cAMP-dependent protein kinase regulatory subunit

Overview
NamecAMP-dependent protein kinase regulatory subunit
Smed IDSMED30027644
Length (bp)1858
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase regulatory subunit (SMED30027644) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase regulatory subunit (SMED30027644) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase regulatory subunit (SMED30027644) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase regulatory subunit (SMED30027644) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027644

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30027644SMESG000003135.1 SmedASXL_013305SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027644SMESG000003135.1 dd_Smed_v4_14355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027644SMESG000003135.1 dd_Smed_v4_14355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027644SMESG000003135.1 dd_Smed_v4_14355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027644SMESG000003135.1 dd_Smed_v4_14355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027644SMESG000003135.1 dd_Smed_v4_14355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027644SMESG000003135.1 dd_Smed_v6_14355_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 57.7658 bits (138), Expect = 4.640e-8
Identity = 55/194 (28.35%), Postives = 87/194 (44.85%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVAPVLEEEFKMKLE 619
            A + AI+ +    ++ E    I+ + ++ R E        +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV     EE +  LE
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE----QYRNFLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTF--EELQKYLE 402          

HSP 2 Score: 53.1434 bits (126), Expect = 1.418e-6
Identity = 43/210 (20.48%), Postives = 88/210 (41.90%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   + +     +I +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +    +   +    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 57.7658 bits (138), Expect = 4.640e-8
Identity = 55/194 (28.35%), Postives = 87/194 (44.85%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVAPVLEEEFKMKLE 619
            A + AI+ +    ++ E    I+ + ++ R E        +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV     EE +  LE
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE----QYRNFLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTF--EELQKYLE 402          

HSP 2 Score: 53.1434 bits (126), Expect = 1.418e-6
Identity = 43/210 (20.48%), Postives = 88/210 (41.90%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   + +     +I +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +    +   +    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 57.7658 bits (138), Expect = 4.847e-8
Identity = 55/194 (28.35%), Postives = 87/194 (44.85%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVAPVLEEEFKMKLE 619
            A + AI+ +    ++ E    I+ + ++ R E        +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV     EE +  LE
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE----QYRNFLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTF--EELQKYLE 402          

HSP 2 Score: 53.1434 bits (126), Expect = 1.434e-6
Identity = 43/210 (20.48%), Postives = 88/210 (41.90%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   + +     +I +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +    +   +    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 51.9878 bits (123), Expect = 3.109e-6
Identity = 38/190 (20.00%), Postives = 78/190 (41.05%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +++C    ++  +  +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F    +    +L   +E    E    I++QG R    + +  G + ++ E
Sbjct:  130 IVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTRE 286          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 51.2174 bits (121), Expect = 4.819e-6
Identity = 41/206 (19.90%), Postives = 84/206 (40.78%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            L +D ++ L       +++C    ++  +  +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F    +    +L   +E    E    I++QG R    + +  G + ++ E
Sbjct:   99 LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTRE 271          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 61.2326 bits (147), Expect = 1.795e-9
Identity = 45/205 (21.95%), Postives = 89/205 (43.41%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS F   S+    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  197 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVT 367          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 61.2326 bits (147), Expect = 1.795e-9
Identity = 45/205 (21.95%), Postives = 89/205 (43.41%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS F   S+    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  197 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVT 367          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 60.8474 bits (146), Expect = 2.043e-9
Identity = 45/205 (21.95%), Postives = 89/205 (43.41%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS F   S+    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  154 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVT 324          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 60.8474 bits (146), Expect = 2.043e-9
Identity = 45/205 (21.95%), Postives = 89/205 (43.41%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS F   S+    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  154 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVT 324          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 60.8474 bits (146), Expect = 2.076e-9
Identity = 45/205 (21.95%), Postives = 89/205 (43.41%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS F   S+    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  166 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVT 336          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 63.5438 bits (153), Expect = 3.524e-10
Identity = 43/211 (20.38%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQ 796
            L +D ++ L       +++C    K+P+  ++I EG++G  +Y++  GR+ V R                                  G+ L+TL    + GE+A++  C RTA++    EC +  I R+ +   +     + + E+    +F++SV  F   ++    ++   +E    +    I++QG R    + +  G++R++ + Q
Sbjct:  170 LDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSRE---------------------------------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYS---DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 344          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473363)

HSP 1 Score: 63.5438 bits (153), Expect = 3.767e-10
Identity = 40/195 (20.51%), Postives = 86/195 (44.10%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQ 796
            +++C    K+P+  ++I EG++G  +Y++  GR+ V R                                  G+ L+TL    + GE+A++  C RTA++    EC +  I R+ +   +     + + E+    +F++SV  F   ++    ++   +E    +    I++QG R    + +  G++R++ + Q
Sbjct:   12 IVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSRE---------------------------------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYS---DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 170          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473364)

HSP 1 Score: 63.5438 bits (153), Expect = 3.767e-10
Identity = 40/195 (20.51%), Postives = 86/195 (44.10%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQ 796
            +++C    K+P+  ++I EG++G  +Y++  GR+ V R                                  G+ L+TL    + GE+A++  C RTA++    EC +  I R+ +   +     + + E+    +F++SV  F   ++    ++   +E    +    I++QG R    + +  G++R++ + Q
Sbjct:   12 IVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSRE---------------------------------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYS---DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 170          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 63.5438 bits (153), Expect = 5.023e-10
Identity = 43/211 (20.38%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQ 796
            L +D ++ L       +++C    K+P+  ++I EG++G  +Y++  GR+ V R                                  G+ L+TL    + GE+A++  C RTA++    EC +  I R+ +   +     + + E+    +F++SV  F   ++    ++   +E    +    I++QG R    + +  G++R++ + Q
Sbjct:  516 LDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSRE---------------------------------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYS---DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 690          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089312)

HSP 1 Score: 63.5438 bits (153), Expect = 5.023e-10
Identity = 43/211 (20.38%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQ 796
            L +D ++ L       +++C    K+P+  ++I EG++G  +Y++  GR+ V R                                  G+ L+TL    + GE+A++  C RTA++    EC +  I R+ +   +     + + E+    +F++SV  F   ++    ++   +E    +    I++QG R    + +  G++R++ + Q
Sbjct:  516 LDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSRE---------------------------------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYS---DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 690          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 62.3882 bits (150), Expect = 1.120e-9
Identity = 46/210 (21.90%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G+L V++ N                                 + L ++     FGE+A++  C RTASV      +   + RE+++N +    E   +    F+ SVS  A        +++  +E         I+++GE  +  Y + +G+I+++   Q H
Sbjct:  167 KNQYLRRLEVQQVKDMV-ECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHN---------------------------------KLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDH 342          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 62.003 bits (149), Expect = 1.510e-9
Identity = 46/210 (21.90%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G+L V++ N                                 + L ++     FGE+A++  C RTASV      +   + RE+++N +    E   +    F+ SVS  A        +++  +E         I+++GE  +  Y + +G+I+++   Q H
Sbjct:  172 KNQYLRRLEVQQVKDMV-ECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHN---------------------------------KLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDH 347          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 62.003 bits (149), Expect = 1.585e-9
Identity = 46/210 (21.90%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G+L V++ N                                 + L ++     FGE+A++  C RTASV      +   + RE+++N +    E   +    F+ SVS  A        +++  +E         I+++GE  +  Y + +G+I+++   Q H
Sbjct:  167 KNQYLRRLEVQQVKDMV-ECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHN---------------------------------KLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDH 342          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 59.6918 bits (143), Expect = 7.808e-9
Identity = 46/210 (21.90%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G+L V++ N                                 + L ++     FGE+A++  C RTASV      +   + RE+++N +    E   +    F+ SVS  A        +++  +E +  +    I+++GE  +  Y + +G+I+++   Q H
Sbjct:  172 KNQYLRRLEVQQVKDMV-ECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHN---------------------------------KLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEEYYNK-GDYIIREGEEGNTFYIIANGKIKVTQSTQDH 346          

HSP 2 Score: 51.6026 bits (122), Expect = 2.738e-6
Identity = 59/224 (26.34%), Postives = 99/224 (44.20%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEE-CEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYP 712
            A + A S +    ++ E    I+   ++ R E + R+   +LR  V     L  D L T +++C  E +     +I EGE G+  YI+ +G++ V +  +       ++EP                     Q + TL  G  FGE ALI   +R+A+++  E+  E +VI RE ++ TV     +E K  L+     S+    ++  KK+   A  S SC  P
Sbjct:  251 ASVKAASNVKTWALDREVFHNIMRMTAEARHE-QYRN---FLRS-VSLLASLPGDKL-TKIVDCLEEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQD------HEEP---------------------QIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTF--DELKKYLQ-----SYVDSLARDDKKR--NAKRSGSCTPP 432          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 51.9878 bits (123), Expect = 2.059e-6
Identity = 38/190 (20.00%), Postives = 77/190 (40.53%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +++C     +  N  +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +E ++SV  F    +    +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:  111 IVDCMYPVDYDKNSCIIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GLKLCTMGPGKVFGELAILYNCTRTATVRTVSSVKLWAIDRQCFQTIMMRTGLIKHAEYMELLKSVLTFRGLPEEILSKLADVLEETHYEDGNYIIRQGARGDTFFIISKGKVTMTRE 267          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 63.1586 bits (152), Expect = 5.274e-10
Identity = 54/227 (23.79%), Postives = 97/227 (42.73%), Query Frame = 2
Query:   92 ETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPR-ELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSG 769
            E   E+  +  + R E +IR +   +   +  F++ S  +   L       ++   +V++ +G  GD  Y + SG + V        +DV  D    L  P    EP++            L  G  FGEVAL++   R A+VV  EE E +V+ R E + N +   L++E K + +   S+  F+  S +  + L    ++  C +   ++K       + F+  G
Sbjct:    7 EKAIEVALRRPEQRSEQDIRFIRSMMM-GILSFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSGVIAV-------TQDV--DGSSALLDP----EPIL------------LHKGASFGEVALLKDLRRNATVVCMEETEFLVVDRMEFFENKLDQELQKELKYRFQHFRSLDLFSSWSDKSLETLADHCKAEECHHSQVMVKDTHETKNIIFVTKG 207          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 53.5286 bits (127), Expect = 8.595e-7
Identity = 40/190 (21.05%), Postives = 80/190 (42.11%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +++C    ++  +  +I EG++G  +Y++  G++ V       KE V                            L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F    +    +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:  129 IVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVT------KESVK---------------------------LCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTRE 285          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 53.5286 bits (127), Expect = 8.595e-7
Identity = 40/190 (21.05%), Postives = 80/190 (42.11%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +++C    ++  +  +I EG++G  +Y++  G++ V       KE V                            L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F    +    +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:  129 IVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVT------KESVK---------------------------LCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTRE 285          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 53.5286 bits (127), Expect = 1.049e-6
Identity = 43/206 (20.87%), Postives = 86/206 (41.75%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            L +D ++ L       +++C    ++  +  +I EG++G  +Y++  G++ V       KE V                            L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F    +    +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:  101 LDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVT------KESVK---------------------------LCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTRE 273          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 58.5362 bits (140), Expect = 1.902e-8
Identity = 53/182 (29.12%), Postives = 85/182 (46.70%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVA 583
            A + AI+ +    ++ E    I+ + ++ R E E R+   +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV 
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE-EYRN---FLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVG 392          

HSP 2 Score: 53.9138 bits (128), Expect = 5.259e-7
Identity = 47/213 (22.07%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   + +     VI +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +   A   +EE++    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYR---NFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 58.5362 bits (140), Expect = 1.934e-8
Identity = 53/182 (29.12%), Postives = 85/182 (46.70%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVA 583
            A + AI+ +    ++ E    I+ + ++ R E E R+   +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV 
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE-EYRN---FLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVG 392          

HSP 2 Score: 53.9138 bits (128), Expect = 5.291e-7
Identity = 47/213 (22.07%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   + +     VI +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +   A   +EE++    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYR---NFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 52.373 bits (124), Expect = 1.767e-6
Identity = 38/190 (20.00%), Postives = 78/190 (41.05%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +++C    ++  +  +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F         +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:  130 IVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTRE 286          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 51.6026 bits (122), Expect = 2.578e-6
Identity = 41/206 (19.90%), Postives = 84/206 (40.78%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            L +D ++ L       +++C    ++  +  +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F         +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:   99 LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTRE 271          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt/SwissProt
Match: sp|Q03043|KGP24_DROME (cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster OX=7227 GN=for PE=1 SV=3)

HSP 1 Score: 63.5438 bits (153), Expect = 5.036e-9
Identity = 43/211 (20.38%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQ 796
            L +D ++ L       +++C    K+P+  ++I EG++G  +Y++  GR+ V R                                  G+ L+TL    + GE+A++  C RTA++    EC +  I R+ +   +     + + E+    +F++SV  F   ++    ++   +E    +    I++QG R    + +  G++R++ + Q
Sbjct:  516 LDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSRE---------------------------------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYS---DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 690          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt/SwissProt
Match: sp|A8X6H1|EGL4_CAEBR (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae OX=6238 GN=egl-4 PE=3 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 6.268e-9
Identity = 45/205 (21.95%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS FA  ++    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  166 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GATLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQIINFLSKVSIFANLTEDRISKIADVMDQDYYDGGHYILRQGEKGDAFFVINSGQVKVT 336          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt/SwissProt
Match: sp|O76360|EGL4_CAEEL (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 2.284e-8
Identity = 45/205 (21.95%), Postives = 89/205 (43.41%), Query Frame = 2
Query:  173 EKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +K  + K+L+ + +  LV  C  E +  + + VI EGE GD ++++  G L V R                                  G  L  + +G + GE+A++  C RTASV    + ++ V+ R ++      +  E     + F+  VS F   S+    ++   ++    +    I++QGE+  A + + SG+++++
Sbjct:  197 QKNDFLKQLAKEQIIELV-NCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSRE---------------------------------GALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVT 367          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt/SwissProt
Match: sp|Q64595|KGP2_RAT (cGMP-dependent protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Prkg2 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.139e-7
Identity = 53/182 (29.12%), Postives = 85/182 (46.70%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVA 583
            A + AI+ +    ++ E    I+ + ++ R E E R+   +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV 
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE-EYRN---FLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVG 392          

HSP 2 Score: 52.7582 bits (125), Expect = 8.156e-6
Identity = 45/213 (21.13%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   + +     ++ +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +   A   +EE++    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGRNYQQGSYIVKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYR---NFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt/SwissProt
Match: sp|Q61410|KGP2_MOUSE (cGMP-dependent protein kinase 2 OS=Mus musculus OX=10090 GN=Prkg2 PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.377e-7
Identity = 53/182 (29.12%), Postives = 85/182 (46.70%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIEC-TVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTE-ECEMVVIPRELYNNTVA 583
            A + AI+ +    ++ E    I+ + ++ R E E R+   +LR  V   K L +D L T +I+C  VE +     +I EGE G   +IL  G++ V +  E       +D+P                     Q + TL+ G  FGE ALI   +R+A+++  E +   +VI RE +N TV 
Sbjct:  244 ASVKAITNVKTWALDREVFQNIMRRTAQARDE-EYRN---FLRS-VSLLKNLPEDKL-TKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTE------GHDQP---------------------QLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVG 392          

HSP 2 Score: 56.6102 bits (135), Expect = 5.355e-7
Identity = 49/213 (23.00%), Postives = 93/213 (43.66%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTV-EKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTV---APVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K ++ K+L    ++ +V EC   EK  +   VI +GE G+ +++L  GRL V                        + E L          L+++     FGE+A++  C RTASV      +   + RE++ N +   A   +EE++    F+ SVS      +    +++  +E    +    I+++GE  S  + L  G+++++   + H
Sbjct:  165 KNQFLKRLDPQQIKDMV-ECMYGEKLSTGSYVIKQGEPGNHIFVLAEGRLEV-----------------------FQGEKL----------LSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYR---NFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGH 340          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: A0A1S3JNU3 (uncharacterized protein LOC106174696 OS=Lingula unguis OX=7574 GN=LOC106174696 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 3.238e-64
Identity = 149/470 (31.70%), Postives = 253/470 (53.83%), Query Frame = 2
Query:   98 LAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALI-EKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHF----------QKTYNSWNQESYG-----KMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLGNV----LPLLGLIKDRTLYCMKNLKGYKGPLTLEQLLKRNQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLRE--QNKKYNRNKLFHQESFKPL 1441
            + E++SKP+ +R +FEI  +  W ++K + FK L  DIL  ++  C+  K   N+++I +G+ G+C +ILLSGR+ ++     +  D + +E  E        E ++ D   LG  + TL  G  FGEVAL+ E C+RTAS++  + C+M+VI R+LY  +V  VL +EF+ K +F+ +  FF     ++KKQL MA+E H+  Y + + KQG+ V+A+YF++ GE++LS +PQ H+  F          +K  ++   ++ G     K+++ +L ++   +KK+    K  D+C L       G    IGD+E+LL     + TA  T    +L L  RH++R+ +KR P +I  M +    RI+  C R+ +V    +P +  +  ++      ++  +   TL ++    +D+     PP  G LID + PGTVF  I+ + + R+  Q +  +R  L H  S   L
Sbjct:   10 VVEVISKPTSERKDFEIAPLLPWFKKKSELFKDLKSDILHDVIKHCSFVKNRQNQLIIRQGDKGECFFILLSGRVSIYIFYAKNM-DSSENESTEHESDVTDDEYIVRDRRKLGTYVTTLNPGATFGEVALVSEDCVRTASIICDDPCDMIVIDRDLYTRSVKSVLAQEFEDKAKFVSTNQFFGGWPPKYKKQLAMALEKHTLTYDSVLAKQGQPVNALYFILRGEVKLSMDPQLHSSMFPSSPTKVRAERKKEDANGTQTKGAPISRKLSRAVLQKKANPHKKKVEPRKLIDVCCL-------GPNECIGDIEVLLEYETFLQTAKCTQKTEILTLDMRHWDRLFVKRQPKTIEKMRQGLELRIQ--C-RITDVVEKHIPFMKQLLSKSKQYNIIIENTENSKTLSKMNPTKKDDAVDIVPP-WGPLIDQYAPGTVFHRIRAREHRRKLRQLRDEHRKSLEHPTSADEL 467          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: A0A210QU71 (cAMP-dependent protein kinase regulatory subunit OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04116 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 3.145e-59
Identity = 149/459 (32.46%), Postives = 248/459 (54.03%), Query Frame = 2
Query:   74 MTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALI-EKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKTYNSWNQES------YGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLGNV--LPLLGLIKDRTLYCMKNLKGYKGPLTLEQLLKR---NQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNK-KYNRNK 1411
            M +   E +  ++SK  + R +FEI+ +  WLR+K + F +L  D L+ +V  C +  +   +++I +GE GDC YI+L G++ +  LN+    D  +   +E+     R      D S LG  +  L SG  FGEVAL+ + C+RTAS+++ E+ +++V+ R LYN  V  VL +EF+ K+EFI++   FA  + R++KQL MA+   +  Y + +++QG  V+ +YF++SG++ +  +P HH   + + +     ES      + ++     +Q     KK+ S  K   +C+L       G   SIG+VE+LL++P    TA  T    VLVL  +H+ER+ ++R+P +I  M  +   ++E     L N   LP L L+KDR       +  Y  P       K+   +     + F  +KG LIDI+GPG+VF+ I+    +RE++K KY  +K
Sbjct:    1 MGSTQYEKVVAVISKRPELRQDFEIQGLLLWLRKKSQLFSQLKTDYLKDIVRNCGMVSYDKEEMIIKQGERGDCFYIILDGKISIFILNKDKDADDDDRAMEEIGS---RTPEGKLDKSKLGNFVTHLGSGVPFGEVALMSDDCIRTASIISEEKTDLLVVDRALYNRAVKIVLAKEFEEKVEFIKTNPLFANWAPRYRKQLTMAMYKETLPYDSVLVRQGGPVTNIYFVISGQVEIQIDPSHHQVQYPRIFMEAQDESDRLIRKHERIRPPTEAQYSTFVKKKDST-KYSKLCIL-------GINESIGEVEVLLDLPTYTQTAVCTEKTDVLVLERKHYERLFVRRHPRTIEAMRGMFKVKLETRMNLLTNKEELPFLNLLKDR-------IDSYNNPKPSADKKKKELTSASAAEKEFLNHKGPLIDIYGPGSVFYMIR----VREKHKQKYKAHK 437          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: K1Q5I1 (cAMP-dependent protein kinase regulatory subunit OS=Crassostrea gigas OX=29159 GN=CGI_10006713 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.694e-50
Identity = 134/445 (30.11%), Postives = 236/445 (53.03%), Query Frame = 2
Query:   92 ETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALI-EKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKTYNSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDN--------GNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLGNV--LPLLGLIKDRTLYCMKNLKGYKGPLTLEQLLKRNQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNK 1393
            E +  ++SKP   R +FEI+++  WLR++ + F +L  + L+ ++  C    +  + ++I +G+ GDC Y++L G++ ++ LN+  +E    DE   L       E    D S LG  +  L +G  FG+VAL+ E C+RTA+++  E  +++V+ R LYN  V  VL +E++ K+ FI +   F+  + R+KKQL MA+      Y T ++KQG+ V  +YFL+ G + L  +P  H   + K Y     E      ++LL    +R+K +      ++     +K +++        G   S+G++E+LL M   + TA  T    VLVL  +H+ER+ +KR+  +I  M ++   ++E     L N   +P L  +K + L  M N +    P+  ++    ++    + F  +KG LID++GPG+VF+ I+    +RE+ K
Sbjct:    6 EKVLNVISKPPAFRQDFEIQTLMPWLRKQSQLFSQLRTEYLKDIIRNCGQVTFNKDDIIIKQGDQGDCFYMILGGKISIYVLNKKSEE---GDETVPLEQIGTLNEKGQLDRSKLGIFVTHLGTGVPFGDVALMSEDCVRTATIIAEEVTDLLVVDRALYNRAVKEVLAKEYEDKVAFINNNPLFSAWTPRYKKQLTMAMYKEEFTYNTTLVKQGDPVEVIYFLIRGHVELRTDPAMHPVQYPKIYLDTMNEG-----ERLL----RRDKVRPPTEPHYNNSTQLRKKENHKHVKMFLLGRNESVGELEILLGMDTYMQTAVCTEKVDVLVLEMKHYERLFVKRHQRTIEDMRKILEVKLETRMDLLANKSEIPFLPRVKTK-LNMMNNPQ----PVAKKEKELPSKKMAEREFLNHKGPLIDMYGPGSVFYMIR----VREKTK 429          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: V4BGQ9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_227784 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 6.817e-44
Identity = 130/518 (25.10%), Postives = 251/518 (48.46%), Query Frame = 2
Query:   41 LAFLCAI-STISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKI--RAEPLIE--DTSILGQCLATLESGHIFGEVALIEK-CMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHA----HHF-----------------------QKTYNSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLG-NVLPLLGLIKDRTLYCMKNLKGY----KGPLTLEQL---LKRNQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNKKYNRNKLFHQESFKPLQKSFYRSVGR 1471
            +  +C + ST        +T+  ++++P++ R + EI  +  W R+K   FK L  ++L+ ++  C       + V+I +GE GDC +I+L+G + +H       E+  N   ++L    +  R  P +   D S  G  L  +E+G  FGE+ALI   C+R AS+++TE  +++++ ++LYN ++     + F+ K +F+ S+  F     R+K  + M+++    ++   ++KQG  V  + F+VSG++++  +P  H     HHF                       +K      +E+Y K ++ +   + Q N       K  ++CL+       G    IGD+E++L +     T   T    + VL   +++R+L KR+P S+ +M ++ + ++     RL    LPL        LY +   +      K P+  ++    ++ + D I       KG LI+++GPG+VF+ I+ + N R +++K  R+K   +  F  +Q++  ++ GR
Sbjct:    8 IVLVCGVRSTWGAMAHLYDTVISLITQPAEKRSDAEIEQILPWFRKKSDMFKHLHSEVLKDIIKNCEFTSCQRDSVIIRQGEKGDCFFIILTGTVSIHINTSLTDEEFANTRKRQLDEEALVLREGPDLHPLDRSKYGNYLGKIEAGKSFGELALISNDCVRNASIISTEVTDLLIVRKDLYNRSLRFHQAQAFEEKQKFVNSLPLFHSWQSRYKNMMAMSLKKEILKFEDVVVKQGAPVDGLIFIVSGQVKVVMDPSQHKTQYPHHFPKGAIADLEKEKARDLLRKEMNLEKKRGFDRKETYQKRSEVVHETKKQAN-------KHLELCLM-------GAVDIIGDLEMVLGLQTYAETIICTEEARLFVLDQNNYDRLLEKRHPQSLNIMKDIVHNKLTLHFSRLSEQTLPLFRFF----LYTLDEKEKKEKLRKAPIVQQERPPQIELSPDGI------QKGPLINMYGPGSVFYLIRMRENKR-RHRKIERSKYTDKLDFNKVQEN-QKASGR 499          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: A0A094ZI31 (Uncharacterized protein OS=Schistosoma haematobium OX=6185 GN=MS3_00666 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.241e-42
Identity = 124/414 (29.95%), Postives = 197/414 (47.58%), Query Frame = 2
Query:   89 TETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKEL--------FPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTT------------------------------EECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKTYNSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPS---IGDVELLLNMPYSIFTATA-TSHCVVLVLHARHFERIL----LKRNPASILVMLELSYQRIEHWCG-RLGNVLPLL 1186
            +  L E+L KP+  R   EIR +  W +E +   K +S +IL  LV EC  E K+P + ++I EG+IGDCMYILLSGR+ VH     D+  V N+E  EL         P K     +I     LG  +  LE+G +FGEVALIE C+RTAS++                                +   +V I R LYNNTV   +E EF  +++F++++ +F   S + +KQ+ M++E    EY   ++KQG   + +YF+  GE+R++                     + K +Q   + R+     ++ +P      L+   N +   K     IGD+E LL  P  +FT  + TS+ ++  ++ ++ ER      +K N   +L M+ L+  +   +   RL N +  L
Sbjct:    6 SNNLVEVLIKPNNMRTAIEIRHIALWFKENILALKDVSIEILMKLVAECKAEFKYPHD-IIIREGDIGDCMYILLSGRVSVHY--RGDQSAVKNEEMHELMNVKSNSFIPVKQNVSDIINQE--LGPQVGQLEAGSVFGEVALIEDCLRTASILALPNTIEVNRHESSLNQQQQSSSSSLTKQSEKQSVCLVNISRTLYNNTVRVAMENEFHERMKFVKNIIYFQHLSDKIQKQIAMSLEKQKYEYNQVVLKQGSSFNGLYFVYRGELRVTL--------------------HVKQSQTSTTYRNNYRSIKYDLP------LITGSNPNTPEKTGSLCIGDIEFLLKYPNYLFTIISNTSYTILYYMNIKNAERYFYGLHIKFNYYELL-MIHLTMNKFSQFIQLRLQNFIDFL 387          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 62.3882 bits (150), Expect = 1.095e-9
Identity = 43/210 (20.48%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G + V++ N                                 + L ++     FGE+A++  C RTASV         V+ RE+++N +    E   +    F+ SVS  A   +    +++  +E    +    ++++GE  +  Y +  G+++++   + H
Sbjct:  172 KNRYLRRLEGQQIKDMV-ECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNN---------------------------------KLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDH 347          

HSP 2 Score: 51.6026 bits (122), Expect = 2.505e-6
Identity = 55/200 (27.50%), Postives = 89/200 (44.50%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEE-CEMVVIPRELYNNTVAPVLEEEFKMKLE-FIESVS 637
            A + A S +    ++ E    I+   ++ R E + RS   +LR  V     L +D L  +V    VE +     VI EGE G+  YI+  G++ V +                    K   EP         Q + TL+ G  FGE ALI   +R+A+++  E+  E +VI RE +  TV     +E K  L+ ++E+++
Sbjct:  251 ASVKAASGVRTWVLDREVFHNIMRMTAEARHE-QHRS---FLRS-VSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQ------------------STKDHEEP---------QVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTF--DELKKYLQGYVETLA 416          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 62.003 bits (149), Expect = 1.494e-9
Identity = 43/210 (20.48%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHH 802
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G + V++ N                                 + L ++     FGE+A++  C RTASV         V+ RE+++N +    E   +    F+ SVS  A   +    +++  +E    +    ++++GE  +  Y +  G+++++   + H
Sbjct:  172 KNRYLRRLEGQQIKDMV-ECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNN---------------------------------KLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDH 347          

HSP 2 Score: 52.373 bits (124), Expect = 1.185e-6
Identity = 59/217 (27.19%), Postives = 97/217 (44.70%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEE-CEMVVIPRELYNNTVAPVLEEEFKMKLE-FIESVSFFACCSQRHKKQLLMAI 688
            A + A S +    ++ E    I+   ++ R E + RS   +LR  V     L +D L  +V    VE +     VI EGE G+  YI+  G++ V +                    K   EP         Q + TL+ G  FGE ALI   +R+A+++  E+  E +VI RE +  TV     +E K  L+ ++E+++      +R+ K  L+A+
Sbjct:  251 ASVKAASGVRTWVLDREVFHNIMRMTAEARHE-QHRS---FLRS-VSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQ------------------STKDHEEP---------QVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTF--DELKKYLQGYVETLA--RDDKKRNAKWFLIAV 431          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 57.7658 bits (138), Expect = 2.645e-8
Identity = 43/204 (21.08%), Postives = 90/204 (44.12%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            +++D L+ L       +++C  EK + +N++VI EGE G+ +Y+L  G L V                             I++  +LGQ    +  G  FGE+A++  C RTA+V    +  +  + R+ + + +    +   +    F+ SVS      +    +++  +E    +    I+++GE  +  + +  GE+ ++
Sbjct:  173 MNNDFLKKLEPQHTREMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEGLLEV-----------------------------IQNGKLLGQ----MRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVT 343          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 51.9878 bits (123), Expect = 1.861e-6
Identity = 36/175 (20.57%), Postives = 73/175 (41.71%), Query Frame = 2
Query:  266 VIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F   ++    +L   +E    +    I++QG R    + +  G++ ++ E
Sbjct:  119 IIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLAEEILSKLADVLEETHYDDGEYIIRQGARGDTFFIISKGKVNVTRE 260          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 51.2174 bits (121), Expect = 2.764e-6
Identity = 38/190 (20.00%), Postives = 79/190 (41.58%), Query Frame = 2
Query:  224 VIECTVE-KWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            +++C    ++  +  +I EG++G  +Y++  G++ V +                                  G  L T+  G +FGE+A++  C RTA+V T    ++  I R+ +   +      +    +EF++SV  F    +    +L   +E    E    I++QG R    + +  G++ ++ E
Sbjct:  128 IVDCMYPVEYSKDSCIIKEGDVGSLVYVMEDGKVEVTKE---------------------------------GLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFHGLPEEILSKLGDVLEETHYEDGDYIIRQGARGDTFFIISKGKVTVTRE 284          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 52.373 bits (124), Expect = 1.614e-7
Identity = 30/120 (25.00%), Postives = 59/120 (49.17%), Query Frame = 2
Query:  425 TSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLS 784
            T+ + +C+    +   FGE+AL+    R A+++ T E  +  + R  +   +     ++ KM   FIE+V          + +++  I S S +   +I+ QGE+    Y + SGE+R++
Sbjct:  202 TNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAAKKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLVESGEVRIA 321          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 8.626e-7
Identity = 31/132 (23.48%), Postives = 65/132 (49.24%), Query Frame = 2
Query:  395 KIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCE 790
            K+  E L+ D S  G+ L TL+ G +FGE+A++  C RTA+V    +  ++ + R  + + +    +   K+ ++F+++             ++   +E  +      I+ +GE     Y ++ G++R+S E
Sbjct:   50 KVDVEGLL-DVSKQGESLCTLQPGALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFDCMEESAFADGEAIVNEGEVGHIFYVILRGQVRVSQE 180          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Match: EDO49032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT2])

HSP 1 Score: 80.8777 bits (198), Expect = 7.857e-18
Identity = 48/163 (29.45%), Postives = 88/163 (53.99%), Query Frame = 2
Query:   98 LAE-ILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALI-EKCMRTASVVTTEECEMVVIPRELYNNTV 580
            LAE ILSKPS+ R + ++  +  W R++   FK L DD L  ++   T+ ++  + +++ +GE G+C YI+L G + V+   + D E  T+ E        +R+    E   + G  L++L +G  FGE+ ++ E+  R  +V+  E   ++ I  +LY  ++
Sbjct:   12 LAESILSKPSEQRDDADLEHIICWFRQRSPLFKLLEDDALLDIIKNVTLTRYRKDNIIMRQGEKGNCFYIILKGSVSVYAKQDGDGEAATHHE------QSVRSHK--ERLLLFGAELSSLRAGRSFGEMVMVDERKERNTTVIADEATMLISIDEKLYERSL 166          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 52.373 bits (124), Expect = 4.422e-7
Identity = 47/211 (22.27%), Postives = 83/211 (39.34%), Query Frame = 2
Query:  197 LSDDILQTL-------VIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHA 805
            L +D L+ L       V+EC  E+ +  ++ +I E E G  +Y+L  G+  V                KE                  G  L  +  G  FGE+A++  C RTASV      ++  I R+ +   +           +EF+ SV+     ++ +  ++   IE    E    I++QG R    + + SG + ++     H+
Sbjct:   84 LDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQV---------------TKE------------------GTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHS 261          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Match: EDO32932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN2])

HSP 1 Score: 46.2098 bits (108), Expect = 5.228e-6
Identity = 30/114 (26.32%), Postives = 53/114 (46.49%), Query Frame = 2
Query:  248 WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPV 589
            +  ++V+I +G IG   Y ++SG + V R+    +ED T  E                      Q ++ +  G  FGE+AL+    RTA+++  E  E + + ++ +N  V PV
Sbjct:   51 YEQDRVIIKQGHIGVSFYFIVSGSVVVQRV----EEDRTTGEKH-------------------NQIISEMTGGDSFGELALMHDIRRTATIICKERSEFLRVDKDDFNE-VYPV 140          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Medaka
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:101158535])

HSP 1 Score: 57.7658 bits (138), Expect = 2.673e-8
Identity = 52/241 (21.58%), Postives = 100/241 (41.49%), Query Frame = 2
Query:  176 KVKYFKKLSDDILQTLVIECTVEK-WPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKTYNSWNQESYGKMTQKLLSQRDQRN 895
            K +Y ++L    ++ +V EC  E+ +   + VI +GE G+ +++L  G+L V + N                                 + L  +     FGE+A++  C RTASV    + +   + RE + N +    E   +    F+ SVS  A        +++  +E    +    I+++GE  S  Y +  G+++++   +  AH   +  N+  +  Y    +K L   D R+
Sbjct:  173 KNQYLRRLELQQIKDMV-ECMYERNYQQGECVIKQGEPGNHLFVLAEGKLEVFQHN---------------------------------KLLTWITVWTTFGELAILYNCTRTASVRAVNKVKTWALDREAFQNIMRRTAETRHEQYRNFLRSVSLLANLPDDKLSKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVTQTTE--AHKLPQIINALQKGDY--FGEKALVSDDVRS 375          

HSP 2 Score: 53.1434 bits (126), Expect = 7.117e-7
Identity = 46/181 (25.41%), Postives = 79/181 (43.65%), Query Frame = 2
Query:   44 AFLCAISTISMTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEE-CEMVVIPRELYNNTVA 583
            A + A++ +    ++ E    I+ + ++ R E + R+   +LR  V     L DD L  +V    VE +   + +I EGE G   YI+  G++ V +  E  K                           L Q +  L+ G  FGE AL+   +R+A+++  +   E +VI RE ++ TV 
Sbjct:  252 ASVRAVNKVKTWALDREAFQNIMRRTAETRHE-QYRN---FLRS-VSLLANLPDDKLSKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVTQTTEAHK---------------------------LPQIINALQKGDYFGEKALVSDDVRSANIIADDNGVECLVIDRETFDQTVG 400          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 51.9878 bits (123), Expect = 1.326e-6
Identity = 30/132 (22.73%), Postives = 61/132 (46.21%), Query Frame = 2
Query:  416 IEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHH 811
            I D  + G+C+    +   FGE+AL+    R A+++ T+E  +  + R  +   +     ++ +M   FIESV          + +++  +         +I+ QGE+    Y + SGE+++  + +  A H
Sbjct:  178 IYDIVVSGKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQGEKAECFYIVESGEVKIMMKSKTKADH 309          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000003135.1 (SMESG000003135.1)

HSP 1 Score: 1178.7 bits (3048), Expect = 0.000e+0
Identity = 568/572 (99.30%), Postives = 568/572 (99.30%), Query Frame = 2
Query:   74 MTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKTYNSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLGNVLPLLGLIKDRTLYCMKNLKGYKGPLTLEQLLKRNQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNKKYNRNKLFHQESFKPLQKSFYRSVGRLHRPNDEMKMRTSLFTKEIGYGTHYDNHTKELEGRIGNFLTILDESKSATVEPLSDVLEKIPKIKYPKRGNLVILRPVNKQLRYLRDFNLSSEESVRMYFESKSGK 1789
            MTTINTETLAEILSKPSKDRLEFEIRSVCGW REKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKT NSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLGNVLPLL LIKDRTLYCMKNLKGYKGPLTLEQLLKRNQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNKKYNRNKLFHQESFKPLQKSFYRSVGRLHRPNDEMKMRTSLFTKEIGYGTHYDNHTKELEGRIGNFLTILDESKSATVEPLSDVLEKIPKIKYPKRGNLVILRPVNKQLRYLRDFNLS EESVRMYFESKSGK
Sbjct:    1 MTTINTETLAEILSKPSKDRLEFEIRSVCGWFREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKTCNSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVMLELSYQRIEHWCGRLGNVLPLLELIKDRTLYCMKNLKGYKGPLTLEQLLKRNQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNKKYNRNKLFHQESFKPLQKSFYRSVGRLHRPNDEMKMRTSLFTKEIGYGTHYDNHTKELEGRIGNFLTILDESKSATVEPLSDVLEKIPKIKYPKRGNLVILRPVNKQLRYLRDFNLSPEESVRMYFESKSGK 572          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 162.54 bits (410), Expect = 2.335e-42
Identity = 117/451 (25.94%), Postives = 222/451 (49.22%), Query Frame = 2
Query:   92 ETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIE---DTSILGQCLATLESGHIFGEVALIE-KCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHF---QKTYNSWNQESYGKMTQKLLSQRDQRNKK----------------QFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNM---PYSIFTATATSHCVVLVLHARHFERILL-KRNPASILVMLELSYQRIEHWCGRLGNVLPLLGLIK-DRTLYCMKNLKGYKGPLTLEQL--LKRNQDNIYQYFPPNKGALIDIFGPGTVFF 1354
            E +   ++KPSKDR   EI S+  WLR+K   F  L +++L  ++  C+  +   + ++I +G+ GDC Y++L+GR+ +  +N     D   D    +   K + E + +   D S  G  +A L+SG  FGE+ALI   C+R AS++  E   ++V+ RELYN ++  +  +EF  +L F+++ + F     ++K+Q+  ++      +   ++ QGE  + + F+++G  ++      H   +     T N  N+E        L    D   KK                Q    ++ ++C++            IGD+E  L +     S+ T  AT    V +L A++FER+   K+NP ++ ++ + +  +I+H   RL    P+   I+ +  +   ++ +  +  L  +++  LK N+   + +F  ++G LID++GPG+VF+
Sbjct:    3 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIF-INTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATIN--NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVK-------GGEIIGDIEQGLELTTYASSVITIEATE---VYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRL-EFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFF-QHRGPLIDLYGPGSVFY 438          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 162.54 bits (410), Expect = 2.361e-42
Identity = 117/451 (25.94%), Postives = 222/451 (49.22%), Query Frame = 2
Query:   92 ETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIE---DTSILGQCLATLESGHIFGEVALIE-KCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHF---QKTYNSWNQESYGKMTQKLLSQRDQRNKK----------------QFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNM---PYSIFTATATSHCVVLVLHARHFERILL-KRNPASILVMLELSYQRIEHWCGRLGNVLPLLGLIK-DRTLYCMKNLKGYKGPLTLEQL--LKRNQDNIYQYFPPNKGALIDIFGPGTVFF 1354
            E +   ++KPSKDR   EI S+  WLR+K   F  L +++L  ++  C+  +   + ++I +G+ GDC Y++L+GR+ +  +N     D   D    +   K + E + +   D S  G  +A L+SG  FGE+ALI   C+R AS++  E   ++V+ RELYN ++  +  +EF  +L F+++ + F     ++K+Q+  ++      +   ++ QGE  + + F+++G  ++      H   +     T N  N+E        L    D   KK                Q    ++ ++C++            IGD+E  L +     S+ T  AT    V +L A++FER+   K+NP ++ ++ + +  +I+H   RL    P+   I+ +  +   ++ +  +  L  +++  LK N+   + +F  ++G LID++GPG+VF+
Sbjct:    6 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIF-INTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATIN--NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVK-------GGEIIGDIEQGLELTTYASSVITIEATE---VYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRL-EFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFF-QHRGPLIDLYGPGSVFY 441          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 162.54 bits (410), Expect = 4.258e-42
Identity = 117/451 (25.94%), Postives = 222/451 (49.22%), Query Frame = 2
Query:   92 ETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIE---DTSILGQCLATLESGHIFGEVALIE-KCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHF---QKTYNSWNQESYGKMTQKLLSQRDQRNKK----------------QFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNM---PYSIFTATATSHCVVLVLHARHFERILL-KRNPASILVMLELSYQRIEHWCGRLGNVLPLLGLIK-DRTLYCMKNLKGYKGPLTLEQL--LKRNQDNIYQYFPPNKGALIDIFGPGTVFF 1354
            E +   ++KPSKDR   EI S+  WLR+K   F  L +++L  ++  C+  +   + ++I +G+ GDC Y++L+GR+ +  +N     D   D    +   K + E + +   D S  G  +A L+SG  FGE+ALI   C+R AS++  E   ++V+ RELYN ++  +  +EF  +L F+++ + F     ++K+Q+  ++      +   ++ QGE  + + F+++G  ++      H   +     T N  N+E        L    D   KK                Q    ++ ++C++            IGD+E  L +     S+ T  AT    V +L A++FER+   K+NP ++ ++ + +  +I+H   RL    P+   I+ +  +   ++ +  +  L  +++  LK N+   + +F  ++G LID++GPG+VF+
Sbjct:    3 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIF-INTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATIN--NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVK-------GGEIIGDIEQGLELTTYASSVITIEATE---VYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRL-EFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFF-QHRGPLIDLYGPGSVFY 438          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 161.384 bits (407), Expect = 4.650e-42
Identity = 116/445 (26.07%), Postives = 220/445 (49.44%), Query Frame = 2
Query:  110 LSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTLVIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDEPKELFPPKIRAEPLIE---DTSILGQCLATLESGHIFGEVALIE-KCMRTASVVTTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQLLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHF---QKTYNSWNQESYGKMTQKLLSQRDQRNKK----------------QFSMPKSFDICLLNQKNQDNGNKPSIGDVELLLNM---PYSIFTATATSHCVVLVLHARHFERILL-KRNPASILVMLELSYQRIEHWCGRLGNVLPLLGLIK-DRTLYCMKNLKGYKGPLTLEQL--LKRNQDNIYQYFPPNKGALIDIFGPGTVFF 1354
            ++KPSKDR   EI S+  WLR+K   F  L +++L  ++  C+  +   + ++I +G+ GDC Y++L+GR+ +  +N     D   D    +   K + E + +   D S  G  +A L+SG  FGE+ALI   C+R AS++  E   ++V+ RELYN ++  +  +EF  +L F+++ + F     ++K+Q+  ++      +   ++ QGE  + + F+++G  ++      H   +     T N  N+E        L    D   KK                Q    ++ ++C++            IGD+E  L +     S+ T  AT    V +L A++FER+   K+NP ++ ++ + +  +I+H   RL    P+   I+ +  +   ++ +  +  L  +++  LK N+   + +F  ++G LID++GPG+VF+
Sbjct:    6 ITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIF-INTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATIN--NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVK-------GGEIIGDIEQGLELTTYASSVITIEATE---VYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRL-EFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFF-QHRGPLIDLYGPGSVFY 435          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKG24.640e-828.35protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG24.640e-828.35protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG24.847e-828.35protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG13.109e-620.00protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG14.819e-619.90protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-41.795e-921.95cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-41.795e-921.95cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-42.043e-921.95cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-42.043e-921.95cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-42.076e-921.95cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
for3.524e-1020.38gene:FBgn0000721 transcript:FBtr0446099[more]
for3.767e-1020.51gene:FBgn0000721 transcript:FBtr0473363[more]
for3.767e-1020.51gene:FBgn0000721 transcript:FBtr0473364[more]
for5.023e-1020.38gene:FBgn0000721 transcript:FBtr0089310[more]
for5.023e-1020.38gene:FBgn0000721 transcript:FBtr0089312[more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg21.120e-921.90protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg21.510e-921.90protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg21.585e-921.90protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg27.808e-921.90protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg1a2.059e-620.00protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bmp45.274e-1023.79bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
camk48.595e-721.05calcium/calmodulin-dependent protein kinase IV [So... [more]
camk48.595e-721.05calcium/calmodulin-dependent protein kinase IV [So... [more]
camk41.049e-620.87calcium/calmodulin-dependent protein kinase IV [So... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Prkg21.902e-829.12protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg21.934e-829.12protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg11.767e-620.00protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg12.578e-619.90protein kinase, cGMP-dependent, type I [Source:MGI... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03043|KGP24_DROME5.036e-920.38cGMP-dependent protein kinase, isozyme 2 forms cD4... [more]
sp|A8X6H1|EGL4_CAEBR6.268e-921.95cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|O76360|EGL4_CAEEL2.284e-821.95cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|Q64595|KGP2_RAT1.139e-729.12cGMP-dependent protein kinase 2 OS=Rattus norvegic... [more]
sp|Q61410|KGP2_MOUSE1.377e-729.12cGMP-dependent protein kinase 2 OS=Mus musculus OX... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JNU33.238e-6431.70uncharacterized protein LOC106174696 OS=Lingula un... [more]
A0A210QU713.145e-5932.46cAMP-dependent protein kinase regulatory subunit O... [more]
K1Q5I14.694e-5030.11cAMP-dependent protein kinase regulatory subunit O... [more]
V4BGQ96.817e-4425.10Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A094ZI311.241e-4229.95Uncharacterized protein OS=Schistosoma haematobium... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg21.095e-920.48protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg21.494e-920.48protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
ENSAMXT00000002114.22.645e-821.08cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkg1b1.861e-620.57protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1a2.764e-620.00protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-272n13.71.614e-725.00protein kinase cAMP-dependent type II regulatory s... [more]
ENSPMAT00000001198.18.626e-723.48pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO490327.857e-1829.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384074.422e-722.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329325.228e-626.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prkg22.673e-821.58protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkar2aa1.326e-622.73cAMP-dependent protein kinase type II-alpha regula... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003135.10.000e+099.30SMESG000003135.1[more]
SMESG000078515.12.335e-4225.94SMESG000078515.1[more]
SMESG000078515.12.361e-4225.94SMESG000078515.1[more]
SMESG000078515.14.258e-4225.94SMESG000078515.1[more]
SMESG000078515.14.650e-4226.07SMESG000078515.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027644 ID=SMED30027644|Name=cAMP-dependent protein kinase regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1858bp
ATTATTGGCATCAGATCAGTAGTCTATTAAAAGTTGATAATTGGCATTTT
TATGTGCAATTTCTACAATATCAATGACAACAATAAATACTGAAACACTT
GCAGAAATTCTGTCAAAACCTTCGAAAGATCGATTGGAATTTGAGATCAG
ATCAGTTTGTGGTTGGCTCAGAGAAAAAGTGAAATATTTCAAAAAGCTTT
CAGATGATATCCTCCAAACTCTTGTCATAGAATGCACAGTAGAAAAGTGG
CCATCCAACAAAGTTGTCATTTGGGAAGGTGAAATAGGAGATTGCATGTA
CATTCTTCTGTCCGGGAGGTTGCATGTACATAGATTAAATGAGCCTGACA
AAGAAGATGTTACAAATGATGAACCAAAAGAGCTATTTCCACCTAAAATT
AGAGCTGAACCATTGATAGAAGATACTTCAATTCTTGGGCAATGCTTAGC
AACTTTAGAGTCCGGTCATATTTTTGGAGAAGTAGCTCTTATAGAAAAAT
GCATGCGAACAGCTAGTGTCGTAACAACGGAAGAATGTGAAATGGTCGTA
ATTCCAAGAGAACTCTATAACAATACTGTTGCTCCAGTTCTTGAGGAAGA
ATTTAAGATGAAGCTGGAATTCATTGAATCAGTATCATTTTTTGCCTGCT
GTTCACAACGCCATAAAAAGCAATTACTAATGGCAATAGAATCACACTCA
TGTGAATATCCTACTCAGATTATGAAACAAGGAGAAAGAGTTTCAGCAAT
GTATTTTCTTGTTAGCGGTGAAATTCGACTCTCTTGTGAACCGCAGCATC
ATGCTCATCATTTCCAGAAAACGTATAATTCGTGGAATCAGGAATCGTAT
GGCAAAATGACTCAGAAATTGCTTTCTCAGAGAGATCAAAGAAACAAAAA
ACAATTCAGCATGCCTAAGTCTTTTGATATTTGTCTATTGAATCAGAAAA
ACCAAGATAATGGAAATAAACCTTCCATTGGTGATGTTGAATTGCTTTTA
AACATGCCATACTCAATCTTTACGGCAACAGCTACAAGCCATTGCGTCGT
ACTCGTTCTTCACGCGAGACATTTCGAAAGAATTCTACTGAAACGAAATC
CTGCCAGTATTCTGGTTATGTTAGAACTATCCTATCAACGAATCGAACAT
TGGTGTGGAAGATTGGGAAATGTATTACCATTATTGGGATTAATTAAAGA
TAGGACACTTTATTGTATGAAAAATCTCAAAGGTTATAAAGGTCCTTTAA
CTTTGGAACAGCTATTAAAGAGGAATCAAGATAATATATATCAATATTTT
CCTCCTAATAAAGGTGCATTAATTGATATTTTTGGGCCAGGAACGGTTTT
CTTTTATATTAAAAATCAGTACAATTTAAGAGAACAAAACAAAAAATATA
ATCGCAACAAATTATTTCACCAGGAATCTTTTAAACCTCTTCAAAAATCA
TTTTACCGAAGCGTTGGACGTCTACATCGGCCGAATGATGAAATGAAAAT
GAGGACATCCCTATTTACAAAAGAGATTGGCTATGGAACGCATTATGACA
ATCACACAAAAGAGTTAGAAGGTCGAATTGGAAACTTTTTAACAATACTG
GACGAATCCAAATCAGCCACTGTTGAGCCGTTATCAGATGTGTTGGAAAA
AATACCAAAAATTAAATATCCCAAAAGAGGGAATCTCGTCATTTTGAGAC
CTGTTAACAAGCAACTAAGATATCTCAGAGATTTCAATTTATCTTCAGAG
GAATCCGTACGAATGTATTTTGAAAGTAAATCAGGAAAATAATTTAAACT
AAATACTTTTTCAATATTTTTTATCTATTTAGAAACAATAAAAATATTTT
TCCGAAAA
back to top

protein sequence of SMED30027644-orf-1

>SMED30027644-orf-1 ID=SMED30027644-orf-1|Name=SMED30027644-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
MTTINTETLAEILSKPSKDRLEFEIRSVCGWLREKVKYFKKLSDDILQTL
VIECTVEKWPSNKVVIWEGEIGDCMYILLSGRLHVHRLNEPDKEDVTNDE
PKELFPPKIRAEPLIEDTSILGQCLATLESGHIFGEVALIEKCMRTASVV
TTEECEMVVIPRELYNNTVAPVLEEEFKMKLEFIESVSFFACCSQRHKKQ
LLMAIESHSCEYPTQIMKQGERVSAMYFLVSGEIRLSCEPQHHAHHFQKT
YNSWNQESYGKMTQKLLSQRDQRNKKQFSMPKSFDICLLNQKNQDNGNKP
SIGDVELLLNMPYSIFTATATSHCVVLVLHARHFERILLKRNPASILVML
ELSYQRIEHWCGRLGNVLPLLGLIKDRTLYCMKNLKGYKGPLTLEQLLKR
NQDNIYQYFPPNKGALIDIFGPGTVFFYIKNQYNLREQNKKYNRNKLFHQ
ESFKPLQKSFYRSVGRLHRPNDEMKMRTSLFTKEIGYGTHYDNHTKELEG
RIGNFLTILDESKSATVEPLSDVLEKIPKIKYPKRGNLVILRPVNKQLRY
LRDFNLSSEESVRMYFESKSGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 38..187
e-value: 1.6E-6
score: 37.7
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 38..186
score: 19.856
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 189..236
score: 7.828
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 189..338
e-value: 2.89909E-8
score: 50.017
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 39..179
e-value: 4.17053E-21
score: 86.6109
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 8..171
e-value: 4.7E-30
score: 106.1
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 10..345
NoneNo IPR availablePANTHERPTHR11635:SF152CAMP-DEPENDENT PROTEIN KINASE TYPE I REGULATORY SUBUNITcoord: 10..345
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 65..81
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 134..151
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 175..340
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 7..170