SMED30027645

Overview
NameSMED30027645
Smed IDSMED30027645
Length (bp)2437
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027645 (SMED30027645) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027645 (SMED30027645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027645 (SMED30027645) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027645 (SMED30027645) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027645

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30027645SMESG000054738.1 SMESG000035995.1 SmedASXL_012101SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30027645SMESG000054738.1 SMESG000035995.1 dd_Smed_v4_6659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027645SMESG000054738.1 SMESG000035995.1 dd_Smed_v4_6659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027645SMESG000054738.1 SMESG000035995.1 dd_Smed_v4_6659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027645SMESG000054738.1 SMESG000035995.1 dd_Smed_v4_6659_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027645 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000758:140299..152237 -12070
Homology
BLAST of SMED30027645 vs. Ensembl Human
Match: ZNF583 (zinc finger protein 583 [Source:HGNC Symbol;Acc:HGNC:26427])

HSP 1 Score: 87.0409 bits (214), Expect = 4.422e-17
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPF   C EC K F+  S L  H R HTG +P+ CNVC  +F+ + YLI H  +H  ERP+ C++C+K++  Y  LA H+++H
Sbjct:  322 RPFE--CIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVH 402          

HSP 2 Score: 78.9518 bits (193), Expect = 1.774e-14
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++C EC K F+ N+ L  H R HTG +P+ CNVC  +F+    L  H  +H  ERP+ C+ C+KS++    LA+H ++H
Sbjct:  464 YMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIH 542          

HSP 3 Score: 75.0998 bits (183), Expect = 2.572e-13
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 2
Query:  911 TIVDLNTNGNSK-KSNELQNKKGSRRKRK---PTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFS-----------------FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            TI D+  +  +K K+++ + +K S RK+       K  V+   L          N+  K   +SSS  +   IH+  +P    +  G+ FS                 + C EC K F+ N+ L  H R HTG +P+ C  C  +F+Q ++L +H  VH  ERPF C +C K++ +   LA H+++H
Sbjct:  169 TIFDIQQSFPTKEKAHKHEPQKKSYRKKSVEMKHRKVYVEKKLL--------KCNDCEKVFNQSSSLTLHQRIHTGEKPYACVEC-GKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIH 346          

HSP 4 Score: 73.559 bits (179), Expect = 7.093e-13
Identity = 34/83 (40.96%), Postives = 51/83 (61.45%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+   C EC K F+  + L  H R HTG +P+ C VC  +F+Q +YL +H  VH  E+P+ C +C K++ +  SLA H++ H
Sbjct:  378 RPYE--CKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSH 458          

HSP 5 Score: 67.781 bits (164), Expect = 4.482e-11
Identity = 30/79 (37.97%), Postives = 48/79 (60.76%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C EC K F+ +S L  H R HTG +P+ C  C  +F+Q + L +H  +H  E+P+ C  C K++ + GSL  H+++H
Sbjct:  436 YECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIH 514          

HSP 6 Score: 67.3958 bits (163), Expect = 7.336e-11
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++C  C K F+    L  H R HTG RP+ C  C  +F+Q ++L +H  VH  E+P+ C+ C+K++     L  H+++H
Sbjct:  352 YVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVH 430          

HSP 7 Score: 62.7734 bits (151), Expect = 2.037e-9
Identity = 30/103 (29.13%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNG 1480
            + C  C K F+  + L+ H R HTG +P+ C  C  +F+  S L +H   H  E+P+ C++C+K++     LA H+++H  ++  +  +       ++ SY+G
Sbjct:  408 YECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCG-----KAFSYSG 505          
BLAST of SMED30027645 vs. Ensembl Human
Match: ZNF583 (zinc finger protein 583 [Source:HGNC Symbol;Acc:HGNC:26427])

HSP 1 Score: 87.0409 bits (214), Expect = 4.422e-17
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPF   C EC K F+  S L  H R HTG +P+ CNVC  +F+ + YLI H  +H  ERP+ C++C+K++  Y  LA H+++H
Sbjct:  322 RPFE--CIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVH 402          

HSP 2 Score: 78.9518 bits (193), Expect = 1.774e-14
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++C EC K F+ N+ L  H R HTG +P+ CNVC  +F+    L  H  +H  ERP+ C+ C+KS++    LA+H ++H
Sbjct:  464 YMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIH 542          

HSP 3 Score: 75.0998 bits (183), Expect = 2.572e-13
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 2
Query:  911 TIVDLNTNGNSK-KSNELQNKKGSRRKRK---PTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFS-----------------FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            TI D+  +  +K K+++ + +K S RK+       K  V+   L          N+  K   +SSS  +   IH+  +P    +  G+ FS                 + C EC K F+ N+ L  H R HTG +P+ C  C  +F+Q ++L +H  VH  ERPF C +C K++ +   LA H+++H
Sbjct:  169 TIFDIQQSFPTKEKAHKHEPQKKSYRKKSVEMKHRKVYVEKKLL--------KCNDCEKVFNQSSSLTLHQRIHTGEKPYACVEC-GKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIH 346          

HSP 4 Score: 73.559 bits (179), Expect = 7.093e-13
Identity = 34/83 (40.96%), Postives = 51/83 (61.45%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+   C EC K F+  + L  H R HTG +P+ C VC  +F+Q +YL +H  VH  E+P+ C +C K++ +  SLA H++ H
Sbjct:  378 RPYE--CKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSH 458          

HSP 5 Score: 67.781 bits (164), Expect = 4.482e-11
Identity = 30/79 (37.97%), Postives = 48/79 (60.76%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C EC K F+ +S L  H R HTG +P+ C  C  +F+Q + L +H  +H  E+P+ C  C K++ + GSL  H+++H
Sbjct:  436 YECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIH 514          

HSP 6 Score: 67.3958 bits (163), Expect = 7.336e-11
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++C  C K F+    L  H R HTG RP+ C  C  +F+Q ++L +H  VH  E+P+ C+ C+K++     L  H+++H
Sbjct:  352 YVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVH 430          

HSP 7 Score: 62.7734 bits (151), Expect = 2.037e-9
Identity = 30/103 (29.13%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNG 1480
            + C  C K F+  + L+ H R HTG +P+ C  C  +F+  S L +H   H  E+P+ C++C+K++     LA H+++H  ++  +  +       ++ SY+G
Sbjct:  408 YECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCG-----KAFSYSG 505          
BLAST of SMED30027645 vs. Ensembl Human
Match: ZNF213 (zinc finger protein 213 [Source:HGNC Symbol;Acc:HGNC:13005])

HSP 1 Score: 83.5741 bits (205), Expect = 5.643e-17
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            +PFS  C EC K F+ ++ L  H R HTG +PF C+ C  SF+ +SYL+ H  VH  ERPF C +C KS+K    L  H+ LH K
Sbjct:  182 KPFS--CSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAK 264          

HSP 2 Score: 75.8702 bits (185), Expect = 1.881e-14
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            CPEC K F  +S L  H   HTG +PF+C+ C  SF++ +YL  H  +H  E+PF C  C KS+     L +HR++H
Sbjct:  158 CPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVH 234          
BLAST of SMED30027645 vs. Ensembl Human
Match: ZNF213 (zinc finger protein 213 [Source:HGNC Symbol;Acc:HGNC:13005])

HSP 1 Score: 85.1149 bits (209), Expect = 1.050e-16
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            +PFS  C EC K F+ ++ L  H R HTG +PF C+ C  SF+ +SYL+ H  VH  ERPF C +C KS+K    L  H+ LH K
Sbjct:  371 KPFS--CSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAK 453          

HSP 2 Score: 77.7962 bits (190), Expect = 2.948e-14
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            CPEC K F  +S L  H   HTG +PF+C+ C  SF++ +YL  H  +H  E+PF C  C KS+     L +HR++H
Sbjct:  347 CPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVH 423          
BLAST of SMED30027645 vs. Ensembl Human
Match: ZNF213 (zinc finger protein 213 [Source:HGNC Symbol;Acc:HGNC:13005])

HSP 1 Score: 85.1149 bits (209), Expect = 1.050e-16
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            +PFS  C EC K F+ ++ L  H R HTG +PF C+ C  SF+ +SYL+ H  VH  ERPF C +C KS+K    L  H+ LH K
Sbjct:  371 KPFS--CSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAK 453          

HSP 2 Score: 77.7962 bits (190), Expect = 2.948e-14
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            CPEC K F  +S L  H   HTG +PF+C+ C  SF++ +YL  H  +H  E+PF C  C KS+     L +HR++H
Sbjct:  347 CPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVH 423          
BLAST of SMED30027645 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 75.8702 bits (185), Expect = 1.054e-14
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 1160 RPFSFLCP--ECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDS 1432
            RP+   CP  EC KKF+ +  L  H+R HTG +PF C +C   F++  +L  H   H  E+P+ C+ C K +        H K+H+K +++ S
Sbjct:  176 RPYK--CPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSQRSGS 266          
BLAST of SMED30027645 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 70.0922 bits (170), Expect = 2.807e-14
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 1160 RPFSFLCP--ECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDS 1432
            RP+   CP  EC KKF+ +  L  H+R HTG +PF C +C   F++  +L  H   H  E+P+ C+ C K +        H K+H+K +++ S
Sbjct:   11 RPYK--CPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSQRSGS 101          
BLAST of SMED30027645 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 73.9442 bits (180), Expect = 3.558e-14
Identity = 33/82 (40.24%), Postives = 45/82 (54.88%), Query Frame = 2
Query: 1163 PFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P  F C  C K F+  + L AH R HTG +PF C VC   F+Q S L+ H   H  ERP+ C +C+K++    +L  H + H
Sbjct:  163 PKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTH 244          

HSP 2 Score: 67.781 bits (164), Expect = 4.527e-12
Identity = 30/80 (37.50%), Postives = 42/80 (52.50%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHR 1411
            F+CP C + F+ +S L  H R HTG RP+ C  C  +FT  S L +H   H   +P+ C  C   +   G+L  H K H+
Sbjct:  194 FMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK 273          
BLAST of SMED30027645 vs. Ensembl Celegans
Match: ztf-23 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q9N3C6])

HSP 1 Score: 75.0998 bits (183), Expect = 5.499e-14
Identity = 50/165 (30.30%), Postives = 77/165 (46.67%), Query Frame = 2
Query:  920 DLNTNGNSKKSNELQNKK-GSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCE-KCQKSYKHYGSLANHRKLH 1408
            DL+  G  + SN    K   +RR  K  +   V+++Q  SP     ST+ V     +++SGK+                 GR   F C  C + F   S+L+ H R H G++PF C+ C   F+Q+  L  H  +H  ERPF C+ +C K +    + ++H K H
Sbjct:  184 DLSPQGPIRSSNNYHLKYIRTRRMDKLIDNVVVNATQRDSPEQEDCSTSGVAFADGQTNSGKM-----------------GR---FSCDRCSRTFKYQSKLDEHRRTHLGVKPFQCHYCTRQFSQRGALKTHMRLHTGERPFVCQWECGKQFASSSAKSHHEKTH 328          

HSP 2 Score: 52.373 bits (124), Expect = 8.543e-7
Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 2
Query: 1160 RPFSFLCP-ECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRH 1312
            RPF  +C  EC K+F  +S  + H + H+G RP+ CNVC  SFT+ S++IRH
Sbjct:  303 RPF--VCQWECGKQFASSSAKSHHEKTHSGERPYICNVCGKSFTKNSHVIRH 352          
BLAST of SMED30027645 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 75.8702 bits (185), Expect = 7.318e-14
Identity = 36/94 (38.30%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 1127 GEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            G PN +   +     + C +C K F   S L  H+R HTG RPF C +C   FTQ ++L +H  VH  ERP  C+ C K +    +L  H +LH
Sbjct:  493 GVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLH 586          

HSP 2 Score: 70.4774 bits (171), Expect = 3.377e-12
Identity = 31/75 (41.33%), Postives = 40/75 (53.33%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRK 1402
            C  C K+F+  S L  H+R H G +P+TC+VC   FTQ  +L  H  +H  ERP+ C  C K Y     L  H K
Sbjct:  566 CDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWK 640          

HSP 3 Score: 63.1586 bits (152), Expect = 7.233e-10
Identity = 30/83 (36.14%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPF   C  C K+FT  + L  H   HTG RP  C++C   F+  S L  H  +H  ++P+ C+ C   +  Y  L  H++LH
Sbjct:  534 RPFK--CEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLH 614          
BLAST of SMED30027645 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330202)

HSP 1 Score: 80.1073 bits (196), Expect = 3.790e-15
Identity = 45/143 (31.47%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  980 RRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +RKR P      D  ++  P A   ++    +  + S  G +  +   S        + G+P +F C EC K F  +  L  HM  HTG RPF C VC   F Q S L RH  +H  E+P  C+ C K++    +L  H ++H
Sbjct:  266 KRKRSPQ-----DQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSA-------SGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIH 396          

HSP 2 Score: 55.0694 bits (131), Expect = 2.364e-7
Identity = 27/77 (35.06%), Postives = 34/77 (44.16%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C  C K F  +S LN H R H G +PF C  C   F QK     H   H  E+ + C  C K++    +L  H   H
Sbjct:  376 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTH 452          
BLAST of SMED30027645 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330201)

HSP 1 Score: 79.7221 bits (195), Expect = 5.299e-15
Identity = 47/150 (31.33%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  986 KRKPTNKTTVDSSQLASPLAH---PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNK------GRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++ P  + T  SS L + L     P    EV    A +++    +   S     ++ D+       G+P +F C EC K F  +  L  HM  HTG RPF C VC   F Q S L RH  +H  E+P  C+ C K++    +L  H ++H
Sbjct:  247 EKSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIH 396          

HSP 2 Score: 54.6842 bits (130), Expect = 3.287e-7
Identity = 27/77 (35.06%), Postives = 34/77 (44.16%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C  C K F  +S LN H R H G +PF C  C   F QK     H   H  E+ + C  C K++    +L  H   H
Sbjct:  376 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTH 452          
BLAST of SMED30027645 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0077870)

HSP 1 Score: 79.337 bits (194), Expect = 6.063e-15
Identity = 45/143 (31.47%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  980 RRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +RKR P      D  ++  P A   ++    +  + S  G +  +   S        + G+P +F C EC K F  +  L  HM  HTG RPF C VC   F Q S L RH  +H  E+P  C+ C K++    +L  H ++H
Sbjct:  266 KRKRSPQ-----DQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSA-------SGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIH 396          

HSP 2 Score: 54.299 bits (129), Expect = 3.970e-7
Identity = 27/77 (35.06%), Postives = 34/77 (44.16%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C  C K F  +S LN H R H G +PF C  C   F QK     H   H  E+ + C  C K++    +L  H   H
Sbjct:  376 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTH 452          
BLAST of SMED30027645 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330200)

HSP 1 Score: 79.337 bits (194), Expect = 6.181e-15
Identity = 45/143 (31.47%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  980 RRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +RKR P      D  ++  P A   ++    +  + S  G +  +   S        + G+P +F C EC K F  +  L  HM  HTG RPF C VC   F Q S L RH  +H  E+P  C+ C K++    +L  H ++H
Sbjct:  258 KRKRSPQ-----DQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSA-------SGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIH 388          

HSP 2 Score: 54.299 bits (129), Expect = 3.909e-7
Identity = 27/77 (35.06%), Postives = 34/77 (44.16%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C  C K F  +S LN H R H G +PF C  C   F QK     H   H  E+ + C  C K++    +L  H   H
Sbjct:  368 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTH 444          
BLAST of SMED30027645 vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0083584)

HSP 1 Score: 78.5666 bits (192), Expect = 1.217e-14
Identity = 39/106 (36.79%), Postives = 57/106 (53.77%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYN 1477
            RP+   CP+C K F+  + L AH+R HTG +PF C +C   F+Q S +  H   H  ERP+ C  C+KS+    +L  H ++H   EK     L  ++  QS + N
Sbjct:  463 RPYR--CPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIH-SGEKPYQCKLCLLRFSQSGNLN 565          

HSP 2 Score: 72.7886 bits (177), Expect = 6.859e-13
Identity = 29/79 (36.71%), Postives = 47/79 (59.49%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F CP C ++F+ +S +  HMR H+G RP+ C+ C  SF+  S L +H  +H  E+P+ C+ C   +   G+L  H ++H
Sbjct:  493 FRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571          
BLAST of SMED30027645 vs. Ensembl Zebrafish
Match: znf1114 (zinc finger protein 1114 [Source:ZFIN;Acc:ZDB-GENE-110914-54])

HSP 1 Score: 87.0409 bits (214), Expect = 4.142e-18
Identity = 46/120 (38.33%), Postives = 66/120 (55.00%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P +  +  K  ++SSS K+   IH+  +P            F C +C K F+ +S L+ HMR HTG +PFTC  C  SF+Q S L  H  +H  E+PF C +C KS+ H  SL +H ++H
Sbjct:  205 PFTCTQCGKSFSQSSSLKLHMMIHTGEKP------------FTCTQCGKSFSRSSSLDYHMRIHTGEKPFTCTQCGKSFSQSSSLNHHTRIHTGEKPFTCTQCGKSFSHSSSLNHHMRMH 312          

HSP 2 Score: 80.4925 bits (197), Expect = 5.874e-16
Identity = 45/120 (37.50%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P +  +  K +A  S  K+   IH+  +P            F C +C K FT +S LN HMR HT  +PFTC  C  SF+Q S L  H  +H  E+PF C +C KS+    SL  H ++H
Sbjct:  149 PFTCTQCGKSLANKSKLKIHIMIHTGKKP------------FTCTQCGKSFTHSSYLNKHMRIHTREKPFTCTQCGKSFSQSSSLKLHMMIHTGEKPFTCTQCGKSFSRSSSLDYHMRIH 256          

HSP 3 Score: 70.4774 bits (171), Expect = 1.287e-12
Identity = 40/124 (32.26%), Postives = 58/124 (46.77%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            P +  +  K +A  S  K+   IH+  +            SF C +C K F     L  HM  HTG +PFTC  C  S   KS L  H  +H  ++PF C +C KS+ H   L  H ++H +++
Sbjct:   93 PFTCTQCGKSLANKSQLKIHMMIHTGNK------------SFTCTQCGKIFGRKGNLKIHMMIHTGEKPFTCTQCGKSLANKSKLKIHIMIHTGKKPFTCTQCGKSFTHSSYLNKHMRIHTREK 204          

HSP 4 Score: 56.6102 bits (135), Expect = 4.906e-8
Identity = 29/79 (36.71%), Postives = 37/79 (46.84%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C +C K F     L  H   HTG +PFTC  C  S   KS L  H  +H   + F C +C K +   G+L  H  +H
Sbjct:   66 FTCTQCGKSFGREGNLKIHTMIHTGEKPFTCTQCGKSLANKSQLKIHMMIHTGNKSFTCTQCGKIFGRKGNLKIHMMIH 144          
BLAST of SMED30027645 vs. Ensembl Zebrafish
Match: si:dkey-262g12.10 (si:dkey-262g12.10 [Source:ZFIN;Acc:ZDB-GENE-161017-33])

HSP 1 Score: 86.6557 bits (213), Expect = 4.572e-18
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 2
Query: 1136 NTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKN 1426
            +T+     RP++  C +C K FT  + LN HM+ HTG +P+ C  C  SFT K YL  H   H  ERPF C +C KSY H G+L+ H KLH ++ KN
Sbjct:  204 HTMIHTGERPYT--CAQCGKSFTQRNNLNYHMKFHTGDKPYICTECGKSFTYKYYLNAHMRTHTRERPFICGQCGKSYCHRGNLSQHLKLHVEETKN 298          

HSP 2 Score: 72.7886 bits (177), Expect = 1.967e-13
Identity = 34/83 (40.96%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            F+C +C K F     L  HM+ HTG +PF C +C  SF+QK  L  H  +H  ERP+ C +C KS+    +L  H K H  D+
Sbjct:  158 FVCQQCGKCFAQKHNLKQHMKIHTGEKPFACQLCGKSFSQKQRLAVHTMIHTGERPYTCAQCGKSFTQRNNLNYHMKFHTGDK 240          

HSP 3 Score: 68.1662 bits (165), Expect = 6.343e-12
Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C +C K+F L   L  H + HTG RP+ C  C   F +K  L  H AVH  E+PF C++C K +    +L  H K+H
Sbjct:  102 YACQQCGKRFRLLHILQLHFKLHTGERPYACTQCGMRFIKKQRLDTHMAVHSTEKPFVCQQCGKCFAQKHNLKQHMKIH 180          

HSP 4 Score: 63.929 bits (154), Expect = 1.933e-10
Identity = 31/83 (37.35%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP++  C +C  +F    RL+ HM  H+  +PF C  C   F QK  L +H  +H  E+PF C+ C KS+     LA H  +H
Sbjct:  128 RPYA--CTQCGMRFIKKQRLDTHMAVHSTEKPFVCQQCGKCFAQKHNLKQHMKIHTGEKPFACQLCGKSFSQKQRLAVHTMIH 208          
BLAST of SMED30027645 vs. Ensembl Zebrafish
Match: znf1099 (zinc finger protein 1099 [Source:ZFIN;Acc:ZDB-GENE-060503-829])

HSP 1 Score: 85.1149 bits (209), Expect = 5.408e-18
Identity = 47/120 (39.17%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P +  +  K   +SSS K+   IH+  +P            F C +C K F+ +S LN HMR HTG +PFTC  C  SF+Q S L  H  +H  E+PF C +C KS+ H   L  H K+H
Sbjct:   93 PFTCTQCGKSFNQSSSLKIHMRIHTGEKP------------FTCTQCGKSFSQSSSLNLHMRIHTGEKPFTCTQCGKSFSQSSSLNLHVRIHTGEKPFTCPQCGKSFSHSSHLNCHMKIH 200          

HSP 2 Score: 74.3294 bits (181), Expect = 2.903e-14
Identity = 39/103 (37.86%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKC 1357
            P +  +  K  ++SSS  +   IH+  +P            F CP+C K F+ +S LN HM+ HTG +PFTC  C  SF+Q S+L  H  +H  E+PF C +C
Sbjct:  149 PFTCTQCGKSFSQSSSLNLHVRIHTGEKP------------FTCPQCGKSFSHSSHLNCHMKIHTGEKPFTCPHCGKSFSQSSHLNCHMKIHTGEKPFTCPQC 239          

HSP 3 Score: 67.781 bits (164), Expect = 4.521e-12
Identity = 33/79 (41.77%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F+C +C K F     L  HM  H G +PFTC  C  SF Q S L  H  +H  E+PF C +C KS+    SL  H ++H
Sbjct:   66 FICTQCVKSFGRKDDLKFHMMIHAGEKPFTCTQCGKSFNQSSSLKIHMRIHTGEKPFTCTQCGKSFSQSSSLNLHMRIH 144          
BLAST of SMED30027645 vs. Ensembl Zebrafish
Match: zgc:173624 (zgc:173624 [Source:ZFIN;Acc:ZDB-GENE-071004-60])

HSP 1 Score: 86.2705 bits (212), Expect = 6.242e-18
Identity = 38/88 (43.18%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEK 1423
            RPFS  C +C K F+  S+L+ HMR HTG++PF+C  C  SF QK Y   H  +H  E+PFHC++C K +    SL +H  +H ++++
Sbjct:  214 RPFS--CDQCEKSFSHKSKLDVHMRVHTGLKPFSCTECGKSFCQKQYFKVHMRIHTGEKPFHCQQCGKGFIQLQSLKSHISVHAREKQ 299          

HSP 2 Score: 76.6406 bits (187), Expect = 1.229e-14
Identity = 45/120 (37.50%), Postives = 59/120 (49.17%), Query Frame = 2
Query: 1100 KVSSNIHSSGEPNTLFDNKGRPFS-----------------FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            KV + IH+  +P T  +  G+ F                  F C EC K+F LN  L AHMR HTG RPF+C+ C  SF+ KS L  H  VH   +PF C +C KS+        H ++H
Sbjct:  148 KVHTRIHTGDKPYTCTEC-GKSFRQKQYLKVHRRSHTGEKPFSCCECGKRFHLNQYLKAHMRIHTGERPFSCDQCEKSFSHKSKLDVHMRVHTGLKPFSCTECGKSFCQKQYFKVHMRIH 266          

HSP 3 Score: 73.9442 bits (180), Expect = 9.824e-14
Identity = 35/83 (42.17%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C +C K F+  S+L  HMR HT  RP+TC  C  S+ QK YL  H  +H  ++P+ C +C KS++    L  HR+ H
Sbjct:  102 KPFS--CDQCGKSFSQKSKLPVHMRVHTKERPYTCIYCGKSYCQKQYLKVHTRIHTGDKPYTCTECGKSFRQKQYLKVHRRSH 182          

HSP 4 Score: 68.9366 bits (167), Expect = 4.078e-12
Identity = 34/84 (40.48%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
             + C +C K   +   L  H+R HTG +PF+C+ C  SF+QKS L  H  VH +ERP+ C  C KSY     L  H ++H  D+
Sbjct:   75 GYTCSQCGKSVAIKHNLITHIRIHTGEKPFSCDQCGKSFSQKSKLPVHMRVHTKERPYTCIYCGKSYCQKQYLKVHTRIHTGDK 158          

HSP 5 Score: 64.3142 bits (155), Expect = 1.259e-10
Identity = 39/120 (32.50%), Postives = 55/120 (45.83%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S ++  K  ++ S   V   +H+          K RP++  C  C K +     L  H R HTG +P+TC  C  SF QK YL  H   H  E+PF C +C K +     L  H ++H
Sbjct:  103 PFSCDQCGKSFSQKSKLPVHMRVHT----------KERPYT--CIYCGKSYCQKQYLKVHTRIHTGDKPYTCTECGKSFRQKQYLKVHRRSHTGEKPFSCCECGKRFHLNQYLKAHMRIH 210          
BLAST of SMED30027645 vs. Ensembl Zebrafish
Match: znf1062 (zinc finger protein 1062 [Source:ZFIN;Acc:ZDB-GENE-120709-37])

HSP 1 Score: 83.1889 bits (204), Expect = 1.888e-17
Identity = 54/157 (34.39%), Postives = 78/157 (49.68%), Query Frame = 2
Query:  992 KPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTL------------FDNKGR------PFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            KPT   T  +S    P    ++ N   K+  +S S K + ++H+  +P T             F+N  R      PFS  C +C K FT  + L+ HMR HT  RP+TC  C  SFT K     H  +H  ERP+ C++C+KS+ H G+ A H ++H
Sbjct:   19 KPT--LTKKTSSRGRPRKSKSACNFGSKQSRKSFSQKSNLDVHTREKPYTCEQCGKSFGHIQGFENHMRIHTGEKPFS--CKQCGKSFTQKANLDVHMRVHTKERPYTCEQCGKSFTYKQGFTTHMRIHTGERPYTCQQCEKSFYHPGNFAVHMRIH 171          

HSP 2 Score: 72.0182 bits (175), Expect = 1.050e-13
Identity = 38/113 (33.63%), Postives = 56/113 (49.56%), Query Frame = 2
Query: 1070 LKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
             K+  +S + K + ++H           K RP++  C +C K FT       HMR HTG RP+TC  C  SF        H  +H  ERP+ C++C KS+   G+ A H ++H
Sbjct:   95 CKQCGKSFTQKANLDVH------MRVHTKERPYT--CEQCGKSFTYKQGFTTHMRIHTGERPYTCQQCEKSFYHPGNFAVHMRIHTGERPYTCQQCGKSFYQSGNFAAHMRIH 199          

HSP 3 Score: 62.3882 bits (150), Expect = 1.913e-10
Identity = 37/125 (29.60%), Postives = 53/125 (42.40%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSF-----------------LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYK 1372
            P S  +  K   + ++  V   +H+   P T  +  G+ F++                  C +C K F        HMR HTG RP+TC  C  SF Q      H  +H  ERP+ C +C KS+K
Sbjct:   92 PFSCKQCGKSFTQKANLDVHMRVHTKERPYTC-EQCGKSFTYKQGFTTHMRIHTGERPYTCQQCEKSFYHPGNFAVHMRIHTGERPYTCQQCGKSFYQSGNFAAHMRIHTGERPYSCIQCGKSFK 215          
BLAST of SMED30027645 vs. Ensembl Xenopus
Match: shmt2 (serine hydroxymethyltransferase 2 (mitochondrial) [Source:Xenbase;Acc:XB-GENE-957476])

HSP 1 Score: 88.5817 bits (218), Expect = 2.938e-17
Identity = 49/135 (36.30%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1004 KTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            K T+ + Q       P    E  K   +S + +V   IH+  +P            F C EC K FT+ S L  H R HTG RP++C+VC  S+TQ S L  H   H  E+PF C+ C K Y   GSL  H++ H
Sbjct: 1178 KGTLLTHQRCHTGVKPFKCTECGKSFFQSGNLRVHEKIHTGEKP------------FTCTECGKGFTMRSYLRIHQRTHTGERPYSCDVCGRSYTQSSALAVHQRTHTGEKPFTCDVCGKCYAQGGSLTAHKRTH 1300          

HSP 2 Score: 80.8777 bits (198), Expect = 5.936e-15
Identity = 42/113 (37.17%), Postives = 65/113 (57.52%), Query Frame = 2
Query: 1073 KEVAESSSGKVSSNIHSSGEPNTLFDNKG-RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +E  +S + +   +IH         D+ G +P++  C EC + FT+  +L  H + HTG++PFTC  C  SFTQ+  LI H +VH  E+PF C +C KS+   G+L  H++ H
Sbjct: 1085 RECGKSFARRYCLHIHQR-------DHTGEKPYT--CTECGESFTIKHKLVCHQKKHTGVKPFTCTECGKSFTQRQKLISHQSVHTGEKPFTCSECGKSFFQKGTLLTHQRCH 1188          

HSP 3 Score: 74.3294 bits (181), Expect = 7.389e-13
Identity = 42/120 (35.00%), Postives = 59/120 (49.17%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P    +  KE A SSS ++   +H+  +             F+C EC K+F   S    H++ HTG +PF+C  C  SF  K  L RH + H  E+ F C +C KS+ H  SL  H K+H
Sbjct:  941 PFRCTKCGKEYAYSSSLRLHMKLHTGDK------------LFICTECGKRFLQRSLFLLHVKVHTGEKPFSCTECGESFVYKVQLCRHLSRHTGEKSFTCTECGKSFSHRSSLQLHIKIH 1048          

HSP 4 Score: 73.1738 bits (178), Expect = 1.376e-12
Identity = 41/102 (40.20%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 1115 IHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            IH+ G+P T            C EC K FTL   L +H R HT  RPF+C  C   F     L  H   H+ E+PF C KC K Y +  SL  H KLH  D+
Sbjct:  879 IHTEGKPLT------------CAECGKHFTLTRNLRSHQRIHTEGRPFSCTECGKGFPCNRSLQLHMQRHRGEKPFRCTKCGKEYAYSSSLRLHMKLHTGDK 968          

HSP 5 Score: 73.1738 bits (178), Expect = 1.703e-12
Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K FT   +L +H   HTG +PFTC+ C  SF QK  L+ H   H   +PF C +C KS+   G+L  H K+H
Sbjct: 1138 FTCTECGKSFTQRQKLISHQSVHTGEKPFTCSECGKSFFQKGTLLTHQRCHTGVKPFKCTECGKSFFQSGNLRVHEKIH 1216          

HSP 6 Score: 71.633 bits (174), Expect = 4.164e-12
Identity = 36/80 (45.00%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            SF C EC K F+  S L  H++ HTG +PFTC  C  SF QKS L  H   H  E+PF C +C KS+     L  H++ H
Sbjct: 1025 SFTCTECGKSFSHRSSLQLHIKIHTGEKPFTCTECGKSFFQKSDLHNHQKTHTREKPFTCRECGKSFARRYCLHIHQRDH 1104          

HSP 7 Score: 67.781 bits (164), Expect = 7.211e-11
Identity = 32/79 (40.51%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K F     L  H RCHTG++PF C  C  SF Q   L  H  +H  E+PF C +C K +     L  H++ H
Sbjct: 1166 FTCSECGKSFFQKGTLLTHQRCHTGVKPFKCTECGKSFFQSGNLRVHEKIHTGEKPFTCTECGKGFTMRSYLRIHQRTH 1244          

HSP 8 Score: 67.0106 bits (162), Expect = 1.094e-10
Identity = 34/87 (39.08%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            +PFS  C EC + F    +L  H+  HTG + FTC  C  SF+ +S L  H  +H  E+PF C +C KS+     L NH+K H +++
Sbjct:  996 KPFS--CTECGESFVYKVQLCRHLSRHTGEKSFTCTECGKSFSHRSSLQLHIKIHTGEKPFTCTECGKSFFQKSDLHNHQKTHTREK 1080          

HSP 9 Score: 60.4622 bits (145), Expect = 1.303e-8
Identity = 32/80 (40.00%), Postives = 39/80 (48.75%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMR-CHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K F  N  L +H    H G +PF+C  C   F +K  L  H AVH   +PF C  C K + H   L  HR +H
Sbjct:  801 FKCTECGKGFLHNRSLMSHQSTVHKGHKPFSCTECGKCFARKDNLRYHQAVHTGVKPFACTDCGKRFLHRPDLQQHRVIH 880          

HSP 10 Score: 60.077 bits (144), Expect = 1.755e-8
Identity = 29/83 (34.94%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C EC K F     L  H   HTG++PF C  C   F  +  L +H  +H E +P  C +C K +    +L +H+++H
Sbjct:  828 KPFS--CTECGKCFARKDNLRYHQAVHTGVKPFACTDCGKRFLHRPDLQQHRVIHTEGKPLTCAECGKHFTLTRNLRSHQRIH 908          

HSP 11 Score: 58.151 bits (139), Expect = 5.969e-8
Identity = 37/113 (32.74%), Postives = 48/113 (42.48%), Query Frame = 2
Query: 1154 KGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVC----AFS------------------------FTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +GRPFS  C EC K F  N  L  HM+ H G +PF C  C    A+S                        F Q+S  + H  VH  E+PF C +C +S+ +   L  H   H
Sbjct:  910 EGRPFS--CTECGKGFPCNRSLQLHMQRHRGEKPFRCTKCGKEYAYSSSLRLHMKLHTGDKLFICTECGKRFLQRSLFLLHVKVHTGEKPFSCTECGESFVYKVQLCRHLSRH 1020          

HSP 12 Score: 58.151 bits (139), Expect = 7.135e-8
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 2
Query: 1055 STNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +  E  K  +  SS ++   IH+  +P            F C EC K F   S L+ H + HT  +PFTC  C  SF ++  L  H   H  E+P+ C +C +S+     L  H+K H
Sbjct: 1027 TCTECGKSFSHRSSLQLHIKIHTGEKP------------FTCTECGKSFFQKSDLHNHQKTHTREKPFTCRECGKSFARRYCLHIHQRDHTGEKPYTCTECGESFTIKHKLVCHQKKH 1132          

HSP 13 Score: 56.6102 bits (135), Expect = 1.978e-7
Identity = 37/124 (29.84%), Postives = 51/124 (41.13%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            P S  E  K  A   + +    +H+  +P            F C +C K+F     L  H   HT  +P TC  C   FT    L  H  +H E RPF C +C K +    SL  H + HR ++
Sbjct:  829 PFSCTECGKCFARKDNLRYHQAVHTGVKP------------FACTDCGKRFLHRPDLQQHRVIHTEGKPLTCAECGKHFTLTRNLRSHQRIHTEGRPFSCTECGKGFPCNRSLQLHMQRHRGEK 940          
BLAST of SMED30027645 vs. Ensembl Xenopus
Match: ENSXETT00000017963.1 (zinc finger protein 239-like [Source:NCBI gene;Acc:100488006])

HSP 1 Score: 85.1149 bits (209), Expect = 5.869e-17
Identity = 38/83 (45.78%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 1166 FSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            ++++C  C K FT  S LN H R HTG RPF+C  C  SFT  SYL+RH   H  ERP+ C  C K++   G +  H+K+H K
Sbjct:  288 WAYMCTICGKGFTCISNLNVHQRSHTGERPFSCGQCGKSFTNNSYLVRHQTTHTGERPYPCPICGKTFTRKGHVVTHQKIHTK 370          

HSP 2 Score: 70.4774 bits (171), Expect = 3.676e-12
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+   CP+C K+FT ++ L  H R HTG RP+ C  C  SFT  S L  H   H  E+P+ C++C K++    +L  H + H
Sbjct:  176 RPYP--CPDCGKRFTSSATLTTHKRIHTGERPYICWECGKSFTSNSSLFLHNRTHTGEKPYECKQCGKTFSCSSALVTHTRTH 256          

HSP 3 Score: 67.0106 bits (162), Expect = 5.048e-11
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +C +C + F+  S L  H R HTG +PF C +C   F +K  L+ H  +H  ERP+ C  C K +    +L  H+++H
Sbjct:  123 VCIDCGRSFSYVSHLIIHRRSHTGEKPFECGMCGKCFARKCSLVIHERIHTGERPYPCPDCGKRFTSSATLTTHKRIH 200          

HSP 4 Score: 64.6994 bits (156), Expect = 2.367e-10
Identity = 33/83 (39.76%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+  +C EC K FT NS L  H R HTG +P+ C  C  +F+  S L+ H   H  E+P+ C +C KS+     L  H+  H
Sbjct:  204 RPY--ICWECGKSFTSNSSLFLHNRTHTGEKPYECKQCGKTFSCSSALVTHTRTHTGEKPYTCAECGKSFFDNSRLLKHQATH 284          

HSP 5 Score: 58.9214 bits (141), Expect = 1.591e-8
Identity = 32/79 (40.51%), Postives = 39/79 (49.37%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C EC K F  NSRL  H   HTG   + C +C   FT  S L  H   H  ERPF C +C KS+ +   L  H+  H
Sbjct:  262 YTCAECGKSFFDNSRLLKHQATHTGEWAYMCTICGKGFTCISNLNVHQRSHTGERPFSCGQCGKSFTNNSYLVRHQTTH 340          

HSP 6 Score: 58.9214 bits (141), Expect = 1.897e-8
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C +C K F+ +S L  H R HTG +P+TC  C  SF   S L++H A H  E  + C  C K +    +L  H++ H
Sbjct:  234 YECKQCGKTFSCSSALVTHTRTHTGEKPYTCAECGKSFFDNSRLLKHQATHTGEWAYMCTICGKGFTCISNLNVHQRSH 312          

HSP 7 Score: 58.5362 bits (140), Expect = 2.184e-8
Identity = 31/79 (39.24%), Postives = 38/79 (48.10%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C  C K F     L  H R HTG RP+ C  C   FT  + L  H  +H  ERP+ C +C KS+    SL  H + H
Sbjct:  150 FECGMCGKCFARKCSLVIHERIHTGERPYPCPDCGKRFTSSATLTTHKRIHTGERPYICWECGKSFTSNSSLFLHNRTH 228          

HSP 8 Score: 53.5286 bits (127), Expect = 8.005e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVH 1324
            RPFS  C +C K FT NS L  H   HTG RP+ C +C  +FT+K +++ H  +H
Sbjct:  316 RPFS--CGQCGKSFTNNSYLVRHQTTHTGERPYPCPICGKTFTRKGHVVTHQKIH 368          
BLAST of SMED30027645 vs. Ensembl Xenopus
Match: ENSXETT00000054820.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29631359:29754934:1 gene:ENSXETG00000016980.1 transcript:ENSXETT00000054820.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 6.239e-17
Identity = 46/123 (37.40%), Postives = 64/123 (52.03%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            P +  E  K   E  + +  + IH+  +P            F C EC K FT  S L +H + HTG +PFTC  C  SFT+K  L  H  VH  E+PF C +C KS+    SL NH+++HR++
Sbjct:  120 PYACTECGKSFTEKKTLRDHTKIHTGEKP------------FTCTECGKSFTEKSHLRSHNKIHTGEKPFTCTECGKSFTEKRNLQHHYNVHTGEKPFTCAECGKSFTTSSSLCNHKRIHREE 230          

HSP 2 Score: 74.3294 bits (181), Expect = 1.108e-13
Identity = 44/120 (36.67%), Postives = 55/120 (45.83%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P +  E  K   E S  +  + IH+  +P            F C EC K FT    L  H   HTG +PFTC  C  SFT  S L  H  +H+EERP+ C  C KS+     L NH+  H
Sbjct:  148 PFTCTECGKSFTEKSHLRSHNKIHTGEKP------------FTCTECGKSFTEKRNLQHHYNVHTGEKPFTCAECGKSFTTSSSLCNHKRIHREERPYSCSDCGKSFYVKSHLLNHQNTH 255          

HSP 3 Score: 70.8626 bits (172), Expect = 1.634e-12
Identity = 34/79 (43.04%), Postives = 43/79 (54.43%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K FT    L  H + HTG RP+ C  C  SFT+K  L  H  +H  E+PF C +C KS+     L +H K+H
Sbjct:   93 FTCTECGKGFTQKKTLRNHTKIHTGERPYACTECGKSFTEKKTLRDHTKIHTGEKPFTCTECGKSFTEKSHLRSHNKIH 171          

HSP 4 Score: 64.6994 bits (156), Expect = 1.634e-10
Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            RP+S  C +C K F + S L  H   HTG +PF+C  C   FT+K  L  H  +H  E+P+ C +C K +    +L  H K+H ++
Sbjct:  231 RPYS--CSDCGKSFYVKSHLLNHQNTHTGEKPFSCTECGKCFTEKGTLRMHQKIHTGEKPYTCTECGKCFTEKKNLRRHVKIHARE 314          

HSP 5 Score: 57.3806 bits (137), Expect = 3.680e-8
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query: 1184 ECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            EC + FT    L  H +   G +PFTC  C   FTQK  L  H  +H  ERP+ C +C KS+    +L +H K+H
Sbjct:   70 ECEESFTDKCSLE-HQKIPPGEKPFTCTECGKGFTQKKTLRNHTKIHTGERPYACTECGKSFTEKKTLRDHTKIH 143          
BLAST of SMED30027645 vs. Ensembl Xenopus
Match: ZBTB14 (zinc finger and BTB domain containing 14 [Source:NCBI gene;Acc:100487514])

HSP 1 Score: 85.8853 bits (211), Expect = 6.508e-17
Identity = 37/84 (44.05%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHR 1411
            RPF  +C  C K FT  + L  H++ HTG +P++C VCA SF +   L +H  VH  ERPF C  C K++KH   L +H + HR
Sbjct:  305 RPF--VCEMCAKAFTTQAHLKEHLKIHTGYKPYSCEVCAKSFIRAPDLKKHERVHSNERPFACHLCDKAFKHKSHLKDHERRHR 386          

HSP 2 Score: 73.559 bits (179), Expect = 4.803e-13
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C  C K FT  +RL  H + HT  RPF C +CA +FT +++L  H  +H   +P+ CE C KS+     L  H ++H
Sbjct:  279 FACQACGKTFTDEARLRKHEKLHTADRPFVCEMCAKAFTTQAHLKEHLKIHTGYKPYSCEVCAKSFIRAPDLKKHERVH 357          

HSP 3 Score: 62.003 bits (149), Expect = 2.260e-9
Identity = 29/79 (36.71%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH 1396
            +P+S  C  C K F     L  H R H+  RPF C++C  +F  KS+L  H   H+ E+PF C  C K++     L  H
Sbjct:  333 KPYS--CEVCAKSFIRAPDLKKHERVHSNERPFACHLCDKAFKHKSHLKDHERRHRGEKPFICASCTKAFAKASDLKRH 409          
BLAST of SMED30027645 vs. Ensembl Xenopus
Match: ENSXETT00000023753.1 (oocyte zinc finger protein XlCOF7.1-like [Source:NCBI gene;Acc:100487628])

HSP 1 Score: 86.6557 bits (213), Expect = 7.475e-17
Identity = 38/86 (44.19%), Postives = 54/86 (62.79%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            +PFS  C EC + FT  + LN H R HTG +PF+C+ C  SF Q++ LI+H   H   RPF C  C++S+K+Y  L  H+++H  D
Sbjct:  550 KPFS--CAECGRSFTQRANLNKHNRIHTGEKPFSCSECGKSFIQRAQLIQHQRSHNGARPFSCSDCRRSFKYYADLKKHQRIHTVD 633          

HSP 2 Score: 73.9442 bits (180), Expect = 5.938e-13
Identity = 39/109 (35.78%), Postives = 53/109 (48.62%), Query Frame = 2
Query: 1082 AESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +ES+ G+    IH   +P            F C EC K+F L S+L  H R HTG +PF+C+ C   FT +S L RH   H  ++PF C  C K +     L  H + H
Sbjct:  369 SESTLGRHQRKIHKIDKP------------FGCSECGKRFKLCSKLATHQRYHTGEKPFSCSDCGKCFTHRSDLNRHRKTHNGDKPFPCPDCGKRFAQRSDLKRHYRTH 465          

HSP 3 Score: 73.1738 bits (178), Expect = 1.132e-12
Identity = 34/79 (43.04%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K F   S L  H R HTG +PF+C  C  SFTQ++ L +H  +H  E+PF C +C KS+     L  H++ H
Sbjct:  524 FSCSECDKCFKHYSDLKKHQRVHTGEKPFSCAECGRSFTQRANLNKHNRIHTGEKPFSCSECGKSFIQRAQLIQHQRSH 602          

HSP 4 Score: 65.855 bits (159), Expect = 2.317e-10
Identity = 34/86 (39.53%), Postives = 44/86 (51.16%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            +PFS  C +C K FT  S LN H + H G +PF C  C   F Q+S L RH   H  E+PF C +C K +     L  H   H ++
Sbjct:  413 KPFS--CSDCGKCFTHRSDLNRHRKTHNGDKPFPCPDCGKRFAQRSDLKRHYRTHNGEKPFSCPECGKCFSQRSLLNKHLATHGEE 496          

HSP 5 Score: 60.077 bits (144), Expect = 1.221e-8
Identity = 31/83 (37.35%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C EC K F   ++L  H R H G RPF+C+ C  SF   + L +H  +H  + PF C +C K +     L  H+  H
Sbjct:  578 KPFS--CSECGKSFIQRAQLIQHQRSHNGARPFSCSDCRRSFKYYADLKKHQRIHTVDMPFSCAECGKGFSLSTQLYRHQLNH 658          

HSP 6 Score: 54.299 bits (129), Expect = 7.211e-7
Identity = 35/139 (25.18%), Postives = 50/139 (35.97%), Query Frame = 2
Query: 1151 NKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEE-----------------------------------------------------RPFHCEKCQKSYKHYGSLANHRKLH 1408
            N  +PF   CP+C K+F   S L  H R H G +PF+C  C   F+Q+S L +H A H EE                                                     +PF C +C +S+    +L  H ++H
Sbjct:  438 NGDKPFP--CPDCGKRFAQRSDLKRHYRTHNGEKPFSCPECGKCFSQRSLLNKHLATHGEEAFPLEFGKCFNHRSDFGQQKTDAAEKQFSCSECDKCFKHYSDLKKHQRVHTGEKPFSCAECGRSFTQRANLNKHNRIH 574          
BLAST of SMED30027645 vs. Ensembl Mouse
Match: Zfp768 (zinc finger protein 768 [Source:MGI Symbol;Acc:MGI:2384582])

HSP 1 Score: 87.4261 bits (215), Expect = 2.655e-17
Identity = 40/83 (48.19%), Postives = 52/83 (62.65%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+S  CPEC K ++ NS L +H R HTG RPF+C +C  SF+Q+S LI HA  H  E+PF C +C K +     LA H + H
Sbjct:  399 RPYS--CPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTH 479          

HSP 2 Score: 75.0998 bits (183), Expect = 1.644e-13
Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + CP C K F  +S L  H R H+G +P+ C  C  +F   SYL+RH   H  ERP+ C +C K Y    SL +H+++H
Sbjct:  345 YKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVH 423          

HSP 3 Score: 73.9442 bits (180), Expect = 4.695e-13
Identity = 32/80 (40.00%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++ CP+C K F  +S L  H R HTG RP+ C VC   F + S L++H  VH  ERP+ C+ C K++     L  H++ H
Sbjct:  484 TYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRTH 563          

HSP 4 Score: 68.5514 bits (166), Expect = 2.046e-11
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +C  C K F   S L  H R HTG +P+ C VC+ +F+Q S LI+H   H  ERP+ C +C K++     L  H++ H
Sbjct:  290 ICGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTH 367          

HSP 5 Score: 65.855 bits (159), Expect = 1.358e-10
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C  C K F+ +S L  H R HTG RP+ C  C  +F   SYL+RH   H  ++P+ C  C K++     L  H++ H
Sbjct:  317 YKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTH 395          

HSP 6 Score: 62.003 bits (149), Expect = 2.059e-9
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            + CP C K F  +S L  H R H+  RP++C  C   ++Q S L  H  VH  +RPF C  C KS+    +L  H + H +++
Sbjct:  373 YKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREK 455          

HSP 7 Score: 54.299 bits (129), Expect = 5.463e-7
Identity = 31/83 (37.35%), Postives = 39/83 (46.99%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPFS  C  C K F+  S L  H R H   +PF C  C   F Q S L  HA  H   R + C  C K++    +L  H++ H
Sbjct:  427 RPFS--CGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH 507          
BLAST of SMED30027645 vs. Ensembl Mouse
Match: Zfp768 (zinc finger protein 768 [Source:MGI Symbol;Acc:MGI:2384582])

HSP 1 Score: 87.0409 bits (214), Expect = 2.922e-17
Identity = 40/83 (48.19%), Postives = 52/83 (62.65%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+S  CPEC K ++ NS L +H R HTG RPF+C +C  SF+Q+S LI HA  H  E+PF C +C K +     LA H + H
Sbjct:  396 RPYS--CPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTH 476          

HSP 2 Score: 75.0998 bits (183), Expect = 1.751e-13
Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + CP C K F  +S L  H R H+G +P+ C  C  +F   SYL+RH   H  ERP+ C +C K Y    SL +H+++H
Sbjct:  342 YKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVH 420          

HSP 3 Score: 73.559 bits (179), Expect = 4.873e-13
Identity = 32/80 (40.00%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++ CP+C K F  +S L  H R HTG RP+ C VC   F + S L++H  VH  ERP+ C+ C K++     L  H++ H
Sbjct:  481 TYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRTH 560          

HSP 4 Score: 68.5514 bits (166), Expect = 2.163e-11
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +C  C K F   S L  H R HTG +P+ C VC+ +F+Q S LI+H   H  ERP+ C +C K++     L  H++ H
Sbjct:  287 ICGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTH 364          

HSP 5 Score: 65.855 bits (159), Expect = 1.461e-10
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C  C K F+ +S L  H R HTG RP+ C  C  +F   SYL+RH   H  ++P+ C  C K++     L  H++ H
Sbjct:  314 YKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTH 392          

HSP 6 Score: 62.003 bits (149), Expect = 2.255e-9
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            + CP C K F  +S L  H R H+  RP++C  C   ++Q S L  H  VH  +RPF C  C KS+    +L  H + H +++
Sbjct:  370 YKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREK 452          

HSP 7 Score: 54.299 bits (129), Expect = 5.735e-7
Identity = 31/83 (37.35%), Postives = 39/83 (46.99%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPFS  C  C K F+  S L  H R H   +PF C  C   F Q S L  HA  H   R + C  C K++    +L  H++ H
Sbjct:  424 RPFS--CGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH 504          
BLAST of SMED30027645 vs. Ensembl Mouse
Match: Zfp772 (zinc finger protein 772 [Source:MGI Symbol;Acc:MGI:2385265])

HSP 1 Score: 85.8853 bits (211), Expect = 3.566e-17
Identity = 36/78 (46.15%), Postives = 53/78 (67.95%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +C +C K FT  S LN H   HTG +PF C+ C  SF+QK++LI+H  +H  E+PF C +C K++KH  SL +H+++H
Sbjct:  194 ICSDCGKTFTSTSHLNRHRMIHTGEKPFQCSECGMSFSQKAFLIKHFRIHTGEKPFRCGECGKAFKHNISLVSHQRVH 271          

HSP 2 Score: 80.4925 bits (197), Expect = 1.836e-15
Identity = 37/83 (44.58%), Postives = 52/83 (62.65%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +P+S  C EC K F   S L  H R HT  RPF C+ C  SF+QK++LI+H  +H  E+PF C +C K++KH   L  H+++H
Sbjct:  303 KPYS--CSECGKAFKEKSSLIYHARVHTRERPFQCSECGKSFSQKAFLIKHFRIHTGEKPFRCSECGKTFKHNCFLVAHQRVH 383          

HSP 3 Score: 75.485 bits (184), Expect = 7.330e-14
Identity = 43/120 (35.83%), Postives = 59/120 (49.17%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S +E  K   E SS    + +H+          + RPF   C EC K F+  + L  H R HTG +PF C+ C  +F    +L+ H  VH  E PF C +C KSY +  SL  H ++H
Sbjct:  304 PYSCSECGKAFKEKSSLIYHARVHT----------RERPFQ--CSECGKSFSQKAFLIKHFRIHTGEKPFRCSECGKTFKHNCFLVAHQRVHTGETPFTCTECGKSYMNRSSLLYHYRVH 411          

HSP 4 Score: 75.485 bits (184), Expect = 7.732e-14
Identity = 35/82 (42.68%), Postives = 47/82 (57.32%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            F C EC K F  N  L +H R HTG  PFTC  C  S+  +S L RH  VH  E+P+ C +C K++K   SL  H ++H ++
Sbjct:  249 FRCGECGKAFKHNISLVSHQRVHTGETPFTCTECGKSYMTRSNLTRHFQVHAAEKPYSCSECGKAFKEKSSLIYHARVHTRE 330          

HSP 5 Score: 73.1738 bits (178), Expect = 4.912e-13
Identity = 32/79 (40.51%), Postives = 44/79 (55.70%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K +   S L  H + H   +P++C+ C  +F +KS LI HA VH  ERPF C +C KS+     L  H ++H
Sbjct:  277 FTCTECGKSYMTRSNLTRHFQVHAAEKPYSCSECGKAFKEKSSLIYHARVHTRERPFQCSECGKSFSQKAFLIKHFRIH 355          

HSP 6 Score: 65.0846 bits (157), Expect = 1.784e-10
Identity = 36/105 (34.29%), Postives = 52/105 (49.52%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEK-NDSEMLNEVKIEQSVSYNGK 1483
            F C EC   F+  + L  H R HTG +PF C  C  +F     L+ H  VH  E PF C +C KSY    +L  H ++H  ++  + SE     K + S+ Y+ +
Sbjct:  221 FQCSECGMSFSQKAFLIKHFRIHTGEKPFRCGECGKAFKHNISLVSHQRVHTGETPFTCTECGKSYMTRSNLTRHFQVHAAEKPYSCSECGKAFKEKSSLIYHAR 325          
BLAST of SMED30027645 vs. Ensembl Mouse
Match: Zfp213 (zinc finger protein 213 [Source:MGI Symbol;Acc:MGI:3053094])

HSP 1 Score: 85.5001 bits (210), Expect = 6.466e-17
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            +PFS  C EC K F+ ++ L  H R HTG +PF+C+ C  SF  +SYL+ H  VH  ERPF C +C KS+K    L  H+ LH K
Sbjct:  380 KPFS--CSECGKSFSRSAYLADHQRIHTGEKPFSCSECGKSFALRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHSK 462          

HSP 2 Score: 79.7221 bits (195), Expect = 4.117e-15
Identity = 48/146 (32.88%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  974 GSRRKRKPTNKTTVDSSQLASPLAH-PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            G+RR R PT++      Q  + LA  P S  +  K     S        H+  +P+             CPEC K F  +S L  H   HTG +PF+C+ C  SF++ +YL  H  +H  E+PF C +C KS+     L +HR++H
Sbjct:  304 GARRGRPPTHRR-----QFQNLLAEKPHSCAQCGKRFRWGSDLARHQRTHTGEKPHK------------CPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFSCSECGKSFALRSYLLDHRRVH 432          
BLAST of SMED30027645 vs. Ensembl Mouse
Match: Zfp606 (zinc finger protein 606 [Source:MGI Symbol;Acc:MGI:1914620])

HSP 1 Score: 85.5001 bits (210), Expect = 1.482e-16
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P   N+  K  + +S   V + IH+  +P            ++C EC K F  NS L  H R HTG +PF C  C  SF+  S+LI H  +H  E+PF C++C+K+++ Y +L+ H + H
Sbjct:  458 PYECNKCGKAFSWNSHLIVHTRIHTGEKP------------YVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCDECEKAFRDYSALSKHERTH 565          

HSP 2 Score: 70.4774 bits (171), Expect = 6.110e-12
Identity = 31/77 (40.26%), Postives = 44/77 (57.14%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C EC K F   S L  H   H+G++P+ CN C  S +Q ++L+RH   H  E+P+ C KC KS+     L  HR++H
Sbjct:  601 CQECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIH 677          

HSP 3 Score: 70.0922 bits (170), Expect = 7.969e-12
Identity = 37/120 (30.83%), Postives = 55/120 (45.83%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P   +E  K   + S+       HS  +P            + C EC K F+ +S L AH R HTG +P+ C  C  +F ++S L +H  +H   +P+ C KC KS      L  H++ H
Sbjct:  542 PFKCDECEKAFRDYSALSKHERTHSGAKP------------YKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTH 649          

HSP 4 Score: 70.0922 bits (170), Expect = 8.832e-12
Identity = 43/150 (28.67%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  998 TNKTTVDSSQLASPLAH--------PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEK 1423
             NK     SQ+A  + H        P   N+  K  ++S        IH+  +P            + C +C + F  +S L AH R HTG +P+ CN C  +F + S LI H   H  E+P+ C  C+K++    SL  H+++H  +++
Sbjct:  629 CNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKP------------YKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKR 766          

HSP 5 Score: 66.6254 bits (161), Expect = 1.005e-10
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C +C K F   S L  H R HTG++P+ CN C  +F+  S+LI H  +H  E+P+ C +C KS+     L  H++ H
Sbjct:  431 YECDKCGKVFRNRSALTKHERTHTGVKPYECNKCGKAFSWNSHLIVHTRIHTGEKPYVCNECGKSFNWNSHLIGHQRTH 509          

HSP 6 Score: 66.2402 bits (160), Expect = 1.345e-10
Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P +  E  K   E S+      IHS  +P            + C +C K  +  + L  H R HTG +P+ CN C  SF+Q  +L+ H  +H  E+P+ C +C++S+     L  HR+ H
Sbjct:  598 PYNCQECGKAFRERSALTKHEIIHSGIKP------------YECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTH 705          

HSP 7 Score: 62.7734 bits (151), Expect = 1.581e-9
Identity = 30/83 (36.14%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            + C EC K F  +S L  H+R HTG +P+ CN C  +F + S LI H  +H  E+ F C +C +++  + +L  H+K H +++
Sbjct:  711 YRCNECGKAFNESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNQCGRAFSGHSALLQHQKNHSEEK 793          

HSP 8 Score: 57.7658 bits (138), Expect = 5.356e-8
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query: 1184 ECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            E  K F  +S L  H   +T  +P+  N C  SF   SYLI+H   H  E+P+ C+KC K +++  +L  H + H
Sbjct:  379 EWEKVFGYDSLLTQHTSTYTAEKPYEFNKCGTSFIWSSYLIQHKKTHPGEKPYECDKCGKVFRNRSALTKHERTH 453          

HSP 9 Score: 52.373 bits (124), Expect = 2.701e-6
Identity = 25/83 (30.12%), Postives = 41/83 (49.40%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +P+ F   +C   F  +S L  H + H G +P+ C+ C   F  +S L +H   H   +P+ C KC K++     L  H ++H
Sbjct:  401 KPYEF--NKCGTSFIWSSYLIQHKKTHPGEKPYECDKCGKVFRNRSALTKHERTHTGVKPYECNKCGKAFSWNSHLIVHTRIH 481          
BLAST of SMED30027645 vs. UniProt/SwissProt
Match: sp|Q8R0T2|ZN768_MOUSE (Zinc finger protein 768 OS=Mus musculus OX=10090 GN=Znf768 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.857e-16
Identity = 40/83 (48.19%), Postives = 52/83 (62.65%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+S  CPEC K ++ NS L +H R HTG RPF+C +C  SF+Q+S LI HA  H  E+PF C +C K +     LA H + H
Sbjct:  399 RPYS--CPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTH 479          

HSP 2 Score: 75.0998 bits (183), Expect = 1.150e-12
Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + CP C K F  +S L  H R H+G +P+ C  C  +F   SYL+RH   H  ERP+ C +C K Y    SL +H+++H
Sbjct:  345 YKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVH 423          

HSP 3 Score: 73.9442 bits (180), Expect = 3.284e-12
Identity = 32/80 (40.00%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++ CP+C K F  +S L  H R HTG RP+ C VC   F + S L++H  VH  ERP+ C+ C K++     L  H++ H
Sbjct:  484 TYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRTH 563          

HSP 4 Score: 68.5514 bits (166), Expect = 1.431e-10
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +C  C K F   S L  H R HTG +P+ C VC+ +F+Q S LI+H   H  ERP+ C +C K++     L  H++ H
Sbjct:  290 ICGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTH 367          

HSP 5 Score: 65.855 bits (159), Expect = 9.500e-10
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C  C K F+ +S L  H R HTG RP+ C  C  +F   SYL+RH   H  ++P+ C  C K++     L  H++ H
Sbjct:  317 YKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTH 395          

HSP 6 Score: 62.003 bits (149), Expect = 1.440e-8
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            + CP C K F  +S L  H R H+  RP++C  C   ++Q S L  H  VH  +RPF C  C KS+    +L  H + H +++
Sbjct:  373 YKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREK 455          

HSP 7 Score: 54.299 bits (129), Expect = 3.821e-6
Identity = 31/83 (37.35%), Postives = 39/83 (46.99%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPFS  C  C K F+  S L  H R H   +PF C  C   F Q S L  HA  H   R + C  C K++    +L  H++ H
Sbjct:  427 RPFS--CGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSH 507          
BLAST of SMED30027645 vs. UniProt/SwissProt
Match: sp|Q96ND8|ZN583_HUMAN (Zinc finger protein 583 OS=Homo sapiens OX=9606 GN=ZNF583 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 2.124e-16
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RPF   C EC K F+  S L  H R HTG +P+ CNVC  +F+ + YLI H  +H  ERP+ C++C+K++  Y  LA H+++H
Sbjct:  322 RPFE--CIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVH 402          

HSP 2 Score: 78.9518 bits (193), Expect = 8.518e-14
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++C EC K F+ N+ L  H R HTG +P+ CNVC  +F+    L  H  +H  ERP+ C+ C+KS++    LA+H ++H
Sbjct:  464 YMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIH 542          

HSP 3 Score: 75.0998 bits (183), Expect = 1.235e-12
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 2
Query:  911 TIVDLNTNGNSK-KSNELQNKKGSRRKRK---PTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFS-----------------FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            TI D+  +  +K K+++ + +K S RK+       K  V+   L          N+  K   +SSS  +   IH+  +P    +  G+ FS                 + C EC K F+ N+ L  H R HTG +P+ C  C  +F+Q ++L +H  VH  ERPF C +C K++ +   LA H+++H
Sbjct:  169 TIFDIQQSFPTKEKAHKHEPQKKSYRKKSVEMKHRKVYVEKKLL--------KCNDCEKVFNQSSSLTLHQRIHTGEKPYACVEC-GKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIH 346          

HSP 4 Score: 73.559 bits (179), Expect = 3.406e-12
Identity = 34/83 (40.96%), Postives = 51/83 (61.45%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+   C EC K F+  + L  H R HTG +P+ C VC  +F+Q +YL +H  VH  E+P+ C +C K++ +  SLA H++ H
Sbjct:  378 RPYE--CKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSH 458          

HSP 5 Score: 67.781 bits (164), Expect = 2.152e-10
Identity = 30/79 (37.97%), Postives = 48/79 (60.76%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C EC K F+ +S L  H R HTG +P+ C  C  +F+Q + L +H  +H  E+P+ C  C K++ + GSL  H+++H
Sbjct:  436 YECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIH 514          

HSP 6 Score: 67.3958 bits (163), Expect = 3.523e-10
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            ++C  C K F+    L  H R HTG RP+ C  C  +F+Q ++L +H  VH  E+P+ C+ C+K++     L  H+++H
Sbjct:  352 YVCNVCGKAFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVH 430          

HSP 7 Score: 62.7734 bits (151), Expect = 9.783e-9
Identity = 30/103 (29.13%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNG 1480
            + C  C K F+  + L+ H R HTG +P+ C  C  +F+  S L +H   H  E+P+ C++C+K++     LA H+++H  ++  +  +       ++ SY+G
Sbjct:  408 YECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCG-----KAFSYSG 505          
BLAST of SMED30027645 vs. UniProt/SwissProt
Match: sp|O14771|ZN213_HUMAN (Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 5.044e-16
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            +PFS  C EC K F+ ++ L  H R HTG +PF C+ C  SF+ +SYL+ H  VH  ERPF C +C KS+K    L  H+ LH K
Sbjct:  371 KPFS--CSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAK 453          

HSP 2 Score: 77.7962 bits (190), Expect = 1.416e-13
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            CPEC K F  +S L  H   HTG +PF+C+ C  SF++ +YL  H  +H  E+PF C  C KS+     L +HR++H
Sbjct:  347 CPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVH 423          
BLAST of SMED30027645 vs. UniProt/SwissProt
Match: sp|Q92010|ZBT14_CHICK (Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus OX=9031 GN=ZBTB14 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.121e-15
Identity = 36/84 (42.86%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHR 1411
            RPF  +C  C K FT  + L  H++ HTG +P++C VC  SF +   L +H  VH  ERPF C  C K++KH   L +H + HR
Sbjct:  301 RPF--VCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHR 382          

HSP 2 Score: 68.9366 bits (167), Expect = 8.441e-11
Identity = 37/133 (27.82%), Postives = 63/133 (47.37%), Query Frame = 2
Query: 1010 TVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            T +S  L S      + N+ + EV +  +   ++   ++G+    +   G     +C  C K F+  +RL  H + HT  RPF C +C   FT +++L  H  +H   +P+ CE C KS+     L  H ++H
Sbjct:  224 TTESKDLGSQTPQALTFNDGISEVKDEQTPGWTT---AAGDMKFEYLLYGHREHIVCQACGKTFSDEARLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVH 353          

HSP 3 Score: 61.2326 bits (147), Expect = 2.126e-8
Identity = 29/79 (36.71%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH 1396
            +P+S  C  C K F     L  H R H+  RPF C++C  +F  KS+L  H   H+ E+PF C  C K++     L  H
Sbjct:  329 KPYS--CEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRH 405          
BLAST of SMED30027645 vs. UniProt/SwissProt
Match: sp|O43829|ZBT14_HUMAN (Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 1.222e-15
Identity = 36/84 (42.86%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHR 1411
            RPF  +C  C K FT  + L  H++ HTG +P++C VC  SF +   L +H  VH  ERPF C  C K++KH   L +H + HR
Sbjct:  303 RPF--VCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHR 384          

HSP 2 Score: 66.6254 bits (161), Expect = 3.793e-10
Identity = 28/77 (36.36%), Postives = 40/77 (51.95%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C  C K F+   RL  H + HT  RPF C +C   FT +++L  H  +H   +P+ CE C KS+     L  H ++H
Sbjct:  279 CQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVH 355          

HSP 3 Score: 61.2326 bits (147), Expect = 2.150e-8
Identity = 29/79 (36.71%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH 1396
            +P+S  C  C K F     L  H R H+  RPF C++C  +F  KS+L  H   H+ E+PF C  C K++     L  H
Sbjct:  331 KPYS--CEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRH 407          
BLAST of SMED30027645 vs. TrEMBL
Match: A0A448WLH6 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS8131 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.254e-33
Identity = 65/128 (50.78%), Postives = 81/128 (63.28%), Query Frame = 2
Query: 1121 SSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK--DEKNDSEMLNEVKIEQSVSYNGKPSIVM 1498
            S G P  L D KGRP +F CP CP++F    RL AH+RCHT +RPF C  C  +FTQK YL RHAAVHK +RPF C  C +SYKHYGSL NHR+ H K      D EM ++  +  +V  +G  +I +
Sbjct:   26 SVGGPVPL-DRKGRPCAFPCPACPRRFAFQCRLAAHLRCHTNIRPFICTDCGRAFTQKGYLARHAAVHKLDRPFCCSLCDRSYKHYGSLVNHRRTHGKVAGLAGDQEMADQ--LVSAVGSSGVGAITL 150          
BLAST of SMED30027645 vs. TrEMBL
Match: A0A183SCJ8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.039e-32
Identity = 53/90 (58.89%), Postives = 64/90 (71.11%), Query Frame = 2
Query: 1145 FDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            FD KGRP +F C  CP++F    RL AHMRCH  +RPF C  C  +FTQK YL+RH AVHK +RPF C  C+++YKHYGSL NHR+ H K
Sbjct:   15 FDRKGRPCNFACSACPRRFAFQCRLAAHMRCHANIRPFICPDCGRAFTQKGYLVRHGAVHKLDRPFVCNLCERAYKHYGSLVNHRRTHSK 104          
BLAST of SMED30027645 vs. TrEMBL
Match: A0A3P7DML9 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS1946 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.156e-32
Identity = 53/90 (58.89%), Postives = 64/90 (71.11%), Query Frame = 2
Query: 1145 FDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            FD KGRP +F C  CP++F    RL AHMRCH  +RPF C  C  +FTQK YL+RH AVHK +RPF C  C+++YKHYGSL NHR+ H K
Sbjct:   15 FDRKGRPCNFACSACPRRFAFQCRLAAHMRCHANIRPFICPDCGRAFTQKGYLVRHGAVHKLDRPFVCNLCERAYKHYGSLVNHRRTHSK 104          
BLAST of SMED30027645 vs. TrEMBL
Match: A0A158R8W4 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6206 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.055e-32
Identity = 62/119 (52.10%), Postives = 77/119 (64.71%), Query Frame = 2
Query: 1058 TNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            T + LK VA + +  V  +  S G P +  D KGR F+F CP CP++F    RL AH+R HT  RPFTC  C  +FTQ+ YL+RHAAVH  ERPF C  C ++YKHYGSL NHR+ H K
Sbjct:  329 TTDQLKLVAAAVA--VGGSSASDGPPGSALDAKGRAFNFPCPACPRRFVFQCRLAAHLRSHTNFRPFTCPDCGRAFTQRGYLVRHAAVHANERPFVCTLCDRAYKHYGSLVNHRRTHSK 445          
BLAST of SMED30027645 vs. TrEMBL
Match: A0A2H1C5U9 (Zinc finger, C2H2 type OS=Fasciola hepatica OX=6192 GN=D915_10153 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.767e-31
Identity = 58/96 (60.42%), Postives = 69/96 (71.88%), Query Frame = 2
Query: 1127 GEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            G P  L D KGRP +F CP CP++F    RL AH+RCHT +RPF C  C  +FTQ+ YL+RHAAVHK +RPF CE C +SYKHYGSL NHR+ H K
Sbjct:   72 GGPVPL-DRKGRPCNFPCPACPRRFAFQCRLAAHLRCHTNVRPFICIDCGRAFTQRGYLVRHAAVHKLDRPFSCELCDRSYKHYGSLVNHRRTHSK 166          
BLAST of SMED30027645 vs. Ensembl Cavefish
Match: ENSAMXT00000031300.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000129.1:98497:107536:1 gene:ENSAMXG00000040155.1 transcript:ENSAMXT00000031300.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 3.098e-19
Identity = 35/78 (44.87%), Postives = 49/78 (62.82%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            LCPEC + F+  SRL  H+R HTG RP+ C+ C  SF Q   ++RH  VH  E+P+ C  C +S+   G+L  HR++H
Sbjct:   28 LCPECGRSFSRQSRLEVHLRVHTGERPYLCSQCGKSFAQLGGILRHRRVHTGEKPYCCPDCGRSFTQQGNLQQHRRVH 105          

HSP 2 Score: 55.0694 bits (131), Expect = 1.468e-8
Identity = 26/73 (35.62%), Postives = 39/73 (53.42%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHY 1378
            RP+  LC +C K F     +  H R HTG +P+ C  C  SFTQ+  L +H  VH  E+ + C  C + ++ +
Sbjct:   53 RPY--LCSQCGKSFAQLGGILRHRRVHTGEKPYCCPDCGRSFTQQGNLQQHRRVHTGEKLYCCSDCGRRFQEH 123          
BLAST of SMED30027645 vs. Ensembl Cavefish
Match: zbtb14 (zinc finger and BTB domain containing 14 [Source:NCBI gene;Acc:103042525])

HSP 1 Score: 85.1149 bits (209), Expect = 5.251e-17
Identity = 36/84 (42.86%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHR 1411
            RPF  +C  CPK FT  + L  H++ HTG +P+ C+ C  SF +   L +H  VH  ERPF C+ C+K++KH   L +H + HR
Sbjct:  271 RPF--ICEICPKAFTTQAHLKEHLKIHTGFKPYRCDDCGKSFIRAPDLKKHERVHSNERPFGCQMCEKAFKHKSHLKDHERRHR 352          

HSP 2 Score: 66.2402 bits (160), Expect = 6.147e-11
Identity = 28/79 (35.44%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C  C K F   SRL  H + H+  RPF C +C  +FT +++L  H  +H   +P+ C+ C KS+     L  H ++H
Sbjct:  245 FACQICGKTFLDESRLRKHEKLHSAERPFICEICPKAFTTQAHLKEHLKIHTGFKPYRCDDCGKSFIRAPDLKKHERVH 323          

HSP 3 Score: 60.4622 bits (145), Expect = 3.918e-9
Identity = 27/75 (36.00%), Postives = 37/75 (49.33%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH 1396
            + C +C K F     L  H R H+  RPF C +C  +F  KS+L  H   H+ E+PF C  C K++     L  H
Sbjct:  301 YRCDDCGKSFIRAPDLKKHERVHSNERPFGCQMCEKAFKHKSHLKDHERRHRGEKPFMCGACPKAFAKASDLKRH 375          
BLAST of SMED30027645 vs. Ensembl Cavefish
Match: si:ch211-155e24.3 (zinc finger protein 835-like [Source:NCBI gene;Acc:103032638])

HSP 1 Score: 85.5001 bits (210), Expect = 6.943e-17
Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            F C  C ++F    +L  H+R HTG RP+TC  C  SFT++  LIRHA VH  E+P+ C  C K +    SL +H+K H  D
Sbjct:  397 FSCTYCERRFVRFGQLKEHLRSHTGERPYTCTQCGRSFTKQGNLIRHAVVHSGEKPYQCGLCGKCFTQRSSLKSHQKTHMPD 478          
BLAST of SMED30027645 vs. Ensembl Cavefish
Match: si:ch211-155e24.3 (zinc finger protein 835-like [Source:NCBI gene;Acc:103032638])

HSP 1 Score: 85.1149 bits (209), Expect = 7.383e-17
Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            F C  C ++F    +L  H+R HTG RP+TC  C  SFT++  LIRHA VH  E+P+ C  C K +    SL +H+K H  D
Sbjct:  399 FSCTYCERRFVRFGQLKEHLRSHTGERPYTCTQCGRSFTKQGNLIRHAVVHSGEKPYQCGLCGKCFTQRSSLKSHQKTHMPD 480          
BLAST of SMED30027645 vs. Ensembl Cavefish
Match: GZF1 (GDNF inducible zinc finger protein 1 [Source:HGNC Symbol;Acc:HGNC:15808])

HSP 1 Score: 84.7297 bits (208), Expect = 1.662e-16
Identity = 43/120 (35.83%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S NE     ++SS+ +    IH+  +P            F C  C  KFT N  L  H RCHTG +PF C  C  SF  K YL  HA +H   +P+ C+ C +++    SL  H K+H
Sbjct:  408 PYSCNECEARFSQSSALRTHQRIHTGEKP------------FACDMCDAKFTQNHMLAYHKRCHTGEKPFMCENCGKSFASKEYLKHHARIHSGFKPYKCDNCGRAFAQRNSLHQHMKIH 515          

HSP 2 Score: 64.3142 bits (155), Expect = 4.245e-10
Identity = 28/79 (35.44%), Postives = 41/79 (51.90%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C  C K  +  + L  H R HTG +P++CN C   F+Q S L  H  +H  E+PF C+ C   +     LA H++ H
Sbjct:  381 YYCTICGKSLSSRTALTLHERTHTGDKPYSCNECEARFSQSSALRTHQRIHTGEKPFACDMCDAKFTQNHMLAYHKRCH 459          

HSP 3 Score: 59.6918 bits (143), Expect = 1.048e-8
Identity = 30/108 (27.78%), Postives = 50/108 (46.30%), Query Frame = 2
Query: 1124 SGEPNTLFDNKGRPFS-----------------FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH 1396
            +GE   + +N G+ F+                 + C  C + F   + L+ HM+ HTG RP+ C  C   FTQ + L RH  +H  E+P+ C  C +++    ++  H
Sbjct:  460 TGEKPFMCENCGKSFASKEYLKHHARIHSGFKPYKCDNCGRAFAQRNSLHQHMKIHTGERPYHCKECDKQFTQLNALQRHQRIHTGEKPYMCSVCGRTFTDKSTVRRH 567          
BLAST of SMED30027645 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009002.1 (pep scaffold:Pmarinus_7.0:GL487004:1276:1827:-1 gene:ENSPMAG00000008149.1 transcript:ENSPMAT00000009002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.729e-16
Identity = 37/85 (43.53%), Postives = 47/85 (55.29%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAA------VHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K FTL   L  HMR HTG RP+ C +C  +F + S L+RH A      +H   +PF CE+C KS+     L  HR +H
Sbjct:   29 FQCEECGKLFTLKYSLKIHMRQHTGERPYRCELCGETFARSSSLLRHRALAIHLRIHAPVKPFACEECGKSFATASYLTKHRLMH 113          

HSP 2 Score: 48.9062 bits (115), Expect = 4.876e-7
Identity = 24/66 (36.36%), Postives = 32/66 (48.48%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSY 1369
            F C EC K F   S L  H   HTG +PF C+ C   F+ ++ L  H       RP  CE C +++
Sbjct:   91 FACEECGKSFATASYLTKHRLMHTGTKPFHCDACGKQFSFRTNLNHHRRTTHAARP--CEWCPQTH 154          

HSP 3 Score: 46.9802 bits (110), Expect = 2.318e-6
Identity = 27/77 (35.06%), Postives = 34/77 (44.16%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHM-RCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKL 1405
            C  C ++F     L AH+   H     F C  C   FT K  L  H   H  ERP+ CE C +++    SL  HR L
Sbjct:    2 CGLCAQRFAEQRLLAAHVASAHRTESGFQCEECGKLFTLKYSLKIHMRQHTGERPYRCELCGETFARSSSLLRHRAL 78          
BLAST of SMED30027645 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006856.1 (pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1 gene:ENSPMAG00000006196.1 transcript:ENSPMAT00000006856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.855e-15
Identity = 33/86 (38.37%), Postives = 46/86 (53.49%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            RPF+  C  C K F     L  H R HTG +P+ CN C  +F++  +L +H A H  ERPF C+ C +++     L +HR  H  D
Sbjct:   28 RPFT--CALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKHRATHAAERPFKCDTCGRAFAQARYLKSHRATHAAD 111          

HSP 2 Score: 63.929 bits (154), Expect = 1.784e-12
Identity = 28/79 (35.44%), Postives = 38/79 (48.10%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C  C + F+ +  L+ H   H   RPF C+ C  +F Q  YL  H A H  +RPF C  C K++     L  HR  H
Sbjct:   58 YECNACGRAFSESGHLDKHRATHAAERPFKCDTCGRAFAQARYLKSHRATHAADRPFECGACGKTFTLARYLDRHRSRH 136          

HSP 3 Score: 56.9954 bits (136), Expect = 6.109e-10
Identity = 26/69 (37.68%), Postives = 35/69 (50.72%), Query Frame = 2
Query: 1202 TLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            T +  L+ H R HTG RPFTC +C  +F     L  H   H  E+P+ C  C +++   G L  HR  H
Sbjct:   12 TTSWNLHKHRRTHTGERPFTCALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKHRATH 80          
BLAST of SMED30027645 vs. Ensembl Sea Lamprey
Match: GZF1 (GDNF inducible zinc finger protein 1 [Source:HGNC Symbol;Acc:HGNC:15808])

HSP 1 Score: 76.2554 bits (186), Expect = 1.214e-14
Identity = 42/133 (31.58%), Postives = 58/133 (43.61%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNE 1447
            P    E     ++ SS KV    H+  +P            F+C +C  +FT N  L  H R HTG RPF C  C  SF  K YL  H  +H   +PF C  C +++    SL  H K+H  +     +M  +
Sbjct:  435 PYHCTECAARFSQVSSLKVHQRTHTGEKP------------FVCEDCGARFTQNHMLIYHKRIHTGERPFMCETCGKSFASKEYLKHHNRIHSGSKPFLCNVCGRAFAQRNSLYQHAKIHTGERPYCCDMCGK 555          

HSP 2 Score: 64.6994 bits (156), Expect = 5.664e-11
Identity = 31/77 (40.26%), Postives = 40/77 (51.95%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            CPEC K  +  + L  H R HTG RP+ C  CA  F+Q S L  H   H  E+PF CE C   +     L  H+++H
Sbjct:  410 CPECGKGLSSRTALRLHERTHTGDRPYHCTECAARFSQVSSLKVHQRTHTGEKPFVCEDCGARFTQNHMLIYHKRIH 486          

HSP 3 Score: 49.2914 bits (116), Expect = 3.179e-6
Identity = 29/85 (34.12%), Postives = 38/85 (44.71%), Query Frame = 2
Query: 1112 NIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQ--------KSYLIRHAAVHKEERPF 1342
             IHS  +P            FLC  C + F   + L  H + HTG RP+ C++C   FTQ        KS L RH  VH +  P+
Sbjct:  512 RIHSGSKP------------FLCNVCGRAFAQRNSLYQHAKIHTGERPYCCDMCGKQFTQLNGRTFTDKSTLRRHTLVHDKNAPW 584          
BLAST of SMED30027645 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001415.1 (pep scaffold:Pmarinus_7.0:GL483974:8149:10580:-1 gene:ENSPMAG00000001278.1 transcript:ENSPMAT00000001415.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.572e-14
Identity = 31/79 (39.24%), Postives = 47/79 (59.49%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F+C  C ++FT +  L  H R HT  RP+ C VC  +F ++ +L  H  +H +E+PF C++C K +    +LA HR LH
Sbjct:   69 FVCKFCGRRFTKSYNLLIHERTHTDERPYVCEVCHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHRTLH 147          

HSP 2 Score: 50.447 bits (119), Expect = 1.609e-7
Identity = 20/57 (35.09%), Postives = 32/57 (56.14%), Query Frame = 2
Query: 1250 RPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            + F C  C   FT+   L+ H   H +ERP+ CE C K+++    L +HR +H K++
Sbjct:   67 KEFVCKFCGRRFTKSYNLLIHERTHTDERPYVCEVCHKAFRRQDHLRDHRYIHSKEK 123          
BLAST of SMED30027645 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001747.1 (pep scaffold:Pmarinus_7.0:GL479152:3602:4030:-1 gene:ENSPMAG00000001584.1 transcript:ENSPMAT00000001747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.667e-14
Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 2
Query: 1154 KGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            K RP    C  C  +F     L  HMR HTG RP+ C VC  +F+Q   L +H   H  ER + C  C +++KH+  L  H + H
Sbjct:    1 KARPHQ--CLHCDSRFFKTDDLKRHMRTHTGERPYCCEVCGRAFSQLCNLKKHWITHTGERQYRCALCGRAFKHFSGLRLHERTH 83          
BLAST of SMED30027645 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 75.0998 bits (183), Expect = 2.631e-14
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            CP C + F+  + L  H+R H G +PF C+ C   FTQ   L  H  +H  E+P+ C+ C K +   G+LA H   H+K
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQK 673          

HSP 2 Score: 71.633 bits (174), Expect = 2.885e-13
Identity = 29/84 (34.52%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHC--EKCQKSYKHYGSLANHR-KLHRK 1414
            F+C  C K+FT    L  H R HTG +P++C++C   F++K  L  H   H++ +PF C  E C K++   G++  H+ + H++
Sbjct:  621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKE 704          
BLAST of SMED30027645 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 62.7734 bits (151), Expect = 1.394e-10
Identity = 27/82 (32.93%), Postives = 45/82 (54.88%), Query Frame = 2
Query: 1136 NTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYG 1381
            +++ +N+  P +F C  C KKFT    L +H+R HT  RPF C++C  +F ++    RH  +H  ++ + C    K  K +G
Sbjct:  557 DSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWG 638          
BLAST of SMED30027645 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 57.3806 bits (137), Expect = 5.364e-9
Identity = 33/87 (37.93%), Postives = 42/87 (48.28%), Query Frame = 2
Query: 1163 PFSFLCPE--CPKKFTLNSRLNAH-MRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            P ++ C    C K FT  S L  H +  H G+R F C+ CA SF +KS+L RH   H + +PF C  C K       L  H   H K
Sbjct:   46 PKTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTK 132          
BLAST of SMED30027645 vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 55.8398 bits (133), Expect = 2.157e-8
Identity = 23/56 (41.07%), Postives = 33/56 (58.93%), Query Frame = 2
Query: 1250 RPFTCNVCAFSFTQKSYLIRHA-AVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            +PF C++C  SF +  +L RH  +VH  ERPF C  C K +    +L+ H K H+K
Sbjct:  645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKK 700          
BLAST of SMED30027645 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 55.4546 bits (132), Expect = 2.811e-8
Identity = 29/90 (32.22%), Postives = 44/90 (48.89%), Query Frame = 2
Query: 1154 KGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEK 1423
            K +P+   C  C + F+    L  H R H+G +P+ C++C   F   S L  H   H  E+P  C+ C K +    +L+ H K H+K  K
Sbjct:  764 KYKPYK--CKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKKYK 851          

HSP 2 Score: 51.2174 bits (121), Expect = 5.192e-7
Identity = 22/81 (27.16%), Postives = 39/81 (48.15%), Query Frame = 2
Query: 1166 FSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +  L  +C + F    +L  H++ H+  +P+ C  C   F+ +  L++H   H  E+P+ C  C K +    SL  H + H
Sbjct:  738 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTH 818          
BLAST of SMED30027645 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 72.4034 bits (176), Expect = 1.036e-15
Identity = 29/86 (33.72%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            RP++     CP++F+ +  L  HMR HTG +PF C +C  +F++  +L  H   H  E+PF CE C + +        H K+H ++
Sbjct:    2 RPYACPVETCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLRE 87          
BLAST of SMED30027645 vs. Ensembl Nematostella
Match: EDO31301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA3])

HSP 1 Score: 70.8626 bits (172), Expect = 3.460e-14
Identity = 33/80 (41.25%), Postives = 44/80 (55.00%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            S+ C  C K+F  +  L  H+R HTG RP+ C VC   F     L RH+  H  E+PF CE C+K +  +GS   H +LH
Sbjct:   15 SYTCEHCGKRFNKSYNLKTHLRVHTGERPYQCEVCGHGFANLGDLKRHSRTHTGEKPFKCEYCEKVFSDFGSHKRHIRLH 94          

HSP 2 Score: 54.6842 bits (130), Expect = 1.546e-8
Identity = 28/79 (35.44%), Postives = 38/79 (48.10%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C +C ++FT       H+R HTG RP+ C  C   F   +   RH  +HK E+P+ C  C K +     L NH   H
Sbjct:  100 FKCEQCDREFTRLDSYKNHIRLHTGDRPYKCETCGKQFNYLTTYKRHLNIHKGEKPYACNLCDKKFTRQNYLKNHLNTH 178          

HSP 3 Score: 51.9878 bits (123), Expect = 1.099e-7
Identity = 31/96 (32.29%), Postives = 41/96 (42.71%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNE 1447
            RP+   C  C   F     L  H R HTG +PF C  C   F+      RH  +H   +PF CE+C + +    S  NH +LH  D     E   +
Sbjct:   42 RPYQ--CEVCGHGFANLGDLKRHSRTHTGEKPFKCEYCEKVFSDFGSHKRHIRLHTGYKPFKCEQCDREFTRLDSYKNHIRLHTGDRPYKCETCGK 135          

HSP 4 Score: 50.447 bits (119), Expect = 3.685e-7
Identity = 26/83 (31.33%), Postives = 40/83 (48.19%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDE 1420
            F C  C K F+       H+R HTG +PF C  C   FT+      H  +H  +RP+ CE C K + +  +   H  +H+ ++
Sbjct:   72 FKCEYCEKVFSDFGSHKRHIRLHTGYKPFKCEQCDREFTRLDSYKNHIRLHTGDRPYKCETCGKQFNYLTTYKRHLNIHKGEK 154          
BLAST of SMED30027645 vs. Ensembl Nematostella
Match: EDO29702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2W2])

HSP 1 Score: 71.633 bits (174), Expect = 1.007e-13
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPF-----------------SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P   +E  K   +S++ K    IHS  +P    D  G+ F                  + C EC K FT + RL  H+R H+G +P+ C+VC   F++   L RH  +H  ++P+ C+ C K +   G+L  H  +H
Sbjct:   63 PYKCDECGKCFNQSANLKTHLRIHSGQKPYKC-DECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIH 198          

HSP 2 Score: 65.855 bits (159), Expect = 7.961e-12
Identity = 29/79 (36.71%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            + C EC K FT +  LN H+R H+G +P+ C+ C   F Q + L  H  +H  ++P+ C++C K +  Y  L  H K+H
Sbjct:   36 YRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIH 114          

HSP 3 Score: 61.2326 bits (147), Expect = 3.010e-10
Identity = 34/120 (28.33%), Postives = 54/120 (45.00%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P   +E  K   +S +      IHS  +P            + C EC K F  ++ L  H+R H+G +P+ C+ C   F Q   L RH  +H  ++P+ C +C K +     L  H ++H
Sbjct:   35 PYRCDECGKGFTQSGALNRHLRIHSGQKP------------YKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLRIH 142          

HSP 4 Score: 60.4622 bits (145), Expect = 5.377e-10
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 2
Query: 1178 CPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            C EC   FT ++ L  H+  H+G +P+ C+ C   FTQ   L RH  +H  ++P+ C++C K +    +L  H ++H
Sbjct:   10 CGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLRIH 86          

HSP 5 Score: 59.6918 bits (143), Expect = 8.362e-10
Identity = 41/154 (26.62%), Postives = 65/154 (42.21%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH---------RKLHRKDEKNDSEMLNEVKIEQSVSYNGK 1483
            P    E  K    S   K    IHS  +P            + C  C K F+ +  L  H+  H+G +P+ C+VC   F++   L +H  +H  ++P+ C++C K +  Y +L  H         +K H+ DE             QSV Y+G+
Sbjct:  119 PYECGECGKCFTRSERLKTHLRIHSGQKP------------YKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLIHLMIHSGQKPHKCDECGKC-------FHQSVLYDGQ 253          

HSP 6 Score: 48.1358 bits (113), Expect = 6.507e-6
Identity = 18/53 (33.96%), Postives = 31/53 (58.49%), Query Frame = 2
Query: 1250 RPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +P  C  C   FT+ +YL RH  +H  ++P+ C++C K +   G+L  H ++H
Sbjct:    6 KPNECGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLRIH 58          
BLAST of SMED30027645 vs. Ensembl Nematostella
Match: EDO25873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDG9])

HSP 1 Score: 68.9366 bits (167), Expect = 1.012e-13
Identity = 42/112 (37.50%), Postives = 56/112 (50.00%), Query Frame = 2
Query: 1088 SSSGKVSSNIHS-SGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNV--CAFSFTQKSYLIRHAAVHKEERPFHC--EKCQKSYKHYGSLANHRKLH 1408
            ++ G ++S++ S SGE         RP       C K+FT  S+L  H+R HTG RPF+C+   C +SFT    L RH   H  ERPF C  E C K +     L  H  +H
Sbjct:   37 AAMGVLTSHLKSHSGE---------RPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKLFTRSSHLKTHVLVH 139          

HSP 2 Score: 52.7582 bits (125), Expect = 3.521e-8
Identity = 30/67 (44.78%), Postives = 36/67 (53.73%), Query Frame = 2
Query: 1160 RPFSFLCPE--CPKKFTLNSRLNAHMRCHTGMRPFTCNV--CAFSFTQKSYLIRHAAVHKEERPFHC 1348
            RPFS  C E  C   FT   +L  H R HTG RPF C+   C   FT+ S+L  H  VH  E+P+ C
Sbjct:   83 RPFS--CDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKLFTRSSHLKTHVLVHTGEKPYVC 147          

HSP 3 Score: 52.373 bits (124), Expect = 4.973e-8
Identity = 29/78 (37.18%), Postives = 37/78 (47.44%), Query Frame = 2
Query: 1187 CPKKFTLNSRLNAHMRCHTGMRPFTCNV--CAFSFTQKSYLIRHAAVHKEERPFHC--EKCQKSYKHYGSLANHRKLH 1408
            C K F     L +H++ H+G RP  C V  C   FT+ S L  H   H  ERPF C  E C  S+     L  H++ H
Sbjct:   32 CGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKH 109          
BLAST of SMED30027645 vs. Ensembl Nematostella
Match: EDO47692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH7])

HSP 1 Score: 68.1662 bits (165), Expect = 1.016e-13
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P      LK   ++++      IHS  +P            F C  C ++F+ +S +  HMR H G RP+ C VC  +F   S L +H   H  E+P+ CE C + +   G++  H+++H
Sbjct:   21 PYQCMVCLKSFTQAANLTAHFRIHSGEKP------------FRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIH 128          

HSP 2 Score: 65.4698 bits (158), Expect = 8.807e-13
Identity = 31/92 (33.70%), Postives = 48/92 (52.17%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNE 1447
            + C  C K FT  + L AH R H+G +PF C VC   F+Q S +  H   H  ERP+ C+ C K++    +L  H + H  ++    E+ ++
Sbjct:   22 YQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQ 113          

HSP 3 Score: 58.9214 bits (141), Expect = 2.007e-10
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 2
Query: 1211 SRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQS 1465
            S L  HMR H+G++P+ C VC  SFTQ + L  H  +H  E+PF C  C + +    S+  H + H  +     ++ N+   + S
Sbjct:    7 STLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSS 91          
BLAST of SMED30027645 vs. Ensembl Medaka
Match: ENSORLT00000034775.1 (pep primary_assembly:ASM223467v1:17:11375208:11461017:1 gene:ENSORLG00000025380.1 transcript:ENSORLT00000034775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.903e-17
Identity = 44/83 (53.01%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            RP+S  C  C K FT NS LN HMR HTG RPFTC VC  SFT+ S L  H   H  ERPF C  C K + H G L  H + H
Sbjct:  143 RPYS--CKVCEKSFTQNSSLNVHMRIHTGERPFTCEVCEKSFTKGSDLKTHMRTHTGERPFSCHICNKGFIHSGGLTLHMRTH 223          

HSP 2 Score: 78.1814 bits (191), Expect = 4.745e-15
Identity = 45/102 (44.12%), Postives = 55/102 (53.92%), Query Frame = 2
Query: 1112 NIHSSGEP---NTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            N+ S+ EP     L  N  +PFS  C  C K FT    +  HMR HTG RP++C VC  SFTQ S L  H  +H  ERPF CE C+KS+     L  H + H
Sbjct:   96 NMDSNPEPIENPVLEANSKKPFS--CKVCKKNFTQRKNVKLHMRTHTGERPYSCKVCEKSFTQNSSLNVHMRIHTGERPFTCEVCEKSFTKGSDLKTHMRTH 195          

HSP 3 Score: 74.7146 bits (182), Expect = 6.760e-14
Identity = 46/120 (38.33%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S     K   ++SS  V   IH+ GE         RPF+  C  C K FT  S L  HMR HTG RPF+C++C   F     L  H   H  ERPF C+ CQK +    +L  H + H
Sbjct:  144 PYSCKVCEKSFTQNSSLNVHMRIHT-GE---------RPFT--CEVCEKSFTKGSDLKTHMRTHTGERPFSCHICNKGFIHSGGLTLHMRTHTGERPFTCKLCQKGFMQSSALKAHMRTH 251          

HSP 4 Score: 67.0106 bits (162), Expect = 2.465e-11
Identity = 44/116 (37.93%), Postives = 53/116 (45.69%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNE-------VKIEQSVSYNGKP 1486
            RPFS  C  C K F  +  L  HMR HTG RPFTC +C   F Q S L  H   H  ER   C  C KS K   SL  H K+H  ++     M  +       +K+   +  N KP
Sbjct:  199 RPFS--CHICNKGFIHSGGLTLHMRTHTGERPFTCKLCQKGFMQSSALKAHMRTHTGERVCKCSICGKSLKDKYSLKVHNKIHTGEKAFSCHMCGKRFRYKHALKVHVRIHTNEKP 312          

HSP 5 Score: 55.0694 bits (131), Expect = 1.594e-7
Identity = 39/129 (30.23%), Postives = 56/129 (43.41%), Query Frame = 2
Query: 1115 IHSSGEPNTLFDNKG-RPFSFLCPECPKKFTLNSRLNAHMRCHTGMR----------------------------PFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            IHS G    +  + G RPF+  C  C K F  +S L AHMR HTG R                             F+C++C   F  K  L  H  +H  E+PF C  C ++++   +L +H K H++
Sbjct:  211 IHSGGLTLHMRTHTGERPFT--CKLCQKGFMQSSALKAHMRTHTGERVCKCSICGKSLKDKYSLKVHNKIHTGEKAFSCHMCGKRFRYKHALKVHVRIHTNEKPFSCRVCGETFRQSSNLISHLKRHQE 337          
BLAST of SMED30027645 vs. Ensembl Medaka
Match: ENSORLT00000029760.1 (pep primary_assembly:ASM223467v1:4:17568956:17596668:1 gene:ENSORLG00000023350.1 transcript:ENSORLT00000029760.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 4.248e-17
Identity = 45/120 (37.50%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S  E  + + ++S+      IH+  +P            F C EC + FT  S L  H R HTG +PF+C  C  SFT+KS L +H  VH  E+PF CE+C KS+    SL  H+++H
Sbjct:  145 PFSCEECGRRLTQNSTLTKHKQIHTGEKP------------FSCEECGRSFTDKSSLTKHKRVHTGEKPFSCEECGKSFTEKSSLTKHKRVHTGEKPFSCEECGKSFTEKSSLTKHKRVH 252          

HSP 2 Score: 84.7297 bits (208), Expect = 6.533e-17
Identity = 45/120 (37.50%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S  E  +   + SS      +H+  +P            F C EC K FT  S L  H R HTG +PF+C  C  SFT+KS L +H  VH  E+PF CE+C KS+    +L  H+++H
Sbjct:  173 PFSCEECGRSFTDKSSLTKHKRVHTGEKP------------FSCEECGKSFTEKSSLTKHKRVHTGEKPFSCEECGKSFTEKSSLTKHKRVHTGEKPFSCEECGKSFTEKSNLTKHKRVH 280          

HSP 3 Score: 84.7297 bits (208), Expect = 7.746e-17
Identity = 51/140 (36.43%), Postives = 68/140 (48.57%), Query Frame = 2
Query:  989 RKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            R  T+K+++   +       P S  E  K   E SS      +H+  +P            F C EC K FT  S L  H R HTG +PF+C  C  SFT+KS L +H  VH  E+PF CEKC KS+    +L  H ++H
Sbjct:  181 RSFTDKSSLTKHKRVHTGEKPFSCEECGKSFTEKSSLTKHKRVHTGEKP------------FSCEECGKSFTEKSSLTKHKRVHTGEKPFSCEECGKSFTEKSNLTKHKRVHTGEKPFSCEKCGKSFPLRQTLDVHIRIH 308          

HSP 4 Score: 81.2629 bits (199), Expect = 8.595e-16
Identity = 38/83 (45.78%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C +C K F L   L+ H+R HTG +PF C  C  SFT+KS L +H  VH  E+P+ CEKC K + H  S   H ++H
Sbjct:  340 KPFS--CEKCGKSFPLRQTLDVHIRIHTGEKPFLCEECGKSFTEKSNLTKHKRVHTGEKPYSCEKCGKCFAHRQSFEVHMRIH 420          

HSP 5 Score: 78.9518 bits (193), Expect = 5.445e-15
Identity = 45/120 (37.50%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S  E  K   E S+      +H+  +P            F C +C K F L   L+ H+R HTG +PF C  C  SFT+KS L +H  VH  E+PF CEKC KS+    +L  H ++H
Sbjct:  257 PFSCEECGKSFTEKSNLTKHKRVHTGEKP------------FSCEKCGKSFPLRQTLDVHIRIHTGEKPFLCAECGKSFTEKSNLTQHKRVHTGEKPFSCEKCGKSFPLRQTLDVHIRIH 364          

HSP 6 Score: 67.781 bits (164), Expect = 1.749e-11
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 2
Query: 1175 LCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
             C EC K FT    L  HM+ H   +PF+C  C    TQ S L +H  +H  E+PF CE+C +S+    SL  H+++H
Sbjct:  119 CCKECRKCFTNAKSLRHHMKIHKEEKPFSCEECGRRLTQNSTLTKHKQIHTGEKPFSCEECGRSFTDKSSLTKHKRVH 196          

HSP 7 Score: 55.4546 bits (132), Expect = 1.310e-7
Identity = 24/57 (42.11%), Postives = 30/57 (52.63%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPF 1342
            FLC EC K FT  S L  H R HTG +P++C  C   F  +     H  +H  E+PF
Sbjct:  370 FLCEECGKSFTEKSNLTKHKRVHTGEKPYSCEKCGKCFAHRQSFEVHMRIHTGEKPF 426          
BLAST of SMED30027645 vs. Ensembl Medaka
Match: ENSORLT00000017383.2 (pep primary_assembly:ASM223467v1:21:12958798:12962977:1 gene:ENSORLG00000013863.2 transcript:ENSORLT00000017383.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 7.916e-17
Identity = 40/83 (48.19%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C EC K FTL+  L  HMR HTG +PF C  C  SF + S L  H  +H  E+PF CE C +S+ H  SL NH ++H
Sbjct:  140 KPFS--CKECGKCFTLSCSLTDHMRIHTGEKPFPCKKCGRSFRRSSKLSVHMRIHTGEKPFTCEVCGRSFSHAKSLTNHMRIH 220          

HSP 2 Score: 80.8777 bits (198), Expect = 1.884e-16
Identity = 44/120 (36.67%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            P S  E  K    S S      IH+  +P            F C +C + F  +S+L+ HMR HTG +PFTC VC  SF+    L  H  +H  E+PF CE+C +S+    SL NH ++H
Sbjct:  141 PFSCKECGKCFTLSCSLTDHMRIHTGEKP------------FPCKKCGRSFRRSSKLSVHMRIHTGEKPFTCEVCGRSFSHAKSLTNHMRIHTGEKPFSCEECGRSFSQATSLTNHMRIH 248          

HSP 3 Score: 72.4034 bits (176), Expect = 1.350e-13
Identity = 35/84 (41.67%), Postives = 52/84 (61.90%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSR-LNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C EC + F+ + R L+ HMR HTG +PF+C  C  SF++   LI H  +H  E+PF C++C K +    SL +H ++H
Sbjct:   83 KPFS--CKECSRSFSRSDRKLSLHMRIHTGEKPFSCKECGRSFSRVDSLIGHMRIHTGEKPFSCKECGKCFTLSCSLTDHMRIH 164          

HSP 4 Score: 72.0182 bits (175), Expect = 1.721e-13
Identity = 34/81 (41.98%), Postives = 48/81 (59.26%), Query Frame = 2
Query: 1169 SFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSY-LIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            SF C EC K FT   +L  HMR HTG +PF+C  C+ SF++    L  H  +H  E+PF C++C +S+    SL  H ++H
Sbjct:   56 SFFCQECGKSFTRIGKLALHMRIHTGEKPFSCKECSRSFSRSDRKLSLHMRIHTGEKPFSCKECGRSFSRVDSLIGHMRIH 136          

HSP 5 Score: 70.8626 bits (172), Expect = 4.385e-13
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            +PFS  C EC + F+    L  HMR HTG +PF+C  C   FT    L  H  +H  E+PF C+KC +S++    L+ H ++H
Sbjct:  112 KPFS--CKECGRSFSRVDSLIGHMRIHTGEKPFSCKECGKCFTLSCSLTDHMRIHTGEKPFPCKKCGRSFRRSSKLSVHMRIH 192          

HSP 6 Score: 48.9062 bits (115), Expect = 9.277e-6
Identity = 29/98 (29.59%), Postives = 42/98 (42.86%), Query Frame = 2
Query: 1049 PTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPF 1342
            P    +  +    SS   V   IH+  +P            F C  C + F+    L  HMR HTG +PF+C  C  SF+Q + L  H  +H  E+ +
Sbjct:  169 PFPCKKCGRSFRRSSKLSVHMRIHTGEKP------------FTCEVCGRSFSHAKSLTNHMRIHTGEKPFSCEECGRSFSQATSLTNHMRIHTGEKIY 254          
BLAST of SMED30027645 vs. Ensembl Medaka
Match: zbtb14 (zinc finger and BTB domain-containing protein 14 [Source:NCBI gene;Acc:101156481])

HSP 1 Score: 84.3445 bits (207), Expect = 8.642e-17
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHR 1411
            RPF+  C  C K FT ++ L  H++ HTG +P+ C+VC  SF +   L +H  VH  ERPF C+ C+K++KH   L +H + HR
Sbjct:  284 RPFT--CEICTKAFTTHAHLKEHLKIHTGFKPYRCDVCGKSFIRAPDLKKHERVHSNERPFACQMCEKAFKHKSHLKDHERRHR 365          

HSP 2 Score: 58.9214 bits (141), Expect = 1.251e-8
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANH 1396
            + C  C K F     L  H R H+  RPF C +C  +F  KS+L  H   H+ E+PF C  C K++     L  H
Sbjct:  314 YRCDVCGKSFIRAPDLKKHERVHSNERPFACQMCEKAFKHKSHLKDHERRHRGEKPFVCPSCTKAFAKASDLKRH 388          
BLAST of SMED30027645 vs. Ensembl Medaka
Match: ENSORLT00000045995.1 (zinc finger protein OZF [Source:NCBI gene;Acc:101163503])

HSP 1 Score: 84.7297 bits (208), Expect = 8.773e-17
Identity = 43/107 (40.19%), Postives = 53/107 (49.53%), Query Frame = 2
Query: 1160 RPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNG 1480
            RP+   CP C K FT   RL  HMR HTG +PF C VC   F++   L  H  +H  E+PF C  C KSY   G+L  H  +HR +    S  L   + E   S  G
Sbjct:  206 RPYR--CPVCRKCFTWRGRLQKHMRTHTGEKPFKCTVCCKRFSESGNLKVHMRIHTGEKPFSCSFCGKSYAQRGNLKMHMAMHRGETTVSSSRLQHSQTESRTSLRG 310          

HSP 2 Score: 80.4925 bits (197), Expect = 2.135e-15
Identity = 49/139 (35.25%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 1031 ASP-LAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFS----------FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRK 1414
            ASP L H T    V      +++ K S   +S  E    F  KG+  S          F CP C K F+ N+ L  HM+ HTG +P+ C VC   F +   L  H  +H  E+PF+C +C K Y+  GSL  H  +HR+
Sbjct:  325 ASPGLQHVTGNGGVPANCWRATACKKS---YSCSECGKRFGFKGQLASHMRAHTGEKPFRCPVCWKCFSWNACLQKHMKIHTGEKPYRCTVCGKGFIESGNLKVHMRIHTGEKPFNCSECGKRYRQKGSLTKHMDVHRE 460          

HSP 3 Score: 58.9214 bits (141), Expect = 1.436e-8
Identity = 29/79 (36.71%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1172 FLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLH 1408
            F C EC K ++  S L  H + H   RP+ C VC   FT +  L +H   H  E+PF C  C K +   G+L  H ++H
Sbjct:  181 FRCSECGKTYSSQSYLKLHTQYH-AERPYRCPVCRKCFTWRGRLQKHMRTHTGEKPFKCTVCCKRFSESGNLKVHMRIH 258          
BLAST of SMED30027645 vs. Planmine SMEST
Match: SMESG000035995.1 (SMESG000035995.1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 507/507 (100.00%), Postives = 507/507 (100.00%), Query Frame = 2
Query:  347 MNDGSTYLTIQTQPNTGASELSGAKILNXXXXXXXXXXXXXXXXXXXXXXXXINVQPNSNTVXXXXXXXXXXXXXXMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWXXXXXXXXXXXXXXXXXXHQIQLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMXXXXXXXXXXXXXXTGSRMQHDMNESNTFSIXXXXXXXXXXXXXYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV 1867
            MNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSPSLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNFNSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNCNEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV
Sbjct: 1181 MNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSPSLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNFNSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNCNEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV 1687          
BLAST of SMED30027645 vs. Planmine SMEST
Match: SMESG000054738.1 (SMESG000054738.1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 507/507 (100.00%), Postives = 507/507 (100.00%), Query Frame = 2
Query:  347 MNDGSTYLTIQTQPNTGASELSGAKILNXXXXXXXXXXXXXXXXXXXXXXXXINVQPNSNTVXXXXXXXXXXXXXXMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWXXXXXXXXXXXXXXXXXXHQIQLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMXXXXXXXXXXXXXXTGSRMQHDMNESNTFSIXXXXXXXXXXXXXYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV 1867
            MNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSPSLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNFNSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNCNEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV
Sbjct:    1 MNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSPSLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNFNSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNCNEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV 507          
BLAST of SMED30027645 vs. Planmine SMEST
Match: SMESG000035995.1 (SMESG000035995.1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 507/507 (100.00%), Postives = 507/507 (100.00%), Query Frame = 2
Query:  347 MNDGSTYLTIQTQPNTGASELSGAKILNXXXXXXXXXXXXXXXXXXXXXXXXINVQPNSNTVXXXXXXXXXXXXXXMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWXXXXXXXXXXXXXXXXXXHQIQLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMXXXXXXXXXXXXXXTGSRMQHDMNESNTFSIXXXXXXXXXXXXXYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV 1867
            MNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSPSLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNFNSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNCNEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV
Sbjct:    1 MNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSPSLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQTSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNFNSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIASTIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTSTNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNCNEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYPITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNEVSSAHQIFPTSEKSRSPYLV 507          
BLAST of SMED30027645 vs. Planmine SMEST
Match: SMESG000030429.1 (SMESG000030429.1)

HSP 1 Score: 184.111 bits (466), Expect = 3.335e-49
Identity = 76/102 (74.51%), Postives = 88/102 (86.27%), Query Frame = 2
Query: 1142 LFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKDEKNDSEMLNE 1447
            L D+KGRPF + CP CPKKFTLNSRL AH+RCHTG+RP+TC  C FSFTQKSYLIRHAAVH EERPF CE+C K+YKHYGSLANHRKLHRK++KN +  ++E
Sbjct:  274 LLDHKGRPFIYNCPNCPKKFTLNSRLTAHLRCHTGIRPYTCVQCGFSFTQKSYLIRHAAVHTEERPFTCERCLKTYKHYGSLANHRKLHRKEDKNGTSDISE 375          
BLAST of SMED30027645 vs. Planmine SMEST
Match: SMESG000009964.1 (SMESG000009964.1)

HSP 1 Score: 172.555 bits (436), Expect = 9.392e-46
Identity = 69/99 (69.70%), Postives = 84/99 (84.85%), Query Frame = 2
Query: 1121 SSGEPNTLFDNKGRPFSFLCPECPKKFTLNSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKCQKSYKHYGSLANHRKLHRKD 1417
            ++G+   ++D+KGRPF + C +CPKKFT NSRL AH+RCH+G+RP+TC  C FSFTQKSYLIRHAAVHKE+RPF C KC K+YKHYGSLANHRKLH +D
Sbjct:  245 TNGDSEVMYDHKGRPFIYECNQCPKKFTQNSRLTAHLRCHSGIRPYTCTQCGFSFTQKSYLIRHAAVHKEDRPFICSKCLKTYKHYGSLANHRKLHCRD 343          
The following BLAST results are available for this feature:
BLAST of SMED30027645 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF5834.422e-1744.58zinc finger protein 583 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5834.422e-1744.58zinc finger protein 583 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2135.643e-1747.06zinc finger protein 213 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2131.050e-1647.06zinc finger protein 213 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2131.050e-1647.06zinc finger protein 213 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egrh-21.054e-1435.48EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-22.807e-1435.48EGR (Early Growth factor Response factor) Homolog ... [more]
che-13.558e-1440.24Transcription factor che-1 [Source:UniProtKB/Swis... [more]
ztf-235.499e-1430.30Zinc finger putative Transcription Factor family ... [more]
blmp-17.318e-1438.30B lymphocyte-induced maturation protein 1 homolog ... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erm3.790e-1531.47gene:FBgn0031375 transcript:FBtr0330202[more]
erm5.299e-1531.33gene:FBgn0031375 transcript:FBtr0330201[more]
erm6.063e-1531.47gene:FBgn0031375 transcript:FBtr0077870[more]
erm6.181e-1531.47gene:FBgn0031375 transcript:FBtr0330200[more]
gl1.217e-1436.79gene:FBgn0004618 transcript:FBtr0083584[more]
back to top
BLAST of SMED30027645 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf11144.142e-1838.33zinc finger protein 1114 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:dkey-262g12.104.572e-1845.36si:dkey-262g12.10 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
znf10995.408e-1839.17zinc finger protein 1099 [Source:ZFIN;Acc:ZDB-GENE... [more]
zgc:1736246.242e-1843.18zgc:173624 [Source:ZFIN;Acc:ZDB-GENE-071004-60][more]
znf10621.888e-1734.39zinc finger protein 1062 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shmt22.938e-1736.30serine hydroxymethyltransferase 2 (mitochondrial) ... [more]
ENSXETT00000017963.15.869e-1745.78zinc finger protein 239-like [Source:NCBI gene;Acc... [more]
ENSXETT00000054820.16.239e-1737.40pep primary_assembly:Xenopus_tropicalis_v9.1:9:296... [more]
ZBTB146.508e-1744.05zinc finger and BTB domain containing 14 [Source:N... [more]
ENSXETT00000023753.17.475e-1744.19oocyte zinc finger protein XlCOF7.1-like [Source:N... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp7682.655e-1748.19zinc finger protein 768 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7682.922e-1748.19zinc finger protein 768 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7723.566e-1746.15zinc finger protein 772 [Source:MGI Symbol;Acc:MGI... [more]
Zfp2136.466e-1747.06zinc finger protein 213 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6061.482e-1635.00zinc finger protein 606 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30027645 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R0T2|ZN768_MOUSE1.857e-1648.19Zinc finger protein 768 OS=Mus musculus OX=10090 G... [more]
sp|Q96ND8|ZN583_HUMAN2.124e-1644.58Zinc finger protein 583 OS=Homo sapiens OX=9606 GN... [more]
sp|O14771|ZN213_HUMAN5.044e-1647.06Zinc finger protein 213 OS=Homo sapiens OX=9606 GN... [more]
sp|Q92010|ZBT14_CHICK1.121e-1542.86Zinc finger and BTB domain-containing protein 14 O... [more]
sp|O43829|ZBT14_HUMAN1.222e-1542.86Zinc finger and BTB domain-containing protein 14 O... [more]
back to top
BLAST of SMED30027645 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448WLH61.254e-3350.78Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A183SCJ81.039e-3258.89Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7DML91.156e-3258.89Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A158R8W43.055e-3252.10Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A2H1C5U91.767e-3160.42Zinc finger, C2H2 type OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031300.13.098e-1944.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zbtb145.251e-1742.86zinc finger and BTB domain containing 14 [Source:N... [more]
si:ch211-155e24.36.943e-1743.90zinc finger protein 835-like [Source:NCBI gene;Acc... [more]
si:ch211-155e24.37.383e-1743.90zinc finger protein 835-like [Source:NCBI gene;Acc... [more]
GZF11.662e-1635.83GDNF inducible zinc finger protein 1 [Source:HGNC ... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009002.11.729e-1643.53pep scaffold:Pmarinus_7.0:GL487004:1276:1827:-1 ge... [more]
ENSPMAT00000006856.11.855e-1538.37pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1... [more]
GZF11.214e-1431.58GDNF inducible zinc finger protein 1 [Source:HGNC ... [more]
ENSPMAT00000001415.11.572e-1439.24pep scaffold:Pmarinus_7.0:GL483974:8149:10580:-1 g... [more]
ENSPMAT00000001747.11.667e-1437.65pep scaffold:Pmarinus_7.0:GL479152:3602:4030:-1 ge... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF12.631e-1437.97Zinc-finger transcription factor; involved in diau... [more]
CRZ11.394e-1032.93Transcription factor, activates transcription of s... [more]
PZF15.364e-937.93Transcription factor IIIA (TFIIIA); essential DNA ... [more]
MSN22.157e-841.07Stress-responsive transcriptional activator; activ... [more]
ZAP12.811e-832.22Zinc-regulated transcription factor; binds to zinc... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491121.036e-1533.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313013.460e-1441.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297021.007e-1329.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258731.012e-1337.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476921.016e-1329.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027645 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034775.11.903e-1753.01pep primary_assembly:ASM223467v1:17:11375208:11461... [more]
ENSORLT00000029760.14.248e-1737.50pep primary_assembly:ASM223467v1:4:17568956:175966... [more]
ENSORLT00000017383.27.916e-1748.19pep primary_assembly:ASM223467v1:21:12958798:12962... [more]
zbtb148.642e-1742.86zinc finger and BTB domain-containing protein 14 [... [more]
ENSORLT00000045995.18.773e-1740.19zinc finger protein OZF [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of SMED30027645 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035995.10.000e+0100.00SMESG000035995.1[more]
SMESG000054738.10.000e+0100.00SMESG000054738.1[more]
SMESG000035995.10.000e+0100.00SMESG000035995.1[more]
SMESG000030429.13.335e-4974.51SMESG000030429.1[more]
SMESG000009964.19.392e-4669.70SMESG000009964.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027645 ID=SMED30027645|Name=SMED30027645|organism=Schmidtea mediterranea sexual|type=transcript|length=2437bp
ATTATATTTCAAATATTTATTTCTCTTAATTATTTTTTAACATCTGTAAT
TTTTTTTATTTGATAAATTTCAAAGATTTCTTATTTGTTTTGATTCTCTA
TGTATAGACTCAAAATTTCAATAATTAAATTTAGAAAGACCAAATAAAAA
CATATTAATGTCGGATTATAATGCATATTCAGCTTTAATTCAGTCTTCAC
AATCTGATTTTGTGTCCACTGAAACATTGGATACAACAAATAATCAAATC
CAATCTAATAATACTAATAATATGTTATATAATACTGCTCCTGTTATATT
TTTAAATCCTCAAAAGTCAGACGTTGGGCTTCTACAGAATTCTGTAATGA
ATGATGGATCAACTTATCTGACCATTCAAACTCAACCAAATACCGGTGCC
TCTGAACTCAGTGGAGCAAAAATTTTGAATACTCCAATTATAATTCAAAG
TTCTCCTTCTCTACCAATTCAAACTTCTCAATATCAACAATCAACTTCTA
CTATAAATGTACAGCCGAACAGCAACACAGTAACCTCATTAACTCCAAGT
CAACTGCAGAGTCTATCGTATCTAATGCAAACCCAAATTACTCCCCAGTT
CATACAGACGTCTAATGGGCTGATTCAATTGATACCACATGGGTTAATAG
CAGCACAAACTTCTAACGCTCAAATACAGAACCATAACCAAGATCAACAA
TTACTATCTTCACAAATAGCAACGTTACCAACTCTCGGCTGGTCGCTTAA
TAACTTTAATTCATCAAATAATCAAATATCAATTGATAATCAGCTACACC
AAATTCAACTGAACAATTTGGGAATACCCCAATTAATTCCTTTGCAGCAA
ATTATTCAACCAAACAATGCATTTTTCAATCAAAATGATGATCAAAATCA
AATTGCATCGACTATTGTAGATCTTAATACAAATGGAAACTCAAAAAAAT
CCAATGAACTTCAAAATAAAAAAGGATCTCGAAGAAAGCGAAAACCAACG
AATAAAACCACAGTCGATTCTTCACAACTGGCAAGCCCTCTGGCTCACCC
AACCAGTACAAATGAAGTATTGAAAGAAGTTGCCGAAAGCAGTAGTGGAA
AAGTGTCGTCTAATATCCACAGTTCCGGTGAACCAAACACCTTATTCGAC
AATAAAGGCCGACCTTTTAGTTTTCTTTGTCCAGAGTGTCCGAAAAAATT
CACACTGAATTCACGTCTAAATGCACACATGAGATGTCACACAGGAATGC
GCCCATTTACGTGCAATGTTTGCGCATTTTCCTTTACTCAAAAAAGCTAT
TTGATCAGACATGCTGCTGTCCATAAAGAAGAACGTCCATTTCATTGTGA
AAAATGCCAAAAGAGTTATAAGCACTATGGATCATTGGCAAATCATAGGA
AATTACACAGAAAGGATGAGAAAAATGATTCAGAAATGTTAAATGAAGTA
AAAATTGAACAGTCTGTTTCCTATAACGGTAAACCTTCAATCGTAATGAG
TAACTGTAACGAATTTTCTAATAATAATCAAAATTTCGAAACCGGTAGCA
GAATGCAACACGATATGAATGAATCCAACACTTTCTCGATAACCTCATCA
GTGCATTCAACGACTGGAGGAAGTGGTGGATATATAAAAGATATAGAACT
CTATCCGATTACTATATCTCACATGAATGACGATGAAAATAAAACGGGAA
ATTTGTTTTTTCAAAGCCAACAGCATGATCTAAATTATAAAAACACCTTT
ACCAATAGTATGATTGATATGACGTCAAATAGTCTCCAGGATCAAACGCC
AAATGAAGTATCTTCTGCACATCAAATATTTCCGACAAGTGAAAAAAGTC
GCTCACCTTATCTTGTTTAAAATAATTATTCAGTTTAGGAATGGTGCTCC
TGTTATTATTTCTCATGTGCCTTTATTTTTTTAAACGTTTTGTTCACGTT
TTAGTTTCTATTATATTTTTTCATTGTTAATTTAATGCTCCATTGATCAT
AGAGTAAATTATTAAATTTATTGCATTGGAATAATTTTAAAAATTTGTTA
ACGCATTTTATAATTCATTGTGTATTGCTTATTTTTGTAATTTGACTGCT
AATAGTTCTCAACGTGCTGTATCATTTTTGTACAGTTAATATGATGCAAT
AACTTTTTCCATAATTTAAACTTAATTCTATATATTTCTAGATTTTCATA
ATTAAGATAGTTTTAATTTTTTAGTATATAATATTATGTATACTGGTAAA
TTTTTGCAGTATTATGCATGTGTACAACTGATTTGAGTGCCTCGTTTTAG
AAATGTAAATATGAATTTAAAGGTGCTTTTTGATTAATGCCTTACGGTCA
TGCTTTGTCATATTTTAATATTATTTAGCTGTTTATTGTACTTATAAAGC
GTGTTATATATAAATAAAATAATTGCTTCGAAAAAAA
back to top

protein sequence of SMED30027645-orf-1

>SMED30027645-orf-1 ID=SMED30027645-orf-1|Name=SMED30027645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=571bp
MSDYNAYSALIQSSQSDFVSTETLDTTNNQIQSNNTNNMLYNTAPVIFLN
PQKSDVGLLQNSVMNDGSTYLTIQTQPNTGASELSGAKILNTPIIIQSSP
SLPIQTSQYQQSTSTINVQPNSNTVTSLTPSQLQSLSYLMQTQITPQFIQ
TSNGLIQLIPHGLIAAQTSNAQIQNHNQDQQLLSSQIATLPTLGWSLNNF
NSSNNQISIDNQLHQIQLNNLGIPQLIPLQQIIQPNNAFFNQNDDQNQIA
STIVDLNTNGNSKKSNELQNKKGSRRKRKPTNKTTVDSSQLASPLAHPTS
TNEVLKEVAESSSGKVSSNIHSSGEPNTLFDNKGRPFSFLCPECPKKFTL
NSRLNAHMRCHTGMRPFTCNVCAFSFTQKSYLIRHAAVHKEERPFHCEKC
QKSYKHYGSLANHRKLHRKDEKNDSEMLNEVKIEQSVSYNGKPSIVMSNC
NEFSNNNQNFETGSRMQHDMNESNTFSITSSVHSTTGGSGGYIKDIELYP
ITISHMNDDENKTGNLFFQSQQHDLNYKNTFTNSMIDMTSNSLQDQTPNE
VSSAHQIFPTSEKSRSPYLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR000595cNMP-bd_dom
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 395..417
e-value: 0.088
score: 21.9
coord: 339..361
e-value: 0.012
score: 24.8
coord: 367..389
e-value: 0.0045
score: 26.2
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 367..389
e-value: 0.001
score: 19.4
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 369..389
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 397..417
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 341..361
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 367..394
score: 13.443
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 339..366
score: 14.752
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 395..422
score: 11.281
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 366..389
e-value: 1.8E-10
score: 42.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 338..365
e-value: 1.6E-10
score: 42.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 390..477
e-value: 1.3E-5
score: 27.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..328
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 256..328
NoneNo IPR availablePANTHERPTHR24409:SF331ZINC FINGER AND BTB DOMAIN-CONTAINING PROTEIN 17coord: 309..423
NoneNo IPR availablePANTHERPTHR24409FAMILY NOT NAMEDcoord: 306..421
NoneNo IPR availablePANTHERPTHR24409FAMILY NOT NAMEDcoord: 309..423
NoneNo IPR availablePANTHERPTHR24409:SF331ZINC FINGER AND BTB DOMAIN-CONTAINING PROTEIN 17coord: 306..421
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 339..389
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 375..419