Transcription factor BTF3 homolog

Overview
NameTranscription factor BTF3 homolog
Smed IDSMED30027646
Uniprot Best hitTranscription factor BTF3 homolog OS=Caenorhabditis elegans GN=icd-1 PE=1 SV=1 (E=5.65448e-29)
Length (bp)541
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor BTF3 homolog (SMED30027646) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor BTF3 homolog (SMED30027646) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Transcription factor BTF3 homolog vs. Ensembl Human
Match: BTF3L4 (basic transcription factor 3-like 4 [Source:HGNC Symbol;Acc:HGNC:30547])

HSP 1 Score: 96.2857 bits (238), Expect = 2.647e-24
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Human
Match: BTF3L4 (basic transcription factor 3-like 4 [Source:HGNC Symbol;Acc:HGNC:30547])

HSP 1 Score: 95.9005 bits (237), Expect = 4.158e-24
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Human
Match: BTF3 (basic transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:1125])

HSP 1 Score: 94.3597 bits (233), Expect = 1.701e-23
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 129          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Human
Match: BTF3 (basic transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:1125])

HSP 1 Score: 93.9745 bits (232), Expect = 6.389e-23
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:   53 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 173          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Human
Match: BTF3 (basic transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:1125])

HSP 1 Score: 74.7146 bits (182), Expect = 6.096e-17
Identity = 34/70 (48.57%), Postives = 47/70 (67.14%), Query Frame = 1
Query:  220 VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q
Sbjct:    2 IEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQ 71          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Celegans
Match: icd-1 (Transcription factor BTF3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18885])

HSP 1 Score: 110.923 bits (276), Expect = 4.146e-30
Identity = 69/120 (57.50%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++ KQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Celegans
Match: icd-1 (Transcription factor BTF3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18885])

HSP 1 Score: 110.923 bits (276), Expect = 4.146e-30
Identity = 69/120 (57.50%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++ KQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Fly
Match: bic (bicaudal [Source:FlyBase gene name;Acc:FBgn0000181])

HSP 1 Score: 94.7449 bits (234), Expect = 6.914e-24
Identity = 60/114 (52.63%), Postives = 81/114 (71.05%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIA 411
            EKL KL   VR GGKGT RRKKK++  + A DDKKL+++ K LS++ +P +EEVN+ K+DGTVI+F NPK   SLP NT ++TG  E K +TE++P +  QLGP   +  KK+A
Sbjct:    4 EKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGTVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLA 117          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Fly
Match: bic (bicaudal [Source:FlyBase gene name;Acc:FBgn0000181])

HSP 1 Score: 94.7449 bits (234), Expect = 6.914e-24
Identity = 60/114 (52.63%), Postives = 81/114 (71.05%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIA 411
            EKL KL   VR GGKGT RRKKK++  + A DDKKL+++ K LS++ +P +EEVN+ K+DGTVI+F NPK   SLP NT ++TG  E K +TE++P +  QLGP   +  KK+A
Sbjct:    4 EKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGTVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLA 117          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Fly
Match: CG11835 (pep:known chromosome:BDGP6:2L:560568:563347:-1 gene:FBgn0031264 transcript:FBtr0332341 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG11835)

HSP 1 Score: 84.3445 bits (207), Expect = 2.008e-18
Identity = 56/104 (53.85%), Postives = 76/104 (73.08%), Query Frame = 1
Query:   70 LEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            +EKL +L   VR GGKGT RRKKKV+ +++A DDKKL+++ K LS+S +P +EEVN+ KDD TVI+F NPK   SL  NT +VTG  E +++ E+LP +  QLG
Sbjct:    3 VEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLG 106          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Fly
Match: CG11835 (pep:known chromosome:BDGP6:2L:560568:563347:-1 gene:FBgn0031264 transcript:FBtr0078076 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG11835)

HSP 1 Score: 84.3445 bits (207), Expect = 2.008e-18
Identity = 56/104 (53.85%), Postives = 76/104 (73.08%), Query Frame = 1
Query:   70 LEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            +EKL +L   VR GGKGT RRKKKV+ +++A DDKKL+++ K LS+S +P +EEVN+ KDD TVI+F NPK   SL  NT +VTG  E +++ E+LP +  QLG
Sbjct:    3 VEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLG 106          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Fly
Match: CG11835 (pep:known chromosome:BDGP6:2L:560568:563819:-1 gene:FBgn0031264 transcript:FBtr0345577 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG11835)

HSP 1 Score: 84.3445 bits (207), Expect = 2.008e-18
Identity = 56/104 (53.85%), Postives = 76/104 (73.08%), Query Frame = 1
Query:   70 LEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            +EKL +L   VR GGKGT RRKKKV+ +++A DDKKL+++ K LS+S +P +EEVN+ KDD TVI+F NPK   SL  NT +VTG  E +++ E+LP +  QLG
Sbjct:    3 VEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLG 106          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Zebrafish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1650])

HSP 1 Score: 99.3673 bits (246), Expect = 1.426e-25
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Zebrafish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1650])

HSP 1 Score: 99.3673 bits (246), Expect = 1.426e-25
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Zebrafish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1650])

HSP 1 Score: 99.3673 bits (246), Expect = 1.925e-25
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:   16 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 135          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Zebrafish
Match: btf3 (basic transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8731])

HSP 1 Score: 95.9005 bits (237), Expect = 3.117e-24
Identity = 61/121 (50.41%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  QA
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQA 129          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Zebrafish
Match: btf3 (basic transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8731])

HSP 1 Score: 95.9005 bits (237), Expect = 3.117e-24
Identity = 61/121 (50.41%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  QA
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQA 129          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Xenopus
Match: btf3l4 (basic transcription factor 3-like 4 [Source:Xenbase;Acc:XB-GENE-948236])

HSP 1 Score: 100.908 bits (250), Expect = 1.528e-26
Identity = 62/120 (51.67%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Xenopus
Match: btf3l4 (basic transcription factor 3-like 4 [Source:Xenbase;Acc:XB-GENE-948236])

HSP 1 Score: 101.293 bits (251), Expect = 2.209e-26
Identity = 64/128 (50.00%), Postives = 90/128 (70.31%), Query Frame = 1
Query:   49 FKINTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            + IN  + EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:   20 YSINMNQ-EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 146          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Xenopus
Match: btf3 (basic transcription factor 3 [Source:Xenbase;Acc:XB-GENE-985803])

HSP 1 Score: 92.0485 bits (227), Expect = 9.284e-23
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:   56 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 176          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 2.743e-24
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 2.743e-24
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 2.743e-24
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 2.743e-24
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. Ensembl Mouse
Match: Btf3 (basic transcription factor 3 [Source:MGI Symbol;Acc:MGI:1202875])

HSP 1 Score: 94.3597 bits (233), Expect = 1.122e-23
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 129          
BLAST of Transcription factor BTF3 homolog vs. UniProt
Match: sp|Q18885|BTF3_CAEEL (Transcription factor BTF3 homolog OS=Caenorhabditis elegans GN=icd-1 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.654e-29
Identity = 69/120 (57.50%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++ KQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 homolog vs. UniProt
Match: sp|Q0CGL5|NACB_ASPTN (Nascent polypeptide-associated complex subunit beta OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd1 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.772e-26
Identity = 48/95 (50.53%), Postives = 70/95 (73.68%), Query Frame = 1
Query:  145 IVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMEN 426
            + KSS ADDKKL+AT K +++ P+P VEEVNMFK+DG VI+F NP+V+ S+P NT ++ G  E K+LTE++P +  QLGP      +K+A++ +N
Sbjct:   40 VHKSSGADDKKLQATLKKMNVQPIPAVEEVNMFKEDGNVIHFGNPRVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQN 134          
BLAST of Transcription factor BTF3 homolog vs. UniProt
Match: sp|Q5M8V0|BT3L4_XENTR (Transcription factor BTF3 homolog 4 OS=Xenopus tropicalis GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.485e-25
Identity = 62/120 (51.67%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. UniProt
Match: sp|Q4KLF5|BT3L4_XENLA (Transcription factor BTF3 homolog 4 OS=Xenopus laevis GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.485e-25
Identity = 62/120 (51.67%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. UniProt
Match: sp|Q6PC91|BT3L4_DANRE (Transcription factor BTF3 homolog 4 OS=Danio rerio GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.247e-24
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 homolog vs. TrEMBL
Match: tr|A0A1I7TUX6|A0A1I7TUX6_9PELO (Uncharacterized protein OS=Caenorhabditis tropicalis PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.168e-28
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++IKQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADIKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 homolog vs. TrEMBL
Match: tr|J3JVT8|J3JVT8_DENPD (Transcription factor BTF3 OS=Dendroctonus ponderosae PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 8.943e-28
Identity = 71/126 (56.35%), Postives = 94/126 (74.60%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL + +E VRTGGKGT RRKKKV+ K++A DDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT S+TG +E KQ+TE+LP +  QLG       KK+A N+ NQ
Sbjct:    1 MNAEKIKKLQQNAEQVRTGGKGTARRKKKVVHKTAANDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFHNPKVQASVPANTFSITGSAENKQITEMLPGILNQLGAESLTHLKKLANNVTNQ 126          
BLAST of Transcription factor BTF3 homolog vs. TrEMBL
Match: tr|A0A1I7S300|A0A1I7S300_BURXY (Uncharacterized protein OS=Bursaphelenchus xylophilus PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 9.609e-28
Identity = 71/126 (56.35%), Postives = 93/126 (73.81%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL   SE VRTGGKGT RRKKK++ K++A DDKKL++  K LS++ +P +EEVNM KDDG+VI+F NPKV  S+P NT SVTG +E KQLTE+LP +  QLG       KK+A N+ +Q
Sbjct:    1 MNAEKIKKLQAASEAVRTGGKGTARRKKKIVHKTAATDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGSVIHFNNPKVQASVPANTFSVTGTAENKQLTEMLPGILNQLGAESLTHLKKLANNVTSQ 126          
BLAST of Transcription factor BTF3 homolog vs. TrEMBL
Match: tr|A0A044QWE6|A0A044QWE6_ONCVO (Transcription factor BTF3 OS=Onchocerca volvulus GN=WBGene00247475 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.201e-27
Identity = 71/126 (56.35%), Postives = 93/126 (73.81%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL + +  VRTGGKGT RRKKKV+ K++A DDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG +E KQ+TE+LP +  QLG       KK+A N+ NQ
Sbjct:    1 MNVEKIKKLQQNAAQVRTGGKGTARRKKKVVHKTAATDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQASVPANTFSVTGSAENKQITEMLPGILNQLGAESLTHLKKLANNVTNQ 126          
BLAST of Transcription factor BTF3 homolog vs. TrEMBL
Match: tr|A0A182DWS6|A0A182DWS6_ONCOC (Transcription factor BTF3 OS=Onchocerca ochengi PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.201e-27
Identity = 71/126 (56.35%), Postives = 93/126 (73.81%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL + +  VRTGGKGT RRKKKV+ K++A DDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG +E KQ+TE+LP +  QLG       KK+A N+ NQ
Sbjct:    1 MNVEKIKKLQQNAAQVRTGGKGTARRKKKVVHKTAATDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQASVPANTFSVTGSAENKQITEMLPGILNQLGAESLTHLKKLANNVTNQ 126          
The following BLAST results are available for this feature:
BLAST of Transcription factor BTF3 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
BTF3L42.647e-2450.83basic transcription factor 3-like 4 [Source:HGNC S... [more]
BTF3L44.158e-2450.83basic transcription factor 3-like 4 [Source:HGNC S... [more]
BTF31.701e-2349.59basic transcription factor 3 [Source:HGNC Symbol;A... [more]
BTF36.389e-2349.59basic transcription factor 3 [Source:HGNC Symbol;A... [more]
BTF36.096e-1748.57basic transcription factor 3 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 2
Match NameE-valueIdentityDescription
icd-14.146e-3057.50Transcription factor BTF3 homolog [Source:UniProt... [more]
icd-14.146e-3057.50Transcription factor BTF3 homolog [Source:UniProt... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
bic6.914e-2452.63bicaudal [Source:FlyBase gene name;Acc:FBgn0000181... [more]
bic6.914e-2452.63bicaudal [Source:FlyBase gene name;Acc:FBgn0000181... [more]
CG118352.008e-1853.85pep:known chromosome:BDGP6:2L:560568:563347:-1 gen... [more]
CG118352.008e-1853.85pep:known chromosome:BDGP6:2L:560568:563347:-1 gen... [more]
CG118352.008e-1853.85pep:known chromosome:BDGP6:2L:560568:563819:-1 gen... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
btf3l41.426e-2552.50basic transcription factor 3-like 4 [Source:ZFIN;A... [more]
btf3l41.426e-2552.50basic transcription factor 3-like 4 [Source:ZFIN;A... [more]
btf3l41.925e-2552.50basic transcription factor 3-like 4 [Source:ZFIN;A... [more]
btf33.117e-2450.41basic transcription factor 3 [Source:ZFIN;Acc:ZDB-... [more]
btf33.117e-2450.41basic transcription factor 3 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 3
Match NameE-valueIdentityDescription
btf3l41.528e-2651.67basic transcription factor 3-like 4 [Source:Xenbas... [more]
btf3l42.209e-2650.00basic transcription factor 3-like 4 [Source:Xenbas... [more]
btf39.284e-2349.59basic transcription factor 3 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Btf3l42.743e-2450.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf3l42.743e-2450.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf3l42.743e-2450.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf3l42.743e-2450.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf31.122e-2349.59basic transcription factor 3 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18885|BTF3_CAEEL5.654e-2957.50Transcription factor BTF3 homolog OS=Caenorhabditi... [more]
sp|Q0CGL5|NACB_ASPTN5.772e-2650.53Nascent polypeptide-associated complex subunit bet... [more]
sp|Q5M8V0|BT3L4_XENTR2.485e-2551.67Transcription factor BTF3 homolog 4 OS=Xenopus tro... [more]
sp|Q4KLF5|BT3L4_XENLA2.485e-2551.67Transcription factor BTF3 homolog 4 OS=Xenopus lae... [more]
sp|Q6PC91|BT3L4_DANRE1.247e-2452.50Transcription factor BTF3 homolog 4 OS=Danio rerio... [more]
back to top
BLAST of Transcription factor BTF3 homolog vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A1I7TUX6|A0A1I7TUX6_9PELO5.168e-2858.33Uncharacterized protein OS=Caenorhabditis tropical... [more]
tr|J3JVT8|J3JVT8_DENPD8.943e-2856.35Transcription factor BTF3 OS=Dendroctonus ponderos... [more]
tr|A0A1I7S300|A0A1I7S300_BURXY9.609e-2856.35Uncharacterized protein OS=Bursaphelenchus xylophi... [more]
tr|A0A044QWE6|A0A044QWE6_ONCVO3.201e-2756.35Transcription factor BTF3 OS=Onchocerca volvulus G... [more]
tr|A0A182DWS6|A0A182DWS6_ONCOC3.201e-2756.35Transcription factor BTF3 OS=Onchocerca ochengi PE... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
IPR002715Nascent polypeptide-associated complex NAC domainSMARTSM01407NAC_2coord: 47..102
e-value: 7.6E-17
score: 72.0
IPR002715Nascent polypeptide-associated complex NAC domainPFAMPF01849NACcoord: 47..102
e-value: 2.0E-15
score: 56.4
IPR002715Nascent polypeptide-associated complex NAC domainPROSITEPS51151NAC_ABcoord: 44..108
score: 14.165

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002715Nas_poly-pep-assoc_cplx_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0009792embryo development ending in birth or egg hatching
GO:0043066negative regulation of apoptotic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0004517blastomere
PLANA:0000029primitive ectoderm
PLANA:0000058embryonic digestive system
PLANA:0000212blastomere compartment
PLANA:0000023temporary embryonic pharynx
PLANA:0000211primitive ectoderm cell
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000002Stage 2
PLANA:0000004Stage 4
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027646 ID=SMED30027646|Name=Transcription factor BTF3 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=541bp
AAATTAATTTGTTTAAATAAATTTCTTTAGAATCACGCAATGGACGGTTT
TAAAATTAACACTGAAAAATTAGAAAAACTTAGTAAGTTGTCGGAAAATG
TCCGAACAGGTGGTAAAGGTACAATGAGACGAAAGAAGAAGGTCATTGTC
AAGAGTTCAGCAGCAGATGATAAGAAATTAGAGGCAACCTTCAAATCATT
GTCAATGAGCCCGGTTCCAGTTGAAGAAGTAAACATGTTCAAGGATGATG
GAACTGTTATTAATTTCGTTAATCCAAAAGTCAATGTGTCACTTCCATGC
AACACTCTCTCAGTTACTGGAAAATCCGAAATTAAGCAATTGACCGAAAT
ACTTCCAAAAGTTTGGCAACAACTTGGCCCACTTAAAGGAGATCTTTTCA
AGAAAATTGCACAAAACATGGAAAATCAAGCAACTGTCGAAGATATTGAT
GATGAAGACGATGACGTTCCAACTCTCGTCACAGACTTCGATCAACAAAG
CAAATTGGAATAACTTTTTAATATCAATAAATTTTTTGGAC
back to top

protein sequence of SMED30027646-orf-1

>SMED30027646-orf-1 ID=SMED30027646-orf-1|Name=SMED30027646-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=158bp
MDGFKINTEKLEKLSKLSENVRTGGKGTMRRKKKVIVKSSAADDKKLEAT
FKSLSMSPVPVEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQ
LTEILPKVWQQLGPLKGDLFKKIAQNMENQATVEDIDDEDDDVPTLVTDF
DQQSKLE*
back to top
Aliases
The feature 'Transcription factor BTF3 homolog' has the following synonyms
Synonym
BTF3-like