYQTVEKLQQS--------YLFIPSKFKDCYLVYVLNELAGNSFMVFCGTCNNVQRVTLMLRNLGLDAVPLHGQMSQSKRLGALNK-FKSKSRSILVATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGRSV 354          
BLAST of SMED30027652 vs. Ensembl Medaka
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:101161657])

HSP 1 Score: 318.546 bits (815), Expect = 1.753e-101
Identity = 156/349 (44.70%), Postives = 226/349 (64.76%), Query Frame = -1
Query:  446 EKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKS 1492
            E   ++  E +    +++S ++L+LDEADRLL+MGFE  L TI+  LPKQR T LFSATQT E+E L+RAGLRNPVRI+VK K    +      P  ++NYY +   + K + LV FL   K +K L+F +TC  V++Y   L +L+RK      H K+K+KR  IF  F+++KSG+++CTDVMARG+DIPD+NWV+Q+DPP  A+ FVHRCGRTAR   +G  L+ L   E+TYV+FL  NQ   ++E     D+  +     +++ + +ADR  +E+ + +F++YV  Y KH+   IF++ +L+   LA  FGLLR+P+M EL+G    DF +  VD   + YKDK+
Sbjct:  146 EDMFRRKSEGLDLASAVRSLDVLVLDEADRLLDMGFESSLNTILSFLPKQRRTGLFSATQTQELEKLVRAGLRNPVRITVKEKGLAAAAPAQKTPSRLSNYYTVCRADEKFNHLVAFLRQHKHEKQLVFFSTCACVEFYGRALELLVRKVPVCCIHGKMKNKRNSIFADFRKLKSGILVCTDVMARGVDIPDVNWVLQYDPPSRASAFVHRCGRTARIGNYGNALVFLLPMEETYVNFLSINQKCPLQEMPPISDVVDVLP---KVKAMALADRAAFERGMKAFVSYVQAYAKHECSLIFRVKDLDFAALARGFGLLRLPKMPELRGKTFPDFPEAAVDTDAIPYKDKN 491          
BLAST of SMED30027652 vs. Ensembl Medaka
Match: ddx18 (DEAD-box helicase 18 [Source:NCBI gene;Acc:101158147])

HSP 1 Score: 189.889 bits (481), Expect = 1.688e-52
Identity = 111/313 (35.46%), Postives = 183/313 (58.47%), Query Frame = -1
Query:  518 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRN-PVRISVKVKHGEESDLNDNLP-KNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARC-EQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAEL 1444
             K+ + LI+DEADR+LE+GFE++L  IIK LPK+R T LFSATQT  VE+L R  L+  P+ + V        D  DN     +   Y++   E +  +L  FL+  + KK+++F ++C SV ++  +L+ +      +A H K K  +       F    SG++LCTDV ARG+DIP+++W++Q+DPP     ++HR GRTAR  +  G  LL+LR  E  ++ FL++ + V + EF+  F   +I   +++++ L   +  L++ +  ++ +YV  Y  H LK I+ ++ LN+  +A SFG  ++P   +L
Sbjct:  296 FKNLQCLIIDEADRILEVGFEEELKQIIKLLPKRRQTMLFSATQTRRVEDLARISLKKEPLYVGV-------DDNKDNATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKFHYELLNYI--DLPVMAIHGKQKQTKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIIQYDPPDDPKEYIHRVGRTARGIDGRGHALLILRPEELGFLRFLKQAK-VPLSEFE--FSWSKISDIQSQLEKLIEKNYYLHKSAQEAYKSYVRAYDSHSLKQIYSVNTLNLPMVALSFG-FKVPPYVDL 595          
BLAST of SMED30027652 vs. Ensembl Medaka
Match: ddx10 (DEAD-box helicase 10 [Source:NCBI gene;Acc:101161476])

HSP 1 Score: 168.703 bits (426), Expect = 2.224e-44
Identity = 100/302 (33.11%), Postives = 165/302 (54.64%), Query Frame = -1
Query:  527 ILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKL-FKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1429
            +L+LDEADR+L+MGF D L  I+++LP+ R T LFSATQT  V++L R  L++P  + V  K         + P ++   Y++ E   K+D+L  F+     KKI++F A C  V Y   +   L      LA H +    +       F   ++ V+  TD+ ARG+D P +NWV+QFD P+ A  ++HR GRTAR ++ GE LLLL  SE   +    + + V + + +   + E+++S + +++     ++   E++   F++Y+        K +F +S LNI + A+S GL   P++
Sbjct:  224 MLVLDEADRILDMGFADTLNAIVENLPRTRQTLLFSATQTKSVKDLARLSLKDPEYVWVHDK------ARFSTPASLEQSYVVCELHQKVDLLFSFIRGHLTKKIIVFFACCKQVQYLFRVFCRLRPGMPVLALHGRQPQVKRVEVYNDFVRKQNAVLFATDIAARGLDFPAVNWVLQFDCPEDADTYIHRVGRTARYKEGGEALLLLLPSEAEAMVAQLQEKKVPINQIQV--NPEKLQSIQQKLEAFLAQEKEQKERAQRCFVSYLRSVHLMKNKAVFDVSKLNINQYAHSLGLAVAPRV 517          
BLAST of SMED30027652 vs. Ensembl Medaka
Match: ddx31 (DEAD-box helicase 31 [Source:NCBI gene;Acc:101158115])

HSP 1 Score: 147.902 bits (372), Expect = 1.701e-37
Identity = 107/357 (29.97%), Postives = 177/357 (49.58%), Query Frame = -1
Query:  533 LILDEADRLLEMGFEDQLMTIIKSL---PKQRLTSLFSATQTTEVENLIRAGLRNPVRISVK--------------VKHGEESDLNDN--LPKNMTNYYMLVEKENKIDILVKFLEDK-KDKKILIFMATCDSVDYYKSIL-SMLLRKRIF--LAFHXXXXXXXXXXXK----LFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK------------------------ASFDIEQ-----IESYETRMQDLCIADRLLYE---KSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIP 1426
            L+LDEADR L++GF+  L  I+ SL      R   L SAT T  V  L    L++PV I V                   E ++ +++  +P+ +  + ++V  + ++  L  F+ DK KD K+++F+++C++V++  S+  S+L R   +  L+F +   + +++       LF   +SGV+LCTDV ARG+D+P + W+VQ+ PP SA  +VHR GRTAR    G +LL L  +E  ++  L  N N+ + E K                        +S  +EQ         +T  ++   +D    +   K++ S++     Y  H LK+IF +  L++G  A SFGL   P
Sbjct:  300 LVLDEADRTLDLGFDKDLTVILNSLNSTGPARQNVLLSATLTLGVSRLADVCLKDPVSIQVSGPSSSSDHTGSSHVTSDTEAANTSESFAVPEALRQFAVVVPSKIRLVCLAAFVLDKCKDNKVIVFVSSCEAVEFLHSLFTSVLTRPAAYPRLSFQRLHGNMKQEERSEVFQLFSASQSGVLLCTDVAARGLDLPLVTWIVQYTPPSSAAEYVHRVGRTARIGGRGSSLLFLTPAETAFISEL-ANHNISLSEMKLQEILSCLMLDDTYRGRGKYYSKTSSKALEQEVRERATVLQTEFENFVHSDAQSLQAAKKALQSYLRAYTTYPAH-LKHIFHIRFLHLGHAAKSFGLRDAP 654          
BLAST of SMED30027652 vs. Ensembl Medaka
Match: ddx31 (DEAD-box helicase 31 [Source:NCBI gene;Acc:101158115])

HSP 1 Score: 147.902 bits (372), Expect = 2.019e-37
Identity = 107/357 (29.97%), Postives = 177/357 (49.58%), Query Frame = -1
Query:  533 LILDEADRLLEMGFEDQLMTIIKSL---PKQRLTSLFSATQTTEVENLIRAGLRNPVRISVK--------------VKHGEESDLNDN--LPKNMTNYYMLVEKENKIDILVKFLEDK-KDKKILIFMATCDSVDYYKSIL-SMLLRKRIF--LAFHXXXXXXXXXXXK----LFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFK------------------------ASFDIEQ-----IESYETRMQDLCIADRLLYE---KSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIP 1426
            L+LDEADR L++GF+  L  I+ SL      R   L SAT T  V  L    L++PV I V                   E ++ +++  +P+ +  + ++V  + ++  L  F+ DK KD K+++F+++C++V++  S+  S+L R   +  L+F +   + +++       LF   +SGV+LCTDV ARG+D+P + W+VQ+ PP SA  +VHR GRTAR    G +LL L  +E  ++  L  N N+ + E K                        +S  +EQ         +T  ++   +D    +   K++ S++     Y  H LK+IF +  L++G  A SFGL   P
Sbjct:  340 LVLDEADRTLDLGFDKDLTVILNSLNSTGPARQNVLLSATLTLGVSRLADVCLKDPVSIQVSGPSSSSDHTGSSHVTSDTEAANTSESFAVPEALRQFAVVVPSKIRLVCLAAFVLDKCKDNKVIVFVSSCEAVEFLHSLFTSVLTRPAAYPRLSFQRLHGNMKQEERSEVFQLFSASQSGVLLCTDVAARGLDLPLVTWIVQYTPPSSAAEYVHRVGRTARIGGRGSSLLFLTPAETAFISEL-ANHNISLSEMKLQEILSCLMLDDTYRGRGKYYSKTSSKALEQEVRERATVLQTEFENFVHSDAQSLQAAKKALQSYLRAYTTYPAH-LKHIFHIRFLHLGHAAKSFGLRDAP 694          
BLAST of SMED30027652 vs. Planmine SMEST
Match: SMESG000009812.1 (SMESG000009812.1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 419/421 (99.52%), Postives = 421/421 (100.00%), Query Frame = -1
Query:  344 AIEEIDEKAKSIKSLKSTKKATEEINXXXXXXXXXKSTEKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSVXXXXXXXXXXXXXXXXXEAMEVGEEDEENITKK 1606
            AIEEIDEKAKSIKSLKSTKKATEEINKKAKLIKLLKSTEKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILS+LLRKRIFLAFHKKIKSKREKIFKLFKEMKSGVMLCTDVMARGIDIPDI+WVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSVRKIREKTRIIKRERREIEAMEVGEEDEENITKK
Sbjct:  166 AIEEIDEKAKSIKSLKSTKKATEEINKKAKLIKLLKSTEKAIKKNDEKVKFIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSLLLRKRIFLAFHKKIKSKREKIFKLFKEMKSGVMLCTDVMARGIDIPDIDWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSVRKIREKTRIIKRERREIEAMEVGEEDEENITKK 586          

HSP 2 Score: 197.978 bits (502), Expect = 2.868e-55
Identity = 101/103 (98.06%), Postives = 102/103 (99.03%), Query Frame = -2
Query:   10 RVIKQVRNSSDAMEVEIDVDEKVQNKSSNANKKEGGNLGTGNQNKRKTLTDNSKSQSKKMKVNSSEKSEGDEEAKTKSNTKKIVKIPIDGKGILASFNKPNKM 318
            RVIKQVRNSSDAMEVEIDVDEKVQNKSS ANKK+GGNLGTGNQNKRKTLTDNSKSQSKKMKVNSSEKSEGDEEAKTKSNTKKIVKIPIDGKGILASFNKPNKM
Sbjct:  595 RVIKQVRNSSDAMEVEIDVDEKVQNKSSKANKKKGGNLGTGNQNKRKTLTDNSKSQSKKMKVNSSEKSEGDEEAKTKSNTKKIVKIPIDGKGILASFNKPNKM 697          
BLAST of SMED30027652 vs. Planmine SMEST
Match: SMESG000060345.1 (SMESG000060345.1)

HSP 1 Score: 144.436 bits (363), Expect = 4.107e-37
Identity = 95/336 (28.27%), Postives = 168/336 (50.00%), Query Frame = -1
Query:  527 EILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSAT-----------------------QTTEVENLIRAGLR----------NPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHXXXXXXXXXXX-KLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLANSFGLLRIPQM 1432
            + LI+DEADRL+E GF +++  I++ LPK+R T LFSAT                        +TE + L  A L           +  ++   V  G+ + ++      ++  Y++ +  ++  +L  F++  + KKI++FM+TC  V Y+  + +++      LA H K    +     + F E ++ ++ CTDV ARG+DIP ++WV+Q+DPP     ++HR GRTAR    G+ L+ LR  E  ++  L +N+ V + EF+  FD  ++   +   + +  ++  L   + + F  +V  Y    L   F +  L++  LA +FGL   P +
Sbjct:  165 QTLIIDEADRLMEQGFLEEMTAIVRKLPKKRQTVLFSATLKMSSAKLKMKMKKPEIDKRSSKVSTEEKVLTLACLSMKENCMLIDMSKEKLEANVVGGDNATVSQ-----LSQGYVVCKPSDRFRLLYTFIKKNQKKKIMVFMSTCLEVKYFYELFNII--NVPVLALHGKQSQPKRLKNFEKFNENEAAIIFCTDVAARGLDIPLVDWVLQYDPPDDPKEYIHRVGRTARAGNAGQALIFLRPEETDFLSLLAKNK-VPVTEFE--FDESKMLPIQESYEKIVESNSALQHSAKSGFTTFVRAYCSFSLS-CFDVHKLDLAALAKTFGLKEPPHV 489          
BLAST of SMED30027652 vs. Planmine SMEST
Match: SMESG000080928.1 (SMESG000080928.1)

HSP 1 Score: 139.428 bits (350), Expect = 3.069e-35
Identity = 104/334 (31.14%), Postives = 164/334 (49.10%), Query Frame = -1
Query:  518 SLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTTEVENLIRAGLRNPVRISVKVKHGEESDLND-NLPKNMTNYYMLVEKENKIDILVKFLEDKKDKKILIFMATCDSVDYYKSILS--------------MLLRKRIFLAFHXXXXXXXXXXXKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESYETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKY--------IFKLSNLNIGKLANSFGLLRIP-QMAEL 1447
            +L +   L++DE D L+E  F  ++ +++ SLPK R+T LFSATQ ++ E   R  L  P  I +        D N   +PKN+   YM +E  +KI  L   LE + D  I++F +T   V Y   + +              M L KRIF + H              K  K  V+  TD+ +RG+D P ++ VVQ+D P+   ++VHR GRTAR    G ++L++  SE  ++ FL+E +N+ +K+   +       +   +       +  L++ + N+F+AY+  Y K   KY        IF +  LN+ K A SFG   IP ++ EL
Sbjct:  152 NLSNLRYLVIDETDYLMEKNFFIEMESLLNSLPKDRVTWLFSATQISDDEQFKRLSLNCPDFIGI--------DSNKIMIPKNLVQTYMKIELHDKIQALWNLLEAQNDANIIVFFSTQKQVLYMYRLFTSLNPPYKVLQLRSNMRLDKRIF-SVHS-----------FGKSNKGCVLFATDIASRGLDFPRVSLVVQYDLPKDFDDYVHRSGRTARFNARGLSVLMIMPSEVGFLSFLKE-KNITLKQISGNILKSGHHNIAEKAAIKYSNNVELFKMAKNAFLAYLRDYAKIPFKYQFNNKTEDIFVVKLLNVKKFARSFGFKTIPYELTEL 464          
BLAST of SMED30027652 vs. Planmine SMEST
Match: SMESG000017301.1 (SMESG000017301.1)

HSP 1 Score: 130.183 bits (326), Expect = 9.589e-32
Identity = 99/367 (26.98%), Postives = 175/367 (47.68%), Query Frame = -1
Query:  530 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRL-----TSLFSATQTTEVENLIRAGLRNPVRISVK--------VKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFL-----EDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLA------------------FHXXXXXXXXXXXKLFKEMKS---GVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLREN------QNVEMKEF--------------KASFDIEQ-IESYETRMQDLCIADRLLYEKSVNSFIAYVMFYR--KHDLKYIFKLSNLNIGKLANSFGLLRIPQ 1444
            L + + LI+DEADR+ E+G+ + +  +++ + KQR      T L SAT T  VENL    L+NPVR  V         V   EE+  + ++P  + +Y ++   + ++  L+ FL       K   K+++FMAT D V+++  +  + LR +  L                   F      + +K   +F+   +   G +L TDV +RG+D+  INWVVQ+ PP +  +++HR GRTAR    G+ LL L+ +E  Y++ L+ +      Q V ++                K++  IE+ I      ++D   +D +L   + N + + V  Y     +++  F   +L++G +A S   +  P+
Sbjct:  281 LNNLQWLIIDEADRITELGYAENVRQVMEQIKKQRQLESLQTVLISATLTKGVENLAGLALKNPVRAEVDYIGKPNNIVNPEEEAVDSFSMPIGLQHYLLVCPTKLRMVALLSFLLLKCKYGKHTGKVVVFMATQDLVEFHYQLFHVFLRNKSLLQELPNTDNTEIDQSTSVDIFQLHGGMEHDKRQAVFRNFSACSAGFLLTTDVCSRGLDMSGINWVVQYHPPGNPIDYIHRVGRTARAGSKGKALLFLQPAEVNYINHLQTSVGGLHIQKVSLRSVMETALHHSGTLRTRKSAHTIEESIFLTAKLLEDHVSSDPILQSLARNGYKSLVRSYTCFSKEMRQFFCYRDLHLGHVAKSMACMETPR 647          
BLAST of SMED30027652 vs. Planmine SMEST
Match: SMESG000017301.1 (SMESG000017301.1)

HSP 1 Score: 130.183 bits (326), Expect = 1.158e-31
Identity = 99/367 (26.98%), Postives = 175/367 (47.68%), Query Frame = -1
Query:  530 LKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRL-----TSLFSATQTTEVENLIRAGLRNPVRISVK--------VKHGEESDLNDNLPKNMTNYYMLVEKENKIDILVKFL-----EDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLA------------------FHXXXXXXXXXXXKLFKEMKS---GVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRCGRTARCEQFGETLLLLRSSEDTYVHFLREN------QNVEMKEF--------------KASFDIEQ-IESYETRMQDLCIADRLLYEKSVNSFIAYVMFYR--KHDLKYIFKLSNLNIGKLANSFGLLRIPQ 1444
            L + + LI+DEADR+ E+G+ + +  +++ + KQR      T L SAT T  VENL    L+NPVR  V         V   EE+  + ++P  + +Y ++   + ++  L+ FL       K   K+++FMAT D V+++  +  + LR +  L                   F      + +K   +F+   +   G +L TDV +RG+D+  INWVVQ+ PP +  +++HR GRTAR    G+ LL L+ +E  Y++ L+ +      Q V ++                K++  IE+ I      ++D   +D +L   + N + + V  Y     +++  F   +L++G +A S   +  P+
Sbjct:  286 LNNLQWLIIDEADRITELGYAENVRQVMEQIKKQRQLESLQTVLISATLTKGVENLAGLALKNPVRAEVDYIGKPNNIVNPEEEAVDSFSMPIGLQHYLLVCPTKLRMVALLSFLLLKCKYGKHTGKVVVFMATQDLVEFHYQLFHVFLRNKSLLQELPNTDNTEIDQSTSVDIFQLHGGMEHDKRQAVFRNFSACSAGFLLTTDVCSRGLDMSGINWVVQYHPPGNPIDYIHRVGRTARAGSKGKALLFLQPAEVNYINHLQTSVGGLHIQKVSLRSVMETALHHSGTLRTRKSAHTIEESIFLTAKLLEDHVSSDPILQSLARNGYKSLVRSYTCFSKEMRQFFCYRDLHLGHVAKSMACMETPR 652          
The following BLAST results are available for this feature:
BLAST of SMED30027652 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX551.869e-9945.11DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX551.638e-7139.08DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX181.393e-5235.05DEAD-box helicase 18 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX101.842e-4835.22DEAD-box helicase 10 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX105.646e-4835.22DEAD-box helicase 10 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK512.22.642e-7338.60Probable ATP-dependent RNA helicase DDX55 homolog ... [more]
ZK512.21.387e-7238.60Probable ATP-dependent RNA helicase DDX55 homolog ... [more]
B0511.63.018e-4731.31RNA helicase [Source:UniProtKB/TrEMBL;Acc:O61815][more]
Y23H5B.61.135e-4532.47RNA helicase [Source:UniProtKB/TrEMBL;Acc:A0A061A... [more]
T26G10.11.020e-3135.75Putative ATP-dependent RNA helicase T26G10.1 [Sou... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG96301.842e-8641.74gene:FBgn0037561 transcript:FBtr0081866[more]
pit7.693e-5235.05gene:FBgn0266581 transcript:FBtr0084174[more]
pit7.693e-5235.05gene:FBgn0266581 transcript:FBtr0346345[more]
pit7.693e-5235.05gene:FBgn0266581 transcript:FBtr0084175[more]
CG58001.769e-3931.97gene:FBgn0030855 transcript:FBtr0074453[more]
back to top
BLAST of SMED30027652 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx552.969e-9744.13DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
ddx182.824e-5334.80DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
ddx104.252e-4333.44DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 [Source:... [more]
ddx315.895e-3428.93DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Source:... [more]
CR381654.17.088e-3428.93DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Source:... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx556.219e-10045.45DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
ddx556.918e-10045.45DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
ddx551.251e-9945.45DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
ddx551.299e-9945.45DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
ddx551.313e-9945.45DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx554.816e-9945.98DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
Ddx551.386e-9845.98DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
Ddx182.190e-5235.16DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
Ddx108.184e-4634.43DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 [Source:... [more]
Ddx311.215e-3428.16DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31 [S... [more]
back to top
BLAST of SMED30027652 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NHQ9|DDX55_HUMAN8.976e-9945.11ATP-dependent RNA helicase DDX55 OS=Homo sapiens O... [more]
sp|Q6ZPL9|DDX55_MOUSE3.369e-9845.98ATP-dependent RNA helicase DDX55 OS=Mus musculus O... [more]
sp|Q2NL08|DDX55_BOVIN1.106e-9745.11ATP-dependent RNA helicase DDX55 OS=Bos taurus OX=... [more]
sp|Q6AZV7|DDX55_XENLA4.225e-9745.74ATP-dependent RNA helicase DDX55 OS=Xenopus laevis... [more]
sp|Q8JHJ2|DDX55_DANRE6.171e-9744.41ATP-dependent RNA helicase DDX55 OS=Danio rerio OX... [more]
back to top
BLAST of SMED30027652 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433T8813.897e-10850.90RNA helicase OS=Elysia chlorotica OX=188477 GN=EGW... [more]
A0A0X3NVN85.510e-10745.08RNA helicase (Fragment) OS=Schistocephalus solidus... [more]
A0A068XVZ81.776e-10650.14RNA helicase OS=Echinococcus multilocularis OX=621... [more]
A0A2T7PD152.509e-10549.70RNA helicase OS=Pomacea canaliculata OX=400727 GN=... [more]
A0A068WUS95.863e-10548.75RNA helicase OS=Echinococcus granulosus OX=6210 GN... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx557.470e-6537.25DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
ddx182.045e-5235.94DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
ddx109.434e-4533.77DEAD-box helicase 10 [Source:NCBI gene;Acc:1030362... [more]
ddx109.436e-4533.77DEAD-box helicase 10 [Source:NCBI gene;Acc:1030362... [more]
ddx101.038e-4433.77DEAD-box helicase 10 [Source:NCBI gene;Acc:1030362... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx551.590e-9844.83DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
ENSPMAT00000010109.12.658e-4237.13pep scaffold:Pmarinus_7.0:GL476492:615610:626431:-... [more]
ENSPMAT00000000216.11.107e-3033.80pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
DDX541.396e-2432.88DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
ddx491.512e-2131.60DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SPB42.381e-5333.23Putative ATP-dependent RNA helicase; nucleolar pro... [more]
HAS12.874e-5333.33ATP-dependent RNA helicase; involved in the biogen... [more]
HCA44.348e-3229.35DEAD box RNA helicase; component of the SSU; inter... [more]
DRS19.145e-2828.91Nucleolar DEAD-box protein required for ribosome a... [more]
RRP31.731e-2634.40Protein involved in rRNA processing; required for ... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413352.844e-9944.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387311.478e-5234.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419691.757e-4333.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362463.570e-3628.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335931.344e-2732.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027652 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx551.753e-10144.70DEAD-box helicase 55 [Source:NCBI gene;Acc:1011616... [more]
ddx181.688e-5235.46DEAD-box helicase 18 [Source:NCBI gene;Acc:1011581... [more]
ddx102.224e-4433.11DEAD-box helicase 10 [Source:NCBI gene;Acc:1011614... [more]
ddx311.701e-3729.97DEAD-box helicase 31 [Source:NCBI gene;Acc:1011581... [more]
ddx312.019e-3729.97DEAD-box helicase 31 [Source:NCBI gene;Acc:1011581... [more]
back to top
BLAST of SMED30027652 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009812.12.868e-5599.52SMESG000009812.1[more]
SMESG000060345.14.107e-3728.27SMESG000060345.1[more]
SMESG000080928.13.069e-3531.14SMESG000080928.1[more]
SMESG000017301.19.589e-3226.98SMESG000017301.1[more]
SMESG000017301.11.158e-3126.98SMESG000017301.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027652 ID=SMED30027652|Name=SMED30027652|organism=Schmidtea mediterranea sexual|type=transcript|length=1606bp
ATTTATTTACATTTTATTAGGCTTATTGAAACTTGCCAAAATTCCTTTTC
CATCAATAGGAATTTTAACTATTTTCTTTGTATTTGATTTAGTTTTAGCC
TCTTCATCGCCTTCCGATTTTTCAGATGAATTCACCTTCATTTTTTTTGA
CTGAGATTTTGAATTATCAGTCAATGTCTTTCGTTTATTTTGATTGCCTG
TTCCTAAATTTCCTCCTTCTTTCTTATTGGCGTTGCTTGATTTATTCTGA
ACTTTTTCATCCACATCTATTTCCACTTCCATTGCATCAGAACTGTTTCG
TACTTGTTTAATGACTCTATTTTTCTTATTGGATTTAACTTGTTTTTTTG
GTGATATTTTCTTCATCTTCTTCACCCACTTCCATAGCTTCAATTTCTCT
TCGTTCTCGTTTAATTATTCTAGTTTTCTCTCGAATTTTTCTGACACTTT
TATCTTTGTAAATCAAAGTTTTTAGATCGACATCCCTTTTATGGAAATCA
GATAGATCGACACCTTTCAATTCGGCCATTTGTGGAATTCTTAAGAGCCC
GAAACTATTTGCAAGTTTTCCAATATTAAGATTGGATAGCTTGAAAATAT
ATTTCAAATCATGTTTCCGATAGAACATGACATATGCAATGAAAGAGTTG
ACACTTTTCTCGTATAGCAAACGGTCAGCAATGCACAAATCTTGCATTCG
AGTTTCATAAGATTCAATTTGTTCAATATCGAAGCTTGCTTTGAATTCTT
TCATTTCAACATTTTGGTTTTCGCGCAGAAAATGCACATATGTATCTTCG
GACGATCGGAGTAGTAATAAAGTTTCACCGAATTGTTCGCATCGAGCTGT
TCTACCACAGCGATGGACAAAGTTAGTTGCGGACTGTGGAGGATCAAACT
GAACGACCCAGTTAATGTCTGGAATATCAATACCTCTCGCCATAACGTCA
GTGCAAAGCATTACACCTGATTTCATTTCTTTAAATAGCTTAAATATCTT
TTCTCTTTTGGATTTAATTTTTTTATGAAAAGCCAAGAAAATTCGTTTCC
TTAATAGCATTGATAAAATTGATTTGTAATAATCCACACTATCACAAGTG
GCCATGAATATTAATATTTTTTTATCCTTTTTATCTTCGAGAAATTTGAC
AAGGATGTCGATTTTGTTTTCCTTCTCTACCAGCATATAATAGTTTGTCA
TATTTTTTGGTAAGTTGTCGTTTAAATCCGATTCTTCTCCGTGTTTGACT
TTAACACTAATCCTAACTGGATTTCTTAAACCGGCTCTAATTAAATTTTC
AACTTCTGTCGTTTGAGTAGCACTAAATAAGCTAGTTAATCTCTGCTTTG
GAAGACTTTTGATAATTGTCATCAATTGATCTTCAAAACCCATTTCTAGC
AATCTATCAGCTTCATCCAAAATCAAAATTTCTGTTGACTTTAATGATTT
AATAAATTTGACCTTTTCGTCATTTTTTTTGATGGCTTTTTCTGTTGACT
TTAATAATTTAATCAATTTGGCCTTTTTGTTGATTTCTTCAGTGGCTTTT
TTTGTTGACTTTAATGATTTAATCGATTTGGCCTTTTCGTCAATTTCTTC
GATGGC
back to top

protein sequence of SMED30027652-orf-1

>SMED30027652-orf-1 ID=SMED30027652-orf-1|Name=SMED30027652-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
AIEEIDEKAKSIKSLKSTKKATEEINKKAKLIKLLKSTEKAIKKNDEKVK
FIKSLKSTEILILDEADRLLEMGFEDQLMTIIKSLPKQRLTSLFSATQTT
EVENLIRAGLRNPVRISVKVKHGEESDLNDNLPKNMTNYYMLVEKENKID
ILVKFLEDKKDKKILIFMATCDSVDYYKSILSMLLRKRIFLAFHKKIKSK
REKIFKLFKEMKSGVMLCTDVMARGIDIPDINWVVQFDPPQSATNFVHRC
GRTARCEQFGETLLLLRSSEDTYVHFLRENQNVEMKEFKASFDIEQIESY
ETRMQDLCIADRLLYEKSVNSFIAYVMFYRKHDLKYIFKLSNLNIGKLAN
SFGLLRIPQMAELKGVDLSDFHKRDVDLKTLIYKDKSVRKIREKTRIIKR
ERREIEAMEVGEEDEENITKKTS*
back to top

protein sequence of SMED30027652-orf-2

>SMED30027652-orf-2 ID=SMED30027652-orf-2|Name=SMED30027652-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MKKISPKKQVKSNKKNRVIKQVRNSSDAMEVEIDVDEKVQNKSSNANKKE
GGNLGTGNQNKRKTLTDNSKSQSKKMKVNSSEKSEGDEEAKTKSNTKKIV
KIPIDGKGILASFNKPNKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR025313DUF4217
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014001Helicase_ATP-bd
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 179..257
e-value: 1.0E-18
score: 78.2
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 147..256
e-value: 2.8E-23
score: 82.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 148..305
score: 17.764
IPR025313Domain of unknown function DUF4217SMARTSM01178DUF4217_3coord: 299..362
e-value: 2.9E-18
score: 76.7
IPR025313Domain of unknown function DUF4217PFAMPF13959DUF4217coord: 303..360
e-value: 2.1E-18
score: 66.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 9..124
e-value: 3.2E-21
score: 77.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 134..368
e-value: 5.1E-47
score: 162.5
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 47..405
NoneNo IPR availablePANTHERPTHR24031:SF2ATP-DEPENDENT RNA HELICASE DDX55coord: 47..405
NoneNo IPR availableCDDcd17960DEADc_DDX55coord: 42..117
e-value: 6.64294E-33
score: 121.144
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 137..266
e-value: 5.70583E-39
score: 134.557
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 12..105
e-value: 3.1E-10
score: 40.1
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 62..70
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 1..116
score: 14.439
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 56..267