Transcription factor BTF3

Overview
NameTranscription factor BTF3
Smed IDSMED30027646
Uniprot Best hitTranscription factor BTF3 homolog OS=Caenorhabditis elegans OX=6239 GN=icd-1 PE=1 SV=1 (E=5.51915e-30)
Length (bp)541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor BTF3 (SMED30027646) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor BTF3 (SMED30027646) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Transcription factor BTF3 ( BTF3-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system, embryonic pharynx, primitive ectoderm cell, primitive ectoderm and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30027646

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
primitive ectodermSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
primitive ectodermSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30027646SMESG000008919.1 SMED30027646smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor BTF3 vs. Ensembl Human
Match: BTF3L4 (basic transcription factor 3 like 4 [Source:HGNC Symbol;Acc:HGNC:30547])

HSP 1 Score: 96.2857 bits (238), Expect = 3.641e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Human
Match: BTF3L4 (basic transcription factor 3 like 4 [Source:HGNC Symbol;Acc:HGNC:30547])

HSP 1 Score: 95.9005 bits (237), Expect = 6.025e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Human
Match: BTF3 (basic transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:1125])

HSP 1 Score: 94.3597 bits (233), Expect = 2.613e-24
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 129          
BLAST of Transcription factor BTF3 vs. Ensembl Human
Match: BTF3 (basic transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:1125])

HSP 1 Score: 93.9745 bits (232), Expect = 1.226e-23
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:   53 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 173          
BLAST of Transcription factor BTF3 vs. Ensembl Human
Match: BTF3 (basic transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:1125])

HSP 1 Score: 74.7146 bits (182), Expect = 1.388e-17
Identity = 34/70 (48.57%), Postives = 47/70 (67.14%), Query Frame = 1
Query:  220 VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q
Sbjct:    2 IEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQ 71          
BLAST of Transcription factor BTF3 vs. Ensembl Celegans
Match: icd-1 (Transcription factor BTF3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18885])

HSP 1 Score: 110.923 bits (276), Expect = 4.339e-31
Identity = 69/120 (57.50%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++ KQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 vs. Ensembl Celegans
Match: icd-1 (Transcription factor BTF3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18885])

HSP 1 Score: 110.923 bits (276), Expect = 4.339e-31
Identity = 69/120 (57.50%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++ KQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 vs. Ensembl Fly
Match: bic (gene:FBgn0000181 transcript:FBtr0087782)

HSP 1 Score: 94.7449 bits (234), Expect = 9.939e-25
Identity = 60/114 (52.63%), Postives = 81/114 (71.05%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIA 411
            EKL KL   VR GGKGT RRKKK++  + A DDKKL+++ K LS++ +P +EEVN+ K+DGTVI+F NPK   SLP NT ++TG  E K +TE++P +  QLGP   +  KK+A
Sbjct:    4 EKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGTVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLA 117          
BLAST of Transcription factor BTF3 vs. Ensembl Fly
Match: bic (gene:FBgn0000181 transcript:FBtr0087783)

HSP 1 Score: 94.7449 bits (234), Expect = 9.939e-25
Identity = 60/114 (52.63%), Postives = 81/114 (71.05%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIA 411
            EKL KL   VR GGKGT RRKKK++  + A DDKKL+++ K LS++ +P +EEVN+ K+DGTVI+F NPK   SLP NT ++TG  E K +TE++P +  QLGP   +  KK+A
Sbjct:    4 EKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGTVIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLA 117          
BLAST of Transcription factor BTF3 vs. Ensembl Fly
Match: CG11835 (gene:FBgn0031264 transcript:FBtr0332341)

HSP 1 Score: 84.3445 bits (207), Expect = 5.065e-19
Identity = 56/104 (53.85%), Postives = 76/104 (73.08%), Query Frame = 1
Query:   70 LEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            +EKL +L   VR GGKGT RRKKKV+ +++A DDKKL+++ K LS+S +P +EEVN+ KDD TVI+F NPK   SL  NT +VTG  E +++ E+LP +  QLG
Sbjct:    3 VEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLG 106          
BLAST of Transcription factor BTF3 vs. Ensembl Fly
Match: CG11835 (gene:FBgn0031264 transcript:FBtr0332342)

HSP 1 Score: 84.3445 bits (207), Expect = 5.065e-19
Identity = 56/104 (53.85%), Postives = 76/104 (73.08%), Query Frame = 1
Query:   70 LEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            +EKL +L   VR GGKGT RRKKKV+ +++A DDKKL+++ K LS+S +P +EEVN+ KDD TVI+F NPK   SL  NT +VTG  E +++ E+LP +  QLG
Sbjct:    3 VEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLG 106          
BLAST of Transcription factor BTF3 vs. Ensembl Fly
Match: CG11835 (gene:FBgn0031264 transcript:FBtr0078076)

HSP 1 Score: 84.3445 bits (207), Expect = 5.065e-19
Identity = 56/104 (53.85%), Postives = 76/104 (73.08%), Query Frame = 1
Query:   70 LEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            +EKL +L   VR GGKGT RRKKKV+ +++A DDKKL+++ K LS+S +P +EEVN+ KDD TVI+F NPK   SL  NT +VTG  E +++ E+LP +  QLG
Sbjct:    3 VEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLG 106          
BLAST of Transcription factor BTF3 vs. Ensembl Zebrafish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:NCBI gene;Acc:393667])

HSP 1 Score: 99.3673 bits (246), Expect = 2.054e-26
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Zebrafish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:NCBI gene;Acc:393667])

HSP 1 Score: 99.3673 bits (246), Expect = 2.054e-26
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Zebrafish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:NCBI gene;Acc:393667])

HSP 1 Score: 99.3673 bits (246), Expect = 2.899e-26
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:   16 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 135          
BLAST of Transcription factor BTF3 vs. Ensembl Zebrafish
Match: btf3 (basic transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8731])

HSP 1 Score: 95.9005 bits (237), Expect = 4.993e-25
Identity = 61/121 (50.41%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  QA
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQA 129          
BLAST of Transcription factor BTF3 vs. Ensembl Zebrafish
Match: btf3 (basic transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8731])

HSP 1 Score: 95.9005 bits (237), Expect = 4.993e-25
Identity = 61/121 (50.41%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  QA
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQA 129          
BLAST of Transcription factor BTF3 vs. Ensembl Xenopus
Match: btf3l4 (basic transcription factor 3-like 4 [Source:NCBI gene;Acc:496686])

HSP 1 Score: 100.908 bits (250), Expect = 5.574e-27
Identity = 62/120 (51.67%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Xenopus
Match: ttc34 (tetratricopeptide repeat domain 34 [Source:Xenbase;Acc:XB-GENE-991680])

HSP 1 Score: 92.0485 bits (227), Expect = 5.548e-23
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:   56 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 176          
BLAST of Transcription factor BTF3 vs. Ensembl Xenopus
Match: ttc34 (tetratricopeptide repeat domain 34 [Source:Xenbase;Acc:XB-GENE-991680])

HSP 1 Score: 86.6557 bits (213), Expect = 7.052e-21
Identity = 43/98 (43.88%), Postives = 66/98 (67.35%), Query Frame = 1
Query:  142 VIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            V+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  Q+
Sbjct:   73 VVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQS 170          
BLAST of Transcription factor BTF3 vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 4.136e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 4.136e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 4.136e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Mouse
Match: Btf3l4 (basic transcription factor 3-like 4 [Source:MGI Symbol;Acc:MGI:1915312])

HSP 1 Score: 95.9005 bits (237), Expect = 4.136e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Mouse
Match: Gm20075 (predicted gene, 20075 [Source:MGI Symbol;Acc:MGI:5012260])

HSP 1 Score: 95.9005 bits (237), Expect = 4.136e-25
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E K +TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. UniProt
Match: sp|Q18885|BTF3_CAEEL (Transcription factor BTF3 homolog OS=Caenorhabditis elegans OX=6239 GN=icd-1 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.519e-30
Identity = 69/120 (57.50%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++ KQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 vs. UniProt
Match: sp|Q0CGL5|NACB_ASPTN (Nascent polypeptide-associated complex subunit beta OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=egd1 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 6.759e-27
Identity = 48/95 (50.53%), Postives = 70/95 (73.68%), Query Frame = 1
Query:  145 IVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMEN 426
            + KSS ADDKKL+AT K +++ P+P VEEVNMFK+DG VI+F NP+V+ S+P NT ++ G  E K+LTE++P +  QLGP      +K+A++ +N
Sbjct:   40 VHKSSGADDKKLQATLKKMNVQPIPAVEEVNMFKEDGNVIHFGNPRVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQN 134          
BLAST of Transcription factor BTF3 vs. UniProt
Match: sp|Q5M8V0|BT3L4_XENTR (Transcription factor BTF3 homolog 4 OS=Xenopus tropicalis OX=8364 GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.953e-26
Identity = 62/120 (51.67%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. UniProt
Match: sp|Q4KLF5|BT3L4_XENLA (Transcription factor BTF3 homolog 4 OS=Xenopus laevis OX=8355 GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.953e-26
Identity = 62/120 (51.67%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E+KQ+TE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. UniProt
Match: sp|Q6PC91|BT3L4_DANRE (Transcription factor BTF3 homolog 4 OS=Danio rerio OX=7955 GN=btf3l4 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.551e-25
Identity = 63/120 (52.50%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L ++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLVVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. TrEMBL
Match: gnl|BL_ORD_ID|25690843 (tr|A0A1I7TUX6|A0A1I7TUX6_9PELO Transcription factor BTF3 OS=Caenorhabditis tropicalis OX=1561998 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.132e-28
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 1
Query:   64 EKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            E+++KL    E+VR GGKGT RRKKKVI K++AADDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG ++IKQ+TE+LP +  QLGP      KK+A N+
Sbjct:    8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADIKQITEMLPGILNQLGPESLTHLKKLANNV 127          
BLAST of Transcription factor BTF3 vs. TrEMBL
Match: gnl|BL_ORD_ID|17417890 (tr|J3JVT8|J3JVT8_DENPD Transcription factor BTF3 OS=Dendroctonus ponderosae OX=77166 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.017e-28
Identity = 71/126 (56.35%), Postives = 94/126 (74.60%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL + +E VRTGGKGT RRKKKV+ K++A DDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT S+TG +E KQ+TE+LP +  QLG       KK+A N+ NQ
Sbjct:    1 MNAEKIKKLQQNAEQVRTGGKGTARRKKKVVHKTAANDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFHNPKVQASVPANTFSITGSAENKQITEMLPGILNQLGAESLTHLKKLANNVTNQ 126          
BLAST of Transcription factor BTF3 vs. TrEMBL
Match: gnl|BL_ORD_ID|157974440 (tr|A0A318LKC4|A0A318LKC4_9GAMM NAC-A/B domain-containing protein OS=Halomonas sp. LBP4 OX=2044917 GN=CR157_21980 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.113e-28
Identity = 71/126 (56.35%), Postives = 93/126 (73.81%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL   SE VRTGGKGT RRKKK++ K++A DDKKL++  K LS++ +P +EEVNM KDDG+VI+F NPKV  S+P NT SVTG +E KQLTE+LP +  QLG       KK+A N+ +Q
Sbjct:    1 MNAEKIKKLQAASEAVRTGGKGTARRKKKIVHKTAATDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGSVIHFNNPKVQASVPANTFSVTGTAENKQLTEMLPGILNQLGAESLTHLKKLANNVTSQ 126          
BLAST of Transcription factor BTF3 vs. TrEMBL
Match: gnl|BL_ORD_ID|24053999 (tr|A0A1I7S300|A0A1I7S300_BURXY Transcription factor BTF3 OS=Bursaphelenchus xylophilus OX=6326 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.113e-28
Identity = 71/126 (56.35%), Postives = 93/126 (73.81%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL   SE VRTGGKGT RRKKK++ K++A DDKKL++  K LS++ +P +EEVNM KDDG+VI+F NPKV  S+P NT SVTG +E KQLTE+LP +  QLG       KK+A N+ +Q
Sbjct:    1 MNAEKIKKLQAASEAVRTGGKGTARRKKKIVHKTAATDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGSVIHFNNPKVQASVPANTFSVTGTAENKQLTEMLPGILNQLGAESLTHLKKLANNVTSQ 126          
BLAST of Transcription factor BTF3 vs. TrEMBL
Match: gnl|BL_ORD_ID|20068191 (tr|A0A238C1D4|A0A238C1D4_9BILA Transcription factor BTF3 OS=Onchocerca flexuosa OX=387005 GN=X798_01733 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 7.257e-28
Identity = 71/126 (56.35%), Postives = 93/126 (73.81%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            +N EK++KL + +  VRTGGKGT RRKKKV+ K++A DDKKL++  K LS++ +P +EEVNM KDDGTVI+F NPKV  S+P NT SVTG +E KQ+TE+LP +  QLG       KK+A N+ NQ
Sbjct:    1 MNVEKIKKLQQNAAQVRTGGKGTARRKKKVVHKTAATDDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIHFNNPKVQASVPANTFSVTGSAENKQITEMLPGILNQLGAESLTHLKKLANNVTNQ 126          
BLAST of Transcription factor BTF3 vs. Ensembl Cavefish
Match: btf3l4 (basic transcription factor 3-like 4 [Source:NCBI gene;Acc:393667])

HSP 1 Score: 99.3673 bits (246), Expect = 2.143e-25
Identity = 64/120 (53.33%), Postives = 85/120 (70.83%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+++ K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +KIA+    Q
Sbjct:  122 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLTSLRKIAEQFPRQ 241          
BLAST of Transcription factor BTF3 vs. Ensembl Cavefish
Match: btf3 (basic transcription factor 3 [Source:NCBI gene;Acc:103023438])

HSP 1 Score: 96.2857 bits (238), Expect = 2.813e-25
Identity = 62/121 (51.24%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+ +  QA
Sbjct:    9 EKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRKLAEALPKQA 129          
BLAST of Transcription factor BTF3 vs. Ensembl Yeast
Match: EGD1 (Subunit beta1 of the nascent polypeptide-associated complex (NAC); involved in protein targeting, associated with cytoplasmic ribosomes; enhances DNA binding of the Gal4p activator; homolog of human BTF3b; EGD1 has a paralog, BTT1, that arose from the whole genome duplication [Source:SGD;Acc:S000005958])

HSP 1 Score: 55.8398 bits (133), Expect = 8.303e-11
Identity = 44/124 (35.48%), Postives = 59/124 (47.58%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNME 423
            I+ EKL KL KLS N + GG      KK      +  DD KL++    L    +  V E N FKDDG V++F    V V+   NT    G  + K L ++ P +  QLGP       ++A  ME
Sbjct:    3 IDQEKLAKLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKVMHFNKVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQME 126          
BLAST of Transcription factor BTF3 vs. Ensembl Yeast
Match: BTT1 (Heterotrimeric nascent polypeptide-associated complex beta3 subunit; complex binds ribosomes via its beta-subunits in close proximity to nascent polypeptides; interacts with Caf130p of the CCR4-NOT complex; similar to human BTF3; BTT1 has a paralog, EGD1, that arose from the whole genome duplication [Source:SGD;Acc:S000002660])

HSP 1 Score: 53.1434 bits (126), Expect = 7.134e-10
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   55 INTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLS-MSPVPVEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            ++ EKL KL KLS   + GG      KK  +  ++  D+ KL+A    L  M+   V E N FK +G V++F +  V ++  CN   + G+ +   L  + P V  QLG  + +    +A N+EN+
Sbjct:    3 VDQEKLAKLHKLSAANKVGGTRRKINKKGNLYNNNDKDNTKLQAELHKLHPMTIENVAEANFFKKNGKVLHFNSAVVQIAPQCNLTMIHGQPKENTLNGLYPSVASQLGSQELEYLTGLAHNLENE 128          
BLAST of Transcription factor BTF3 vs. Ensembl Nematostella
Match: EDO45155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW0])

HSP 1 Score: 97.8265 bits (242), Expect = 2.991e-26
Identity = 60/103 (58.25%), Postives = 78/103 (75.73%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLG 378
            EKL+KL + VR GGKGT RRKKKV+ +++  DDKKL+ T K LS++P+P +EEVNM K+DGTVI+F NPKV  SL  NT +V G +E K +TE+LP +  QLG
Sbjct:    4 EKLAKLQKEVRIGGKGTARRKKKVLHRTATTDDKKLQNTLKKLSVNPIPGIEEVNMIKEDGTVIHFNNPKVQASLGANTFAVNGHAETKSITEMLPGILNQLG 106          
BLAST of Transcription factor BTF3 vs. Ensembl Medaka
Match: BTF3L4 (basic transcription factor 3 like 4 [Source:NCBI gene;Acc:101173410])

HSP 1 Score: 102.064 bits (253), Expect = 1.369e-27
Identity = 64/121 (52.89%), Postives = 85/121 (70.25%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKGT RRKKKV+ K++ ADDKKL+ + K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q+
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHKTATADDKKLQGSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLSSLRKLAEQFPRQS 124          
BLAST of Transcription factor BTF3 vs. Ensembl Medaka
Match: BTF3L4 (basic transcription factor 3 like 4 [Source:NCBI gene;Acc:101173410])

HSP 1 Score: 101.679 bits (252), Expect = 1.718e-27
Identity = 64/120 (53.33%), Postives = 84/120 (70.00%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQ 429
            EKL+KL   VR GGKGT RRKKKV+ K++ ADDKKL+ + K L+++ +  +EEVNM KDDGTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +K+A+    Q
Sbjct:    4 EKLAKLQAQVRIGGKGTARRKKKVVHKTATADDKKLQGSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAETKQLTEMLPGILSQLGADSLSSLRKLAEQFPRQ 123          
BLAST of Transcription factor BTF3 vs. Ensembl Medaka
Match: btf3 (basic transcription factor 3 [Source:NCBI gene;Acc:101157713])

HSP 1 Score: 95.5153 bits (236), Expect = 4.993e-25
Identity = 60/121 (49.59%), Postives = 84/121 (69.42%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQA 432
            EKL+KL   VR GGKG+ RRKKKV+ +++ ADDKKL+ + K L ++ +  +EEVNMF + GTVI+F NPKV  SL  NT ++TG +E KQLTE+LP +  QLG       +++A+ +  QA
Sbjct:    9 EKLAKLQAQVRIGGKGSARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPGILNQLGADSLTSLRRLAEALPKQA 129          
BLAST of Transcription factor BTF3 vs. Ensembl Medaka
Match: ENSORLT00000002626.2 (transcription factor BTF3 [Source:NCBI gene;Acc:101169115])

HSP 1 Score: 91.2781 bits (225), Expect = 1.816e-23
Identity = 56/117 (47.86%), Postives = 80/117 (68.38%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            EKL KL   VR  GKG+ RRK+KV+ +++ ADDKKL  + K L ++ +  +EEV+MF + GTVI+F NPKV  SL  NT +VTG +E KQLTE+LP +  QLG       +++A+++
Sbjct:    9 EKLVKLQAQVRIDGKGSARRKRKVVHRTATADDKKLHFSLKKLGVNNISGIEEVSMFTNQGTVIHFNNPKVQASLAANTFAVTGHAENKQLTEMLPGILSQLGADSLTSLRRLAEHL 125          
BLAST of Transcription factor BTF3 vs. Ensembl Medaka
Match: ENSORLT00000027651.1 (transcription factor BTF3 [Source:NCBI gene;Acc:101169115])

HSP 1 Score: 90.5077 bits (223), Expect = 5.362e-23
Identity = 56/117 (47.86%), Postives = 80/117 (68.38%), Query Frame = 1
Query:   73 EKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNM 420
            EKL KL   VR  GKG+ RRK+KV+ +++ ADDKKL  + K L ++ +  +EEV+MF + GTVI+F NPKV  SL  NT +VTG +E KQLTE+LP +  QLG       +++A+++
Sbjct:    9 EKLVKLQAQVRIDGKGSARRKRKVVHRTATADDKKLHFSLKKLGVNNISGIEEVSMFTNQGTVIHFNNPKVQASLAANTFAVTGHAENKQLTEMLPGILSQLGADSLTSLRRLAEHL 125          
BLAST of Transcription factor BTF3 vs. Planmine SMEST
Match: SMESG000008919.1 (SMESG000008919.1)

HSP 1 Score: 239.195 bits (609), Expect = 1.126e-81
Identity = 156/157 (99.36%), Postives = 157/157 (100.00%), Query Frame = 1
Query:   40 MDGFKINTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVPVEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIAQNMENQAXXXXXXXXXXXXXXXXXXFDQQSKLE 510
            MDGFKINTEKLEKLSKLSENVRTGGKGTMRRKKKVIVKSSAADDKKLEATFKSLSMSPVPVEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKI+QNMENQATVEDIDDEDDDVPTLVTDFDQQSKLE
Sbjct:    1 MDGFKINTEKLEKLSKLSENVRTGGKGTMRRKKKVIVKSSAADDKKLEATFKSLSMSPVPVEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKISQNMENQATVEDIDDEDDDVPTLVTDFDQQSKLE 157          
BLAST of Transcription factor BTF3 vs. Planmine SMEST
Match: SMESG000026176.1 (SMESG000026176.1)

HSP 1 Score: 141.354 bits (355), Expect = 5.068e-43
Identity = 95/162 (58.64%), Postives = 127/162 (78.40%), Query Frame = 1
Query:   40 MDGFKINTEKLEKLSKLSENVXXXXXXXXXXXXXVIVKSSAADDKKLEATFKSLSMSPVP-VEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQLTEILPKVWQQLGPLKGDLFKKIA----QNMENQAXXXXXXXXXXXXXXXXXXFDQQSKLE 510
            M+  K+N ++LEKL KLS+NVR GGKG+ RRKKKV+ K++ +D+KKL+ T K L ++P+P +EEVNMFKDDGT+I+F NPKV  SL CNT+S++G+SEIK L+E+LP VWQQLGPL     KKIA    +N+EN++      +EDDDVPTLV +FD+QSKL+
Sbjct:    1 MESVKVNKDRLEKLHKLSDNVRIGGKGSARRKKKVVTKNNVSDEKKLQTTLKRLGVNPIPTIEEVNMFKDDGTLIHFKNPKVQASLQCNTISISGQSEIKNLSEMLPSVWQQLGPLNIQNIKKIAEEMRENIENKS--TSQINEDDDVPTLVENFDEQSKLQ 160          
The following BLAST results are available for this feature:
BLAST of Transcription factor BTF3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTF3L43.641e-2550.83basic transcription factor 3 like 4 [Source:HGNC S... [more]
BTF3L46.025e-2550.83basic transcription factor 3 like 4 [Source:HGNC S... [more]
BTF32.613e-2449.59basic transcription factor 3 [Source:HGNC Symbol;A... [more]
BTF31.226e-2349.59basic transcription factor 3 [Source:HGNC Symbol;A... [more]
BTF31.388e-1748.57basic transcription factor 3 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
icd-14.339e-3157.50Transcription factor BTF3 homolog [Source:UniProt... [more]
icd-14.339e-3157.50Transcription factor BTF3 homolog [Source:UniProt... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bic9.939e-2552.63gene:FBgn0000181 transcript:FBtr0087782[more]
bic9.939e-2552.63gene:FBgn0000181 transcript:FBtr0087783[more]
CG118355.065e-1953.85gene:FBgn0031264 transcript:FBtr0332341[more]
CG118355.065e-1953.85gene:FBgn0031264 transcript:FBtr0332342[more]
CG118355.065e-1953.85gene:FBgn0031264 transcript:FBtr0078076[more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btf3l42.054e-2652.50basic transcription factor 3-like 4 [Source:NCBI g... [more]
btf3l42.054e-2652.50basic transcription factor 3-like 4 [Source:NCBI g... [more]
btf3l42.899e-2652.50basic transcription factor 3-like 4 [Source:NCBI g... [more]
btf34.993e-2550.41basic transcription factor 3 [Source:ZFIN;Acc:ZDB-... [more]
btf34.993e-2550.41basic transcription factor 3 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
btf3l45.574e-2751.67basic transcription factor 3-like 4 [Source:NCBI g... [more]
ttc345.548e-2349.59tetratricopeptide repeat domain 34 [Source:Xenbase... [more]
ttc347.052e-2143.88tetratricopeptide repeat domain 34 [Source:Xenbase... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btf3l44.136e-2550.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf3l44.136e-2550.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf3l44.136e-2550.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Btf3l44.136e-2550.83basic transcription factor 3-like 4 [Source:MGI Sy... [more]
Gm200754.136e-2550.83predicted gene, 20075 [Source:MGI Symbol;Acc:MGI:5... [more]
back to top
BLAST of Transcription factor BTF3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18885|BTF3_CAEEL5.519e-3057.50Transcription factor BTF3 homolog OS=Caenorhabditi... [more]
sp|Q0CGL5|NACB_ASPTN6.759e-2750.53Nascent polypeptide-associated complex subunit bet... [more]
sp|Q5M8V0|BT3L4_XENTR2.953e-2651.67Transcription factor BTF3 homolog 4 OS=Xenopus tro... [more]
sp|Q4KLF5|BT3L4_XENLA2.953e-2651.67Transcription factor BTF3 homolog 4 OS=Xenopus lae... [more]
sp|Q6PC91|BT3L4_DANRE1.551e-2552.50Transcription factor BTF3 homolog 4 OS=Danio rerio... [more]
back to top
BLAST of Transcription factor BTF3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|256908431.132e-2858.33tr|A0A1I7TUX6|A0A1I7TUX6_9PELO Transcription facto... [more]
gnl|BL_ORD_ID|174178902.017e-2856.35tr|J3JVT8|J3JVT8_DENPD Transcription factor BTF3 O... [more]
gnl|BL_ORD_ID|1579744402.113e-2856.35tr|A0A318LKC4|A0A318LKC4_9GAMM NAC-A/B domain-cont... [more]
gnl|BL_ORD_ID|240539992.113e-2856.35tr|A0A1I7S300|A0A1I7S300_BURXY Transcription facto... [more]
gnl|BL_ORD_ID|200681917.257e-2856.35tr|A0A238C1D4|A0A238C1D4_9BILA Transcription facto... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
btf3l42.143e-2553.33basic transcription factor 3-like 4 [Source:NCBI g... [more]
btf32.813e-2551.24basic transcription factor 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
EGD18.303e-1135.48Subunit beta1 of the nascent polypeptide-associate... [more]
BTT17.134e-1031.75Heterotrimeric nascent polypeptide-associated comp... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO451552.991e-2658.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription factor BTF3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTF3L41.369e-2752.89basic transcription factor 3 like 4 [Source:NCBI g... [more]
BTF3L41.718e-2753.33basic transcription factor 3 like 4 [Source:NCBI g... [more]
btf34.993e-2549.59basic transcription factor 3 [Source:NCBI gene;Acc... [more]
ENSORLT00000002626.21.816e-2347.86transcription factor BTF3 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000027651.15.362e-2347.86transcription factor BTF3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transcription factor BTF3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008919.11.126e-8199.36SMESG000008919.1[more]
SMESG000026176.15.068e-4358.64SMESG000026176.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027646 ID=SMED30027646|Name=Transcription factor BTF3|organism=Schmidtea mediterranea sexual|type=transcript|length=541bp
AAATTAATTTGTTTAAATAAATTTCTTTAGAATCACGCAATGGACGGTTT
TAAAATTAACACTGAAAAATTAGAAAAACTTAGTAAGTTGTCGGAAAATG
TCCGAACAGGTGGTAAAGGTACAATGAGACGAAAGAAGAAGGTCATTGTC
AAGAGTTCAGCAGCAGATGATAAGAAATTAGAGGCAACCTTCAAATCATT
GTCAATGAGCCCGGTTCCAGTTGAAGAAGTAAACATGTTCAAGGATGATG
GAACTGTTATTAATTTCGTTAATCCAAAAGTCAATGTGTCACTTCCATGC
AACACTCTCTCAGTTACTGGAAAATCCGAAATTAAGCAATTGACCGAAAT
ACTTCCAAAAGTTTGGCAACAACTTGGCCCACTTAAAGGAGATCTTTTCA
AGAAAATTGCACAAAACATGGAAAATCAAGCAACTGTCGAAGATATTGAT
GATGAAGACGATGACGTTCCAACTCTCGTCACAGACTTCGATCAACAAAG
CAAATTGGAATAACTTTTTAATATCAATAAATTTTTTGGAC
back to top

protein sequence of SMED30027646-orf-1

>SMED30027646-orf-1 ID=SMED30027646-orf-1|Name=SMED30027646-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=158bp
MDGFKINTEKLEKLSKLSENVRTGGKGTMRRKKKVIVKSSAADDKKLEAT
FKSLSMSPVPVEEVNMFKDDGTVINFVNPKVNVSLPCNTLSVTGKSEIKQ
LTEILPKVWQQLGPLKGDLFKKIAQNMENQATVEDIDDEDDDVPTLVTDF
DQQSKLE*
back to top
Aliases
The feature 'Transcription factor BTF3' has the following synonyms
Synonym
BTF3-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000211primitive ectoderm cell
PLANA:0000029primitive ectoderm
PLANA:0000023embryonic pharynx
PLANA:0000058embryonic digestive system
PLANA:0004517blastomere
Vocabulary: INTERPRO
TermDefinition
IPR038187NAC_A/B_dom_sf
IPR039370BTF3
IPR002715Nas_poly-pep-assoc_cplx_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0009792embryo development ending in birth or egg hatching
GO:0043066negative regulation of apoptotic process
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000002Stage 2
PLANA:0000004Stage 4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002715Nascent polypeptide-associated complex NAC domainSMARTSM01407NAC_2coord: 44..99
e-value: 7.6E-17
score: 72.0
IPR002715Nascent polypeptide-associated complex NAC domainPFAMPF01849NACcoord: 44..99
e-value: 4.4E-15
score: 55.4
IPR002715Nascent polypeptide-associated complex NAC domainPROSITEPS51151NAC_ABcoord: 41..105
score: 14.165
IPR038187NAC A/B domain superfamilyGENE3DG3DSA:2.20.70.30coord: 59..112
e-value: 1.2E-22
score: 81.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 135..157
IPR039370Transcription factor BTF3PANTHERPTHR10351TRANSCRIPTION FACTOR BTF3 FAMILY MEMBERcoord: 12..156