Peptidyl-glycine alpha-amidating monooxygenase

Overview
NamePeptidyl-glycine alpha-amidating monooxygenase
Smed IDSMED30027602
Length (bp)2625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-glycine alpha-amidating monooxygenase (SMED30027602) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-glycine alpha-amidating monooxygenase (SMED30027602) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-glycine alpha-amidating monooxygenase (SMED30027602) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-glycine alpha-amidating monooxygenase (SMED30027602) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027602

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027602h1SMcG0011068 dd_Smed_v4_4863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027602h1SMcG0011068 dd_Smed_v4_4863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027602h1SMcG0011068 dd_Smed_v4_4863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027602h1SMcG0011068 dd_Smed_v6_4863_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027602h1SMcG0011068 OX_Smed_1.0.17572ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027602h1SMcG0019276 OX_Smed_1.0.17572ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 336.265 bits (861), Expect = 2.534e-101
Identity = 222/671 (33.08%), Postives = 337/671 (50.22%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTI----SAKTLQNYNFDIDVLK---------MDKNWKVNKKL---------GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEW--QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAK 2032
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I    + VN D+SC YK N   +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GD+L ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP    E + P P    +           Y   I +L+         +D+++ + + L         G+VSGV++          ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  VL+ + + +FY+PHG++  KDG Y W+TDVA HQV + +  +      + P ++LG+   PG D NHFC+P+ VAVD   G ++V+DGYCN+R+V F P+G +I +W  +S     +    T+    +       + VADREN +I  F  D       I   S   +++ I Y P   L++ +      GD      F  N ++ ++    KP      F  PHD+  +++G  +++ + H   V KF +  K
Sbjct:   59 LDIRMPGVTPKQSDTYFCMSMRIPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYK-NYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKHAVSFMTCTQNVAPDMFRTIPP---EANIPIPVKSDMVMMHEHHKETEYKDKIPLLQQPKREEEEVLDQDFHMEEALDWPGVYLLPGQVSGVALDPKN------NLVIFHRGDHVWDGNSFDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNY-WVTDVALHQVFKLDPNN-----KEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFAISYIPG--LLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEK 704          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 201.06 bits (510), Expect = 5.191e-53
Identity = 111/289 (38.41%), Postives = 154/289 (53.29%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I    + VN D+SC YK N   +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GD+L ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP
Sbjct:   59 LDIRMPGVTPKQSDTYFCMSMRIPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYK-NYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKHAVSFMTCTQNVAPDMFRTIP 342          

HSP 2 Score: 154.451 bits (389), Expect = 6.640e-38
Identity = 103/317 (32.49%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEW--QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAK 2032
            G+VSGV++          ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  VL+ + + +FY+PHG++  KDG Y W+TDVA HQV + +  +      + P ++LG+   PG D NHFC+P+ VAVD   G ++V+DGYCN+R+V F P+G +I +W  +S     +    T+    +       + VADREN +I  F  D       I   S   +++ I Y P   L++ +      GD      F  N ++ ++    KP      F  PHD+  +++G  +++ + H   V KF +  K
Sbjct:  512 GQVSGVALDPKN------NLVIFHRGDHVWDGNSFDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNY-WVTDVALHQVFKLDPNN-----KEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFAISYIPG--LLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKPVRK--HFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEK 811          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 201.06 bits (510), Expect = 5.978e-53
Identity = 111/289 (38.41%), Postives = 154/289 (53.29%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I    + VN D+SC YK N   +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GD+L ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP
Sbjct:   59 LDIRMPGVTPKQSDTYFCMSMRIPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYK-NYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKHAVSFMTCTQNVAPDMFRTIP 342          

HSP 2 Score: 154.451 bits (389), Expect = 7.955e-38
Identity = 103/317 (32.49%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEW--QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAK 2032
            G+VSGV++          ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  VL+ + + +FY+PHG++  KDG Y W+TDVA HQV + +  +      + P ++LG+   PG D NHFC+P+ VAVD   G ++V+DGYCN+R+V F P+G +I +W  +S     +    T+    +       + VADREN +I  F  D       I   S   +++ I Y P   L++ +      GD      F  N ++ ++    KP      F  PHD+  +++G  +++ + H   V KF +  K
Sbjct:  512 GQVSGVALDPKN------NLVIFHRGDHVWDGNSFDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNY-WVTDVALHQVFKLDPNN-----KEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFAISYIPG--LLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKPVRK--HFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEK 811          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 201.445 bits (511), Expect = 6.666e-53
Identity = 111/289 (38.41%), Postives = 154/289 (53.29%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I    + VN D+SC YK N   +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GD+L ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP
Sbjct:   59 LDIRMPGVTPKQSDTYFCMSMRIPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYK-NYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKHAVSFMTCTQNVAPDMFRTIP 342          

HSP 2 Score: 154.451 bits (389), Expect = 8.698e-38
Identity = 103/317 (32.49%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEW--QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAK 2032
            G+VSGV++          ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  VL+ + + +FY+PHG++  KDG Y W+TDVA HQV + +  +      + P ++LG+   PG D NHFC+P+ VAVD   G ++V+DGYCN+R+V F P+G +I +W  +S     +    T+    +       + VADREN +I  F  D       I   S   +++ I Y P   L++ +      GD      F  N ++ ++    KP      F  PHD+  +++G  +++ + H   V KF +  K
Sbjct:  512 GQVSGVALDPKN------NLVIFHRGDHVWDGNSFDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNY-WVTDVALHQVFKLDPNN-----KEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFAISYIPG--LLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEK 811          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Human
Match: PAM (peptidylglycine alpha-amidating monooxygenase [Source:HGNC Symbol;Acc:HGNC:8596])

HSP 1 Score: 201.445 bits (511), Expect = 7.011e-53
Identity = 111/289 (38.41%), Postives = 154/289 (53.29%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I    + VN D+SC YK N   +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GD+L ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP
Sbjct:   59 LDIRMPGVTPKQSDTYFCMSMRIPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYK-NYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKHAVSFMTCTQNVAPDMFRTIP 342          

HSP 2 Score: 154.451 bits (389), Expect = 8.791e-38
Identity = 103/317 (32.49%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEW--QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAK 2032
            G+VSGV++          ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  VL+ + + +FY+PHG++  KDG Y W+TDVA HQV + +  +      + P ++LG+   PG D NHFC+P+ VAVD   G ++V+DGYCN+R+V F P+G +I +W  +S     +    T+    +       + VADREN +I  F  D       I   S   +++ I Y P   L++ +      GD      F  N ++ ++    KP      F  PHD+  +++G  +++ + H   V KF +  K
Sbjct:  512 GQVSGVALDPKN------NLVIFHRGDHVWDGNSFDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNY-WVTDVALHQVFKLDPNN-----KEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFAISYIPG--LLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEK 811          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Celegans
Match: pamn-1 (Probable peptidyl-glycine alpha-amidating monooxygenase pamn-1 Probable peptidylglycine alpha-hydroxylating monooxygenase Probable peptidyl-alpha-hydroxyglycine alpha-amidating lyase [Source:UniProtKB/Swiss-Prot;Acc:P83388])

HSP 1 Score: 238.039 bits (606), Expect = 1.538e-67
Identity = 194/649 (29.89%), Postives = 309/649 (47.61%), Query Frame = 2
Query:  137 EKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICE-NSHEKILFGWARDAKSFHYPSNTGMAVGGKSN-INYFVLQVHYLKP--TTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECG--GNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDLD-SPISDYTIVEVDPVSGN---VLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGII-------KFTHIFRKSLSIYGIKYNPKNRLIYGITSDG--DIRGSS------FTFNTTS----SQMKPWNTDYSFRAPHDLCLADNGKFIFVAEL 1993
            +K  +QM G      D+Y+  S          Y+V++EP+A++   HHMLL+GC+ P S +  +     C       IL+ WAR+A +   P +   +VG + + I YFVLQVHY +P    + D SG+ + +S K P  +  + +LF     I PQ      +++C ++ ++  +  AFRTH HA+GR +S +    +DG    IGK NPQWPQ F    +++ I  GD + A C FDS  K+    +G+  +DEMCNFY MM   +   +N + +      ++     + P    E  P  P  +  + ++     F I    + +N     KLG+V+G++    +Q      +LV  R    W   +F  D Y   LD  PI+D  I+ +   SGN   + R+   G FY+PHGI   KDG +++ TDV  H V ++ + + ++L +   S   G+  +PG D +H+CKP+ +       ++V DGYCN+RVV    NG  I ++    P        +  D   D +  ++ V DREN ++      G +        FT+I+  + S     +    R I G  ++G     G S      + F  T+     QM P      F  PH L +  +G  IFV ++
Sbjct:   33 QKFTIQMIGYSPQKTDDYVAVSIEA----TPGYVVAFEPMAHADRVHHMLLYGCTMPASEQGFWRGMETCGWGGGSYILYAWARNAPNLVLPKDVAFSVGHEQDGIKYFVLQVHYAQPFAGEVHDFSGVTMHISQKKPMNLAAV-MLFVSGTPIPPQLPAFQNNITCMFESSTPIHPFAFRTHTHAMGRLVSAF--FKHDGHWTKIGKRNPQWPQLFEGIPSKLMIGSGDQMSASCRFDSMDKNRTVNMGAMGVDEMCNFY-MMFHYDAKLDNPYPQGAICAKDYPSKMIDYPKDGFELLPSRPELEHHAHQS--KVPFGIVQEAIHENLG-GVKLGQVAGLAFNNEQQ------LLVFQRAGRVWDASTF--DNYNILLDKKPIADPVILVIS-YSGNQTKLERKLGGGQFYLPHGIYVDKDG-FVYTTDVGSHTVAKWKI-EGNELKNIWTS---GELLMPGSDQHHYCKPTGI-TRVEDQLYVTDGYCNSRVVVLDLNGKRIRQFGL--PGEDAGQFNLPHDIVSDSAGRLL-VTDRENGRVQHMTTQGHVIEEFKSTMFTNIYSAA-SHEDYVFMVPGRPIMGHETEGIAVFVGRSGTGLIEYAFGPTTKGKREQMGP-----QFGQPHCLRVCPDGGHIFVGDI 646          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Celegans
Match: pghm-1 (Probable peptidylglycine alpha-hydroxylating monooxygenase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95XM2])

HSP 1 Score: 159.458 bits (402), Expect = 5.864e-43
Identity = 93/312 (29.81%), Postives = 155/312 (49.68%), Query Frame = 2
Query:   89 LRDLFMFLVVIYLANGEKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC-----------RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLN---DGQIELIGKGNPQWPQTF--YKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTK-NTGEENSFSECGGNEFK 973
            L    +        N EK +++MPGV+    D Y+C+S  +   ++ +Y+  ++ L     AHH+LLFGC  P S E  + C           R+    S   IL+ WA DA     P + G  VGG SNI + V+QVHY+      D++GL +  + +P   +    LL +  G   P+ +  + + +C  + +   +  A+RTH H  G+ +SG+ V  +   +   +LIG+ +PQ  Q F   +   + I+ GD++ ARC+  +     ++ +G+T  DEMCNFYIM  T     ++N+    G  ++K
Sbjct:    7 LSSCALLAFATSFCNAEKSQIRMPGVVP-EADSYLCTSLEL--SDQENYLTGFKALTTKGTAHHILLFGCEEPGSDELVWDCGEMNKPDDEMPRAPTCGSKPAILYAWALDAPPLELPQDVGFRVGGDSNIRHLVMQVHYMHSKQEPDETGLEITHTEEPQPKLAATMLLVT--GGTLPRNKTESFETACMIEEDVVMHPFAYRTHTHRHGKEVSGWLVKEDQKHEDHWKLIGRRDPQLAQMFVPVEDQAMTIQQGDMVTARCILQNNENRDIS-MGATEEDEMCNFYIMYWTDGEVMQDNTCYSPGAPDYK 312          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Celegans
Match: pgal-1 (Probable peptidyl-alpha-hydroxyglycine alpha-amidating lyase pgal-1 [Source:UniProtKB/Swiss-Prot;Acc:P91268])

HSP 1 Score: 137.117 bits (344), Expect = 5.727e-35
Identity = 101/326 (30.98%), Postives = 170/326 (52.15%), Query Frame = 2
Query: 1112 NKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIV--LGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW-----QSQDPMFIV-HSITIKEDESGDISKNIVWVADRENRKIIGFGY---DG---------IIKFTHIFRKSLSIYGIKYNPKNRLIYGITSDG-DIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEI 2023
            +K++G+VSG+++      K G+ ++  HR    W E+SF   + + +DL   I++ TI  +      V+ E   G+FYMPHG+T   +G Y W+TDV  HQV + +         KT  IV  LG++ +PG D  HFCKP+ VAV   G++FVADGYCN+R++ F   G  + +      ++Q   F+V HS+++ ED       NIV VADREN+++  F     +G         I   T I R    ++ I+   +   + G+T +  D+    F+ +  + + + +      R  H L +A +G  +FV++L   ++++  +
Sbjct:   56 SKEIGQVSGLAV-----NKNGH-IVAFHRSGRVWDEKSFNDHETFNKDL-GVINNKTIAIISR-EKKVIDEFGAGLFYMPHGLTIDNNGDY-WVTDVGSHQVHKIDA--------KTQKIVMSLGEKMVPGEDQAHFCKPTDVAVAKNGHIFVADGYCNSRILKFDAKGNLMAQINAATEENQPSEFVVPHSLSLIED------MNIVCVADRENQRVQCFSAGLSEGDRTLPTGIPITSATDIGR----VFAIR--EREHYLIGVTGNSEDVEAQMFSIDMQTGKTETFAK--GVRNTHALAIAADG-VMFVSQLEPSRILEIRL 349          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Celegans
Match: pgal-1 (Probable peptidyl-alpha-hydroxyglycine alpha-amidating lyase pgal-1 [Source:UniProtKB/Swiss-Prot;Acc:P91268])

HSP 1 Score: 137.117 bits (344), Expect = 5.727e-35
Identity = 101/326 (30.98%), Postives = 170/326 (52.15%), Query Frame = 2
Query: 1112 NKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIV--LGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW-----QSQDPMFIV-HSITIKEDESGDISKNIVWVADRENRKIIGFGY---DG---------IIKFTHIFRKSLSIYGIKYNPKNRLIYGITSDG-DIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEI 2023
            +K++G+VSG+++      K G+ ++  HR    W E+SF   + + +DL   I++ TI  +      V+ E   G+FYMPHG+T   +G Y W+TDV  HQV + +         KT  IV  LG++ +PG D  HFCKP+ VAV   G++FVADGYCN+R++ F   G  + +      ++Q   F+V HS+++ ED       NIV VADREN+++  F     +G         I   T I R    ++ I+   +   + G+T +  D+    F+ +  + + + +      R  H L +A +G  +FV++L   ++++  +
Sbjct:   56 SKEIGQVSGLAV-----NKNGH-IVAFHRSGRVWDEKSFNDHETFNKDL-GVINNKTIAIISR-EKKVIDEFGAGLFYMPHGLTIDNNGDY-WVTDVGSHQVHKIDA--------KTQKIVMSLGEKMVPGEDQAHFCKPTDVAVAKNGHIFVADGYCNSRILKFDAKGNLMAQINAATEENQPSEFVVPHSLSLIED------MNIVCVADRENQRVQCFSAGLSEGDRTLPTGIPITSATDIGR----VFAIR--EREHYLIGVTGNSEDVEAQMFSIDMQTGKTETFAK--GVRNTHALAIAADG-VMFVSQLEPSRILEIRL 349          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Celegans
Match: tbh-1 (Tyramine beta-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ6])

HSP 1 Score: 88.5817 bits (218), Expect = 7.650e-18
Identity = 67/261 (25.67%), Postives = 106/261 (40.61%), Query Frame = 2
Query:  191 ICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCS------SPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTT---IEDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRKVNLDVSCRYKGNSE-----AYTLAFRTHAHALGRSI--SGYKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYI 907
            I    P    N   ++V  EP     N  + HHM +F C       S    +P  P +S    S   ++  WA      HYP   G+ +GGK    Y ++++HY  P     + D SG    ++ +   Y  GI    L++S    + P  +   ++  C  +             A + HAH  GR +  S Y+  +  G +      +P W         V++ PGD L+  C++D+  +  VT  G   +DEMC  YI
Sbjct:  209 IIRKMPFDTVNNMYHVVRMEPYVTPGNEHLVHHMEIFMCRDEVEEWSGSCNDPKKPPKS---KSCSHVIAAWAMGEGPIHYPKEAGLPIGGKGKNAYVMVEIHYNNPELHKGVIDSSGFQFFVTGQLRKYDAGIMELGLIYSDANSVPPNQKAWAMNGYCPSQCTKNLPEEGINIFASQLHAHLTGRKLFTSQYRSGVRIGDVNRDEHYSPHWQHLQQLRPVVKVMPGDTLVTTCVYDTRKRSKVTFGGYRIVDEMCVNYI 466          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Fly
Match: Phm (gene:FBgn0283509 transcript:FBtr0072203)

HSP 1 Score: 157.918 bits (398), Expect = 6.415e-42
Identity = 96/272 (35.29%), Postives = 140/272 (51.47%), Query Frame = 2
Query:  155 MPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHE------------KILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIE----DKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLN-DGQIEL--IGKGNPQWPQTFYKSAQVQ-IKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM 910
            MP V     D Y+C+   V +     YIV + P A  + AHHMLL+GC  P +++ ++ C  +   S E            +I++ WARDA+  + P   G  VG  S I Y VLQVHY      +    D SG+ L+ + +P   + G  LL +  G+I P  +  +L+ +C        +  A+R H H LG+ +SGY+V  N DG+ E   +GK +P  PQ FY ++    I  GD +  RC   ST +   T+IG T+ DEMCNFY+M
Sbjct:   56 MPNVSPQTPDLYLCTPIKV-DPTTTYYIVGFNPNATMNTAHHMLLYGCGEPGTSKTTWNCGEMNRASQEESASPCGPHSNSQIVYAWARDAQKLNLPEGVGFKVGKNSPIKYLVLQVHYAHIDKFKDGSTDDSGVFLDYTEEPRKKLAGTLLLGT-DGQI-PAMKTEHLETACEVNEQKVLHPFAYRVHTHGLGKVVSGYRVRTNSDGEQEWLQLGKRDPLTPQMFYNTSNTDPIIEGDKIAVRCTMQST-RHRTTKIGPTNEDEMCNFYLM 323          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Fly
Match: Phm (gene:FBgn0283509 transcript:FBtr0072202)

HSP 1 Score: 157.918 bits (398), Expect = 6.415e-42
Identity = 96/272 (35.29%), Postives = 140/272 (51.47%), Query Frame = 2
Query:  155 MPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHE------------KILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIE----DKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLN-DGQIEL--IGKGNPQWPQTFYKSAQVQ-IKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM 910
            MP V     D Y+C+   V +     YIV + P A  + AHHMLL+GC  P +++ ++ C  +   S E            +I++ WARDA+  + P   G  VG  S I Y VLQVHY      +    D SG+ L+ + +P   + G  LL +  G+I P  +  +L+ +C        +  A+R H H LG+ +SGY+V  N DG+ E   +GK +P  PQ FY ++    I  GD +  RC   ST +   T+IG T+ DEMCNFY+M
Sbjct:   56 MPNVSPQTPDLYLCTPIKV-DPTTTYYIVGFNPNATMNTAHHMLLYGCGEPGTSKTTWNCGEMNRASQEESASPCGPHSNSQIVYAWARDAQKLNLPEGVGFKVGKNSPIKYLVLQVHYAHIDKFKDGSTDDSGVFLDYTEEPRKKLAGTLLLGT-DGQI-PAMKTEHLETACEVNEQKVLHPFAYRVHTHGLGKVVSGYRVRTNSDGEQEWLQLGKRDPLTPQMFYNTSNTDPIIEGDKIAVRCTMQST-RHRTTKIGPTNEDEMCNFYLM 323          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Fly
Match: Pal1 (gene:FBgn0283510 transcript:FBtr0339422)

HSP 1 Score: 137.887 bits (346), Expect = 6.710e-34
Identity = 108/377 (28.65%), Postives = 174/377 (46.15%), Query Frame = 2
Query:  995 SYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKN------WKVNK-KLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW------------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGF-GYDGIIKFTHIFRKSL---SIYGIKYNPKNR----LIYGITSDGDIRGS------SFTFNTTSSQM--KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            S + + + P PP +T+        N   ++ K++        W  N  KLG V+ VS      +    +V++ HR +  W + +F  ++ YQE    PI + TI+ ++P +G V  +  +  FYMPHG+T   +   +W+TDVA HQV +F  R      D  P++ LG  F PG     FCKP+ VAV   G  FVADGYCN R++ +   G  I  W              Q+   I H++T+  +        ++  ADREN ++  F   +G   F   +   L    ++ + Y P       ++ G T++  I          F  +  S Q+  K    +  F+ PHD+ +  +G  I+VAEL+  ++ KF
Sbjct:   66 SGATQLNWPQPPKQTVP-------NVKTELAKLNNTYVYQNAWPANNVKLGAVTAVS------FDKAGNVVIFHRVNRVWGQTTFDNRNQYQEKYRGPIRESTILALEPATGKVQYDWGKNFFYMPHGLTVDPEDN-VWLTDVAMHQVFKFPPRGG----DGKPALTLGDAFQPGSGRK-FCKPTSVAVLDNGDFFVADGYCNARILKYSRKGELILFWGQNTFSGISYDVAPQNFFAIPHALTLVPE------LQLLCAADRENGRVQCFLSSNGT--FHSQYHNQLIGDRLFSMAYTPAAGGQLVIVNGPTAELGIHPEHYNEVHGFVLSMRSKQLVSKFGPNNLQFQNPHDVAVTADGNEIYVAELNPMRIHKF 415          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Fly
Match: Pal1 (gene:FBgn0283510 transcript:FBtr0339423)

HSP 1 Score: 137.887 bits (346), Expect = 9.547e-34
Identity = 121/449 (26.95%), Postives = 197/449 (43.88%), Query Frame = 2
Query:  995 SYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKN------WKVNK-KLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW------------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGF-GYDGIIKFTHIFRKSL---SIYGIKYNPKNR----LIYGITSDGDIRGS------SFTFNTTSSQM--KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF---EIAAKSSTKHHQHSVGNNFNQ-----------IHDMVKQINPVYIGVLMVAVTVFILICIVTMKYYRRC 2191
            S + + + P PP +T+        N   ++ K++        W  N  KLG V+ VS      +    +V++ HR +  W + +F  ++ YQE    PI + TI+ ++P +G V  +  +  FYMPHG+T   +   +W+TDVA HQV +F  R      D  P++ LG  F PG     FCKP+ VAV   G  FVADGYCN R++ +   G  I  W              Q+   I H++T+  +        ++  ADREN ++  F   +G   F   +   L    ++ + Y P       ++ G T++  I          F  +  S Q+  K    +  F+ PHD+ +  +G  I+VAEL+  ++ KF    +A   S    + S  +  +Q           +H    +   V   +L+ A + F L  I   +  R C
Sbjct:   66 SGATQLNWPQPPKQTVP-------NVKTELAKLNNTYVYQNAWPANNVKLGAVTAVS------FDKAGNVVIFHRVNRVWGQTTFDNRNQYQEKYRGPIRESTILALEPATGKVQYDWGKNFFYMPHGLTVDPEDN-VWLTDVAMHQVFKFPPRGG----DGKPALTLGDAFQPGSGRK-FCKPTSVAVLDNGDFFVADGYCNARILKYSRKGELILFWGQNTFSGISYDVAPQNFFAIPHALTLVPE------LQLLCAADRENGRVQCFLSSNGT--FHSQYHNQLIGDRLFSMAYTPAAGGQLVIVNGPTAELGIHPEHYNEVHGFVLSMRSKQLVSKFGPNNLQFQNPHDVAVTADGNEIYVAELNPMRIHKFVHRSLAKPMSLSASKDSRDSAISQAVGGDQVPAVAVHHPSGKAILVASLMLLFAGSTFALALIFARRRKRGC 487          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Fly
Match: Pal1 (gene:FBgn0283510 transcript:FBtr0088385)

HSP 1 Score: 137.887 bits (346), Expect = 9.547e-34
Identity = 121/449 (26.95%), Postives = 197/449 (43.88%), Query Frame = 2
Query:  995 SYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKN------WKVNK-KLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW------------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGF-GYDGIIKFTHIFRKSL---SIYGIKYNPKNR----LIYGITSDGDIRGS------SFTFNTTSSQM--KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF---EIAAKSSTKHHQHSVGNNFNQ-----------IHDMVKQINPVYIGVLMVAVTVFILICIVTMKYYRRC 2191
            S + + + P PP +T+        N   ++ K++        W  N  KLG V+ VS      +    +V++ HR +  W + +F  ++ YQE    PI + TI+ ++P +G V  +  +  FYMPHG+T   +   +W+TDVA HQV +F  R      D  P++ LG  F PG     FCKP+ VAV   G  FVADGYCN R++ +   G  I  W              Q+   I H++T+  +        ++  ADREN ++  F   +G   F   +   L    ++ + Y P       ++ G T++  I          F  +  S Q+  K    +  F+ PHD+ +  +G  I+VAEL+  ++ KF    +A   S    + S  +  +Q           +H    +   V   +L+ A + F L  I   +  R C
Sbjct:   66 SGATQLNWPQPPKQTVP-------NVKTELAKLNNTYVYQNAWPANNVKLGAVTAVS------FDKAGNVVIFHRVNRVWGQTTFDNRNQYQEKYRGPIRESTILALEPATGKVQYDWGKNFFYMPHGLTVDPEDN-VWLTDVAMHQVFKFPPRGG----DGKPALTLGDAFQPGSGRK-FCKPTSVAVLDNGDFFVADGYCNARILKYSRKGELILFWGQNTFSGISYDVAPQNFFAIPHALTLVPE------LQLLCAADRENGRVQCFLSSNGT--FHSQYHNQLIGDRLFSMAYTPAAGGQLVIVNGPTAELGIHPEHYNEVHGFVLSMRSKQLVSKFGPNNLQFQNPHDVAVTADGNEIYVAELNPMRIHKFVHRSLAKPMSLSASKDSRDSAISQAVGGDQVPAVAVHHPSGKAILVASLMLLFAGSTFALALIFARRRKRGC 487          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Zebrafish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:ZFIN;Acc:ZDB-GENE-090313-384])

HSP 1 Score: 287.73 bits (735), Expect = 2.870e-87
Identity = 171/452 (37.83%), Postives = 247/452 (54.65%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNP--PSKTISAK----------TLQNYNFDIDV------LKMDKNW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQV 1414
            L +++PGV+   +D Y C + PVP   E +YIV + P A+   AHHM+L+GC +P++T+  + C      C +   KI++ WAR+A     P + G  VGG + INYFVLQ+HY       D     SGL L ++SKP  ++ G++L+ S    I P  +  N D++C Y  +S  Y  AFRTH H+LG+ +SGY+V   +GQ   IG+ +P  PQ FY +   + +K GDIL ARC+F   G+ + T+IG T  DEMCNFYIM    NT     +  C  +   +L++NIPS   E + P P  P   +S K           LQ    D +V      L    +W + + +LG+VSG+++           +++ HRG H W   SF +  +YQ     PI   TI+ VD V G VL+ + + +FY+PHGIT   D  Y W+TDVA HQV
Sbjct:   60 LDIRLPGVVPTESDSYYCMAVPVPTSRE-AYIVDFVPHASMDTAHHMILYGCKTPYATQGYWDCGKELGTCRD-QAKIMYAWARNAPPTKLPKDVGFKVGGDTRINYFVLQIHYGDVNNFRDHHRDCSGLSLRMTSKPQPFIAGMYLMMSVDTLIPPGKKVTNADIACTYT-SSPMYPFAFRTHTHSLGKVVSGYRV--RNGQWTQIGRQSPLLPQAFYPATNTIDVKDGDILAARCVFTGEGRTTTTQIGGTSNDEMCNFYIMYYMDNT-HAVPYMNCRDDGSSELFRNIPS---EANIPIPVRPDHMMSMKHESSPQKDAVELQEPKRDEEVQDQGAHLVEVSDWPEADLQLGQVSGLAL------NSNGDLVIFHRGDHIWGIDSFNMNAIYQLRDQGPIQQSTILLVDSVKGKVLKASGKNMFYLPHGITTDHDDNY-WVTDVALHQV 495          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Zebrafish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:ZFIN;Acc:ZDB-GENE-090313-384])

HSP 1 Score: 226.483 bits (576), Expect = 2.257e-61
Identity = 118/293 (40.27%), Postives = 171/293 (58.36%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPS 997
            L +++PGV+   +D Y C + PVP   E +YIV + P A+   AHHM+L+GC +P++T+  + C      C +   KI++ WAR+A     P + G  VGG + INYFVLQ+HY       D     SGL L ++SKP  ++ G++L+ S    I P  +  N D++C Y  +S  Y  AFRTH H+LG+ +SGY+V   +GQ   IG+ +P  PQ FY +   + +K GDIL ARC+F   G+ + T+IG T  DEMCNFYIM    NT     +  C  +   +L++NIPS
Sbjct:   60 LDIRLPGVVPTESDSYYCMAVPVPTSRE-AYIVDFVPHASMDTAHHMILYGCKTPYATQGYWDCGKELGTCRD-QAKIMYAWARNAPPTKLPKDVGFKVGGDTRINYFVLQIHYGDVNNFRDHHRDCSGLSLRMTSKPQPFIAGMYLMMSVDTLIPPGKKVTNADIACTYT-SSPMYPFAFRTHTHSLGKVVSGYRV--RNGQWTQIGRQSPLLPQAFYPATNTIDVKDGDILAARCVFTGEGRTTTTQIGGTSNDEMCNFYIMYYMDNT-HAVPYMNCRDDGSSELFRNIPS 346          

HSP 2 Score: 161.384 bits (407), Expect = 3.871e-40
Identity = 110/342 (32.16%), Postives = 175/342 (51.17%), Query Frame = 2
Query: 1100 NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQD--------------PMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL---SIYGIKYNP-KNRLIYGITSDGDIRGSS----FTFNTTSSQ-MKPWNTDYS-FRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTK 2044
            +W + + +LG+VSG+++           +++ HRG H W   SF +  +YQ     PI   TI+ VD V G VL+ + + +FY+PHGIT   D  Y W+TDVA HQV + +     + +     +VLG+ F PG D  HFC+P+ VAVD   G V+V+DGYCN+R++ F P G YI  W +                P  I HS+T   D      K  + VADR+N +I  F  D   +F    +K +    ++ I Y+P +  L+Y +  +     ++    F  N +S + +  ++ D   F+ PHD+ +  +G  +FV +     V+KF  +AK+  +
Sbjct:  497 DWPEADLQLGQVSGLAL------NSNGDLVIFHRGDHIWGIDSFNMNAIYQLRDQGPIQQSTILLVDSVKGKVLKASGKNMFYLPHGITTDHDDNY-WVTDVALHQVFKLSGNGKDQQL-----LVLGEAFEPGSDKKHFCQPTDVAVDPVTGNVYVSDGYCNSRILQFSPEGKYISHWGADQRKSALSSALPGRRVPFRIPHSLTFLPD------KRELCVADRDNGRIQCFMAD-TGEFVKEIKKDVFGGEVFAIAYSPAQGGLLYAVNGEPPYGQAAPLQGFVINYSSKEILDSFSPDTQVFKLPHDIVVTADGT-VFVGDAAADSVMKFIQSAKAEHR 818          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Zebrafish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:ZFIN;Acc:ZDB-GENE-090313-384])

HSP 1 Score: 178.718 bits (452), Expect = 6.085e-47
Identity = 136/423 (32.15%), Postives = 210/423 (49.65%), Query Frame = 2
Query:  890 MCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNP--PSKTISAK----------TLQNYNFDIDV------LKMDKNW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEW-------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL---SIYGIKYNP-KNRLIYGITSDGDIRGSS----FTFNTTSSQ-MKPWNTDYS-FRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTK 2044
            MCNFYIM    NT     +  C  +   +L++NIPS   E + P P  P   +S K           LQ    D +V      L    +W + + +LG+VSG+++           +++ HRG H W   SF +  +YQ     PI   TI+ VD V G VL+ + + +FY+PHGIT   D  Y W+TDVA HQV + +     + +     +VLG+ F PG D  HFC+P+ VAVD   G V+V+DGYCN+R++ F P G YI  W       + + P  I HS+T   D      K  + VADR+N +I  F  D   +F    +K +    ++ I Y+P +  L+Y +  +     ++    F  N +S + +  ++ D   F+ PHD+ +  +G  +FV +     V+KF  +AK+  +
Sbjct:    1 MCNFYIMYYMDNT-HAVPYMNCRDDGSSELFRNIPS---EANIPIPVRPDHMMSMKHESSPQKDAVELQEPKRDEEVQDQGAHLVEVSDWPEADLQLGQVSGLAL------NSNGDLVIFHRGDHIWGIDSFNMNAIYQLRDQGPIQQSTILLVDSVKGKVLKASGKNMFYLPHGITTDHDDNY-WVTDVALHQVFKLSGNGKDQQL-----LVLGEAFEPGSDKKHFCQPTDVAVDPVTGNVYVSDGYCNSRILQFSPEGKYISHWGAGSSDRKRRVPFRIPHSLTFLPD------KRELCVADRDNGRIQCFMAD-TGEFVKEIKKDVFGGEVFAIAYSPAQGGLLYAVNGEPPYGQAAPLQGFVINYSSKEILDSFSPDTQVFKLPHDIVVTADGT-VFVGDAAADSVMKFIQSAKAEHR 399          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Zebrafish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:ZFIN;Acc:ZDB-GENE-090313-384])

HSP 1 Score: 163.696 bits (413), Expect = 1.790e-41
Identity = 110/335 (32.84%), Postives = 176/335 (52.54%), Query Frame = 2
Query: 1100 NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEW-------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL---SIYGIKYNP-KNRLIYGITSDGDIRGSS----FTFNTTSSQ-MKPWNTDYS-FRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTK 2044
            +W + + +LG+VSG+++           +++ HRG H W   SF +  +YQ     PI   TI+ VD V G VL+ + + +FY+PHGIT   D  Y W+TDVA HQV + +     + +     +VLG+ F PG D  HFC+P+ VAVD   G V+V+DGYCN+R++ F P G YI  W       + + P  I HS+T   D      K  + VADR+N +I  F  D   +F    +K +    ++ I Y+P +  L+Y +  +     ++    F  N +S + +  ++ D   F+ PHD+ +  +G  +FV +     V+KF  +AK+  +
Sbjct:  186 DWPEADLQLGQVSGLAL------NSNGDLVIFHRGDHIWGIDSFNMNAIYQLRDQGPIQQSTILLVDSVKGKVLKASGKNMFYLPHGITTDHDDNY-WVTDVALHQVFKLSGNGKDQQL-----LVLGEAFEPGSDKKHFCQPTDVAVDPVTGNVYVSDGYCNSRILQFSPEGKYISHWGAGSSDRKRRVPFRIPHSLTFLPD------KRELCVADRDNGRIQCFMAD-TGEFVKEIKKDVFGGEVFAIAYSPAQGGLLYAVNGEPPYGQAAPLQGFVINYSSKEILDSFSPDTQVFKLPHDIVVTADGT-VFVGDAAADSVMKFIQSAKAEHR 500          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Zebrafish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 89.3521 bits (220), Expect = 6.594e-18
Identity = 73/274 (26.64%), Postives = 117/274 (42.70%), Query Frame = 2
Query:  164 VLAMNNDEYICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCSSPFSTEPSFP--CRSICE----NSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTI---EDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRKVNLDVSCRYKGNSEA------YTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-----SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYI 907
            ++      Y C  + +P +   ++IV YE +    N +I HH+ +F CS      P +   C S  +    N    +L  WA  A+ F+YP++ G+ +GG+ +  +  L+VHY  P  +    D SG+ L  S     +  GI    L+++    I P+ R   L   C  K    A      +  A + H H  G    G +  L  G  E+      +   T Y+        V + PGD L+  C F++  +  VT  G   M+EMC  Y+
Sbjct:  218 IIPTQETTYWCHIYQLPPNLPKNHIVMYESVITPGNEAIVHHIEVFECSPQMDIVPQYSGSCDSKMKPRNLNYCRHVLAAWAMGAEPFYYPADAGLPMGGEGSSRFLRLEVHYHNPLLLSGRRDSSGIRLWYSPSLRRFDAGIMELGLVYTPVMAIPPRQRSFQLTGYCTAKCTQTALPVGGIHIFASQLHTHLAGL---GVRTVLVRGGQEVEVVQEDKHFSTHYQIIRVLQKMVTVLPGDALLTTCRFNTEDRSKVTVGGFGIMEEMCVNYV 488          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 361.303 bits (926), Expect = 1.475e-110
Identity = 231/670 (34.48%), Postives = 342/670 (51.04%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNP----------------PSKTIS---AKTLQNYNFDIDV-LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG---IIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L ++MPGV    +D Y+C S+ +P  +E +Y+V + P A+   AHHMLLFGC+ P ST+  + C +        I++ WA++A     P   G  VGGKS   YFVLQVHY      +DK    +G+ + ++ +    + GI+L  S    I P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     ++I PGDI+  RCLF   GK + T IG T  DEMCN YIM    +    +S+  C       L++NIP  +    P +P                P K  +    K  +    D DV L+ D +W  VN K+G+VSG+++          ++++ HRG H W E SF ++ VYQ+    PI + TI+ VDP +  VL+ A + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLGK F PG D  HFC+P+ VAVD   G  FV+DGYCN+R++ F PNG +I +W  +            I HS+T+  D         + VADREN +I  F  +    + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+  AD+G  ++V + H   V KF
Sbjct:   60 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDCSAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPLIAGIYLSMSVDTVIPPGVDAVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRV--RHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYM-DAAHASSYMTCVQTGEPKLFQNIPEIANVPIPVSPDMMMMMGHGHHHEEAEPEKNTALQQPKREEEEVLDQDVHLEEDTDWPGVNLKVGQVSGLALDPKN------NLVIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPNTSKVLKSAGKNLFFLPHGLTIDRDGNY-WVTDVALHQVFKLGAEKE------TPLLVLGKAFQPGSDRKHFCQPTDVAVDPITGNFFVSDGYCNSRIMQFSPNGMFIMQWGDETSSTIPKPGQFRIPHSLTMVPDHGQ------LCVADRENGRIQCFHAETGKFVKQIKHREFGREVFAVSYAPGGVLYAVNGKPYYGDSA--PVQGFMLNFSNGEILDTFIPARKNFEMPHDIAAADDGT-VYVGDAHANAVWKF 702          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 200.29 bits (508), Expect = 1.392e-52
Identity = 109/289 (37.72%), Postives = 157/289 (54.33%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y+C S+ +P  +E +Y+V + P A+   AHHMLLFGC+ P ST+  + C +        I++ WA++A     P   G  VGGKS   YFVLQVHY      +DK    +G+ + ++ +    + GI+L  S    I P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     ++I PGDI+  RCLF   GK + T IG T  DEMCN YIM    +    +S+  C       L++NIP
Sbjct:   60 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDCSAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPLIAGIYLSMSVDTVIPPGVDAVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRV--RHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYM-DAAHASSYMTCVQTGEPKLFQNIP 343          

HSP 2 Score: 177.178 bits (448), Expect = 4.091e-45
Identity = 114/331 (34.44%), Postives = 173/331 (52.27%), Query Frame = 2
Query: 1085 LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG---IIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L+ D +W  VN K+G+VSG+++          ++++ HRG H W E SF ++ VYQ+    PI + TI+ VDP +  VL+ A + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLGK F PG D  HFC+P+ VAVD   G  FV+DGYCN+R++ F PNG +I +W  +            I HS+T+  D         + VADREN +I  F  +    + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+  AD+G  ++V + H   V KF
Sbjct:  501 LEEDTDWPGVNLKVGQVSGLALDPKN------NLVIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPNTSKVLKSAGKNLFFLPHGLTIDRDGNY-WVTDVALHQVFKLGAEKE------TPLLVLGKAFQPGSDRKHFCQPTDVAVDPITGNFFVSDGYCNSRIMQFSPNGMFIMQWGDETSSTIPKPGQFRIPHSLTMVPDHGQ------LCVADRENGRIQCFHAETGKFVKQIKHREFGREVFAVSYAPGGVLYAVNGKPYYGDSA--PVQGFMLNFSNGEILDTFIPARKNFEMPHDIAAADDGT-VYVGDAHANAVWKF 809          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 200.29 bits (508), Expect = 1.695e-52
Identity = 109/289 (37.72%), Postives = 157/289 (54.33%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y+C S+ +P  +E +Y+V + P A+   AHHMLLFGC+ P ST+  + C +        I++ WA++A     P   G  VGGKS   YFVLQVHY      +DK    +G+ + ++ +    + GI+L  S    I P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     ++I PGDI+  RCLF   GK + T IG T  DEMCN YIM    +    +S+  C       L++NIP
Sbjct:   60 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDCSAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPLIAGIYLSMSVDTVIPPGVDAVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRV--RHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYM-DAAHASSYMTCVQTGEPKLFQNIP 343          

HSP 2 Score: 177.178 bits (448), Expect = 4.317e-45
Identity = 114/331 (34.44%), Postives = 173/331 (52.27%), Query Frame = 2
Query: 1085 LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG---IIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L+ D +W  VN K+G+VSG+++          ++++ HRG H W E SF ++ VYQ+    PI + TI+ VDP +  VL+ A + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLGK F PG D  HFC+P+ VAVD   G  FV+DGYCN+R++ F PNG +I +W  +            I HS+T+  D         + VADREN +I  F  +    + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+  AD+G  ++V + H   V KF
Sbjct:  501 LEEDTDWPGVNLKVGQVSGLALDPKN------NLVIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPNTSKVLKSAGKNLFFLPHGLTIDRDGNY-WVTDVALHQVFKLGAEKE------TPLLVLGKAFQPGSDRKHFCQPTDVAVDPITGNFFVSDGYCNSRIMQFSPNGMFIMQWGDETSSTIPKPGQFRIPHSLTMVPDHGQ------LCVADRENGRIQCFHAETGKFVKQIKHREFGREVFAVSYAPGGVLYAVNGKPYYGDSA--PVQGFMLNFSNGEILDTFIPARKNFEMPHDIAAADDGT-VYVGDAHANAVWKF 809          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 189.119 bits (479), Expect = 5.544e-49
Identity = 108/285 (37.89%), Postives = 150/285 (52.63%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y+C S+ +P  +E +Y+V + P A+   AHHMLLFGC+ P ST+  + C +        I++ WA++A     P   G  VGGKS   YFVLQVHY      + K  L           + GI+L  S    I P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     ++I PGDI+  RCLF   GK + T IG T  DEMCN YIM    +    +S+  C       L++NIP
Sbjct:   60 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDCSAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHYGDVKAFQGKQPL-----------IAGIYLSMSVDTVIPPGV-DVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRV--RHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYM-DAAHASSYMTCVQTGEPKLFQNIP 327          

HSP 2 Score: 177.563 bits (449), Expect = 3.960e-45
Identity = 114/331 (34.44%), Postives = 173/331 (52.27%), Query Frame = 2
Query: 1085 LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG---IIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L+ D +W  VN K+G+VSG+++          ++++ HRG H W E SF ++ VYQ+    PI + TI+ VDP +  VL+ A + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLGK F PG D  HFC+P+ VAVD   G  FV+DGYCN+R++ F PNG +I +W  +            I HS+T+  D         + VADREN +I  F  +    + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+  AD+G  ++V + H   V KF
Sbjct:  485 LEEDTDWPGVNLKVGQVSGLALDPKN------NLVIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPNTSKVLKSAGKNLFFLPHGLTIDRDGNY-WVTDVALHQVFKLGAEKE------TPLLVLGKAFQPGSDRKHFCQPTDVAVDPITGNFFVSDGYCNSRIMQFSPNGMFIMQWGDETSSTIPKPGQFRIPHSLTMVPDHGQ------LCVADRENGRIQCFHAETGKFVKQIKHREFGREVFAVSYAPGGVLYAVNGKPYYGDSA--PVQGFMLNFSNGEILDTFIPARKNFEMPHDIAAADDGT-VYVGDAHANAVWKF 793          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Xenopus
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:100170159])

HSP 1 Score: 185.652 bits (470), Expect = 7.856e-48
Identity = 109/285 (38.25%), Postives = 152/285 (53.33%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y+C S+ +P  +E +Y+V + P A+   AHHMLLFGC+ P ST+  + C +        I++ WA++A     P   G  VGGKS   YFVLQVHY       DK      +  +P   + GI+L  S    I P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     ++I PGDI+  RCLF   GK + T IG T  DEMCN YIM    +    +S+  C       L++NIP
Sbjct:   46 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDFRPHASMDTAHHMLLFGCNMPSSTDDYWDCSAGTCTDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGNRYFVLQVHY------GDKY-CCFYVCRQP--LIAGIYLSMSVDTVIPPGV-DVNSDIACLYN-RPAIHPFAYRVHTHQLGQVVSGFRV--RHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGKTTPTYIGGTAKDEMCNLYIMYYM-DAAHASSYMTCVQTGEPKLFQNIP 315          

HSP 2 Score: 177.563 bits (449), Expect = 3.626e-45
Identity = 114/331 (34.44%), Postives = 173/331 (52.27%), Query Frame = 2
Query: 1085 LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG---IIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L+ D +W  VN K+G+VSG+++          ++++ HRG H W E SF ++ VYQ+    PI + TI+ VDP +  VL+ A + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLGK F PG D  HFC+P+ VAVD   G  FV+DGYCN+R++ F PNG +I +W  +            I HS+T+  D         + VADREN +I  F  +    + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+  AD+G  ++V + H   V KF
Sbjct:  472 LEEDTDWPGVNLKVGQVSGLALDPKN------NLVIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPNTSKVLKSAGKNLFFLPHGLTIDRDGNY-WVTDVALHQVFKLGAEKE------TPLLVLGKAFQPGSDRKHFCQPTDVAVDPITGNFFVSDGYCNSRIMQFSPNGMFIMQWGDETSSTIPKPGQFRIPHSLTMVPDHGQ------LCVADRENGRIQCFHAETGKFVKQIKHREFGREVFAVSYAPGGVLYAVNGKPYYGDSA--PVQGFMLNFSNGEILDTFIPARKNFEMPHDIAAADDGT-VYVGDAHANAVWKF 780          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 337.035 bits (863), Expect = 1.142e-101
Identity = 227/683 (33.24%), Postives = 337/683 (49.34%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVL----------KMDKNWKVNKKL---------GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GD---IRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQ 2053
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I P  + VN D+SC YK     +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GDIL ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP  +    P       I     +  N +   L            ++++ V + L         G+VSGV+ L +K      ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP    +L+ + + +FY+PHG++   DG Y W+TDVA HQV +   R       + P +VLG+   PG D NHFC+P+ VAV+ S G VFV+DGYCN+R+V F P+G +I +W  +            + HS+ +          N + VADREN +I  F  D       I   S   +++ I Y P    ++ +      GD   ++G  F  N +S ++    KP      F  PHD+  +++G  +++ + H   V KF +        H+
Sbjct:   63 LDIRMPGVTPKESDTYFCMSMRLPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKHAVSFMTCTQNVAPDMFRTIPEEANIPIPVKSDMVMIHGHHKETENKEKSALIQQPKQGEEEAFEQDFHVEEALEWPGVYLLPGQVSGVA-LDSKN-----NLVIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNKAEILQSSGKNLFYLPHGLSIDTDGNY-WVTDVALHQVFKLEPRS-----KEGPLLVLGRSMQPGSDQNHFCQPTDVAVEPSTGAVFVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPKPGQFSVPHSLALVPH------LNQLCVADRENGRIQCFKTDTKEFVREIKHASFGRNVFAISYIPG--FLFAVNGKPYFGDQEPVQG--FVMNFSSGEIIDVFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTESRLEVEHR 715          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 201.445 bits (511), Expect = 4.686e-53
Identity = 114/291 (39.18%), Postives = 156/291 (53.61%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM--MVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I P  + VN D+SC YK     +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GDIL ARC+F   G+   T IG T  DEMCN YIM  M  K+     SF  C  N   D+++ IP
Sbjct:   63 LDIRMPGVTPKESDTYFCMSMRLPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHA---VSFMTCTQNVAPDMFRTIP 346          

HSP 2 Score: 155.992 bits (393), Expect = 1.947e-38
Identity = 108/330 (32.73%), Postives = 166/330 (50.30%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQ 2053
            G+VSGV+ L +K      ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP    +L+ + + +FY+PHG++   DG Y W+TDVA HQV +   R       + P +VLG+   PG D NHFC+P+ VAV+ S G VFV+DGYCN+R+V F P+G +I +W  +            + HS+ +          N + VADREN +I  F  D       I   S   +++ I Y P    ++ +      GD      F  N +S ++    KP      F  PHD+  +++G  +++ + H   V KF +        H+
Sbjct:  515 GQVSGVA-LDSKN-----NLVIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNKAEILQSSGKNLFYLPHGLSIDTDGNY-WVTDVALHQVFKLEPRS-----KEGPLLVLGRSMQPGSDQNHFCQPTDVAVEPSTGAVFVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPKPGQFSVPHSLALVP------HLNQLCVADRENGRIQCFKTDTKEFVREIKHASFGRNVFAISYIPG--FLFAVNGKPYFGDQEPVQGFVMNFSSGEIIDVFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTESRLEVEHR 821          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Mouse
Match: Pam (peptidylglycine alpha-amidating monooxygenase [Source:MGI Symbol;Acc:MGI:97475])

HSP 1 Score: 201.445 bits (511), Expect = 4.751e-53
Identity = 114/291 (39.18%), Postives = 156/291 (53.61%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM--MVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I P  + VN D+SC YK     +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GDIL ARC+F   G+   T IG T  DEMCN YIM  M  K+     SF  C  N   D+++ IP
Sbjct:   63 LDIRMPGVTPKESDTYFCMSMRLPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNSDISCHYK-MYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHA---VSFMTCTQNVAPDMFRTIP 346          

HSP 2 Score: 155.992 bits (393), Expect = 2.002e-38
Identity = 108/330 (32.73%), Postives = 166/330 (50.30%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQ 2053
            G+VSGV+ L +K      ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP    +L+ + + +FY+PHG++   DG Y W+TDVA HQV +   R       + P +VLG+   PG D NHFC+P+ VAV+ S G VFV+DGYCN+R+V F P+G +I +W  +            + HS+ +          N + VADREN +I  F  D       I   S   +++ I Y P    ++ +      GD      F  N +S ++    KP      F  PHD+  +++G  +++ + H   V KF +        H+
Sbjct:  515 GQVSGVA-LDSKN-----NLVIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNKAEILQSSGKNLFYLPHGLSIDTDGNY-WVTDVALHQVFKLEPRS-----KEGPLLVLGRSMQPGSDQNHFCQPTDVAVEPSTGAVFVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPKPGQFSVPHSLALVP------HLNQLCVADRENGRIQCFKTDTKEFVREIKHASFGRNVFAISYIPG--FLFAVNGKPYFGDQEPVQGFVMNFSSGEIIDVFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTESRLEVEHR 821          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Mouse
Match: Dbh (dopamine beta hydroxylase [Source:MGI Symbol;Acc:MGI:94864])

HSP 1 Score: 97.0561 bits (240), Expect = 3.178e-20
Identity = 77/283 (27.21%), Postives = 126/283 (44.52%), Query Frame = 2
Query:  137 EKLKLQMPGVLAMNNDE-YICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCSSPFSTEPSF--PCRSICE----NSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTI---EDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRKVNLDVSCRYKGNSEA------YTLAFRTHAHALGRSISGYKVSLNDGQ-IELIGKGN---PQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYI 907
            + + ++ P +L  +N+  Y C    +P      +I+ YE +    N ++ HHM +F C++     P F  PC S  +    N    +L  WA  AK+F+YP   G+  GG  +  +  L+VHY  P  I   +D SG+ L  ++    Y  GI    L+++    I PQ     L   C  K    A      +  A + H H  GR +    V   DGQ  +++ + N   P + +       V + PGD+L+  C +++  K   T  G   ++EMC  Y+
Sbjct:  216 QTMDIRAPDILIPDNETTYWCYITELPPRFPRHHIIMYEAIVTEGNEALVHHMEVFQCAAESEDFPQFNGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPKEAGVPFGGPGSSPFLRLEVHYHNPRKIQGRQDSSGIRLHYTATLRRYDAGIMELGLVYTPLMAIPPQETAFVLTGYCTDKCTQMALQDSGIHIFASQLHTHLTGRKV--VTVLARDGQERKVVNRDNHYSPHFQEIRMLKKVVTVYPGDVLITSCTYNTENKTLATVGGFGILEEMCVNYV 496          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Mouse
Match: Moxd2 (monooxygenase, DBH-like 2 [Source:MGI Symbol;Acc:MGI:2388042])

HSP 1 Score: 77.0258 bits (188), Expect = 5.166e-14
Identity = 75/309 (24.27%), Postives = 134/309 (43.37%), Query Frame = 2
Query:  164 VLAMNNDEYICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCSSP----------FSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHY---LKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQ--PQTRKVNLDVS-CRYKG--------NSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKG-----NPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFY-----------------IMMVTKNTGEENS 943
            ++  ++  Y C+  P+P  ++  +I  +EP+    N ++ HH+L++ C +           + ++P+F   S+C  SH  ++ GWA    S+ +P + G+++G   +  +  L++HY        I D SG+ L  +S    Y +G+  L      I   P   +  L    C+            S+ Y  A   H H  GRS+   +   N  Q++++ K      N Q  +       V IKPGD L+  C + +  +D +T  G++ ++EMC  +                 I+ VT   GEE S
Sbjct:  201 IIPEDDTTYACTFLPLPIVSKKHHIYKFEPILVERNETMVHHVLVYACGNSSVLPTGIGECYGSDPAF---SLC--SH--VIAGWAVGGLSYQFPDDVGISIGTPFDPQWIRLEIHYSNFQNLPGIRDTSGMRLFYTSHLRKYDMGVLQLGISVFPIHFIPPGAEAFLSYGLCKTDKFEELNGAPVSDIYISACLLHTHLAGRSLQALQYR-NGTQLQVVCKDFSYDFNLQESRDL--PHPVVIKPGDELLIECHYQTLDRDFMTFGGASTINEMCLIFFFYYPRINISSCMGYPDIIYVTNELGEEAS 499          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. UniProt/SwissProt
Match: sp|P08478|AMDA_XENLA (Peptidyl-glycine alpha-amidating monooxygenase A OS=Xenopus laevis OX=8355 GN=pam-a PE=1 SV=3)

HSP 1 Score: 363.999 bits (933), Expect = 2.724e-110
Identity = 233/670 (34.78%), Postives = 339/670 (50.60%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNP----------------PSKTIS---AKTLQNYNFDIDV-LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG---IIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L ++MPGV    +D Y+C S+ +P  +E +Y+V + P AN   AHHMLLFGC+ P ST+  + C +        I++ WA++A     P   G  VGGKS   YFVLQVHY      +DK    +G+ + ++ +    + GI+L  S    I P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     V+I PGDI+  RCLF   G+ S T IG T  DEMCN YIM    +     S+  C       L++NIP  +    P +P                P K       K  +    D DV L+ D +W  VN K+G+VSG+++          ++ + HRG H W E SF ++ VYQ+    PI + TI+ VDP S  VL+   + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLG+ F PG D  HFC+P+ VAVD   G  FVADGYCN+R++ F PNG +I +W  +            I HS+T+  D+        + VADREN +I  F  +    + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+  AD+G  ++V + H   V KF
Sbjct:   60 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDFRPHANMDTAHHMLLFGCNIPSSTDDYWDCSAGTCMDKSSIMYAWAKNAPPTKLPEGVGFRVGGKSGSRYFVLQVHYGNVKAFQDKHKDCTGVTVRVTPEKQPQIAGIYLSMSVDTVIPPGEEAVNSDIACLYN-RPTIHPFAYRVHTHQLGQVVSGFRV--RHGKWSLIGRQSPQLPQAFYPVEHPVEISPGDIIATRCLFTGKGRTSATYIGGTSNDEMCNLYIMYYM-DAAHATSYMTCVQTGEPKLFQNIPEIANVPIPVSPDMMMMMGHGHHHTEAEPEKNTGLQQPKREEEEVLDQDVHLEEDTDWPGVNLKVGQVSGLALDPKN------NLAIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPSSSKVLKSTGKNLFFLPHGLTIDRDGNY-WVTDVALHQVFKLGAGKE------TPLLVLGRAFQPGSDRKHFCQPTDVAVDPITGNFFVADGYCNSRIMQFSPNGMFIMQWGEETSSNVPRPGQFRIPHSLTMVPDQGQ------LCVADRENGRIQCFHAETGNFVKQIKHQEFGREVFAVSYAPGGVLYAVNGKPYYGYSA--PVQGFMLNFSNGDILDTFIPARKNFDMPHDIAAADDGT-VYVGDAHANAVWKF 702          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. UniProt/SwissProt
Match: sp|P12890|AMDB_XENLA (Peptidyl-glycine alpha-amidating monooxygenase B OS=Xenopus laevis OX=8355 GN=pam-b PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 3.437e-109
Identity = 230/672 (34.23%), Postives = 343/672 (51.04%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNP-----------------PSKTISA----KTLQNYNFDIDV-LKMDKNWK-VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDS-RGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGY---DGIIKFTH------IFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKF 2017
            L ++MPGV    +D Y+C S+ +P  +E +Y+V Y P AN   AHHMLLFGC+ P ST+  + C +   N    I++ WA++A     P   G  VGGKS   YFVLQVHY      +DK    +G+ + ++ +    + GI+L  S    + P    VN D++C Y      +  A+R H H LG+ +SG++V    G+  LIG+ +PQ PQ FY     ++I PGDI+  RCLF   G+ S T IG T  DEMCN YIM    +     S+  C       L++NIP  +    P +P                  ++T +A    K  +    + DV L+ D +W  VN K+G+VSG+++          ++++ HRG H W E SF ++ VYQ+    PI + TI+ VDP +  VL+   + +F++PHG+T  +DG Y W+TDVA HQV +     +      TP +VLG+ F PG D  HFC+P+ VAVD   G  FVADGYCN+R++ F PNG +I +W  +            I HS+T+  D+        + VADREN +I  F     + + +  H      +F  S +  G+ Y    +  YG ++   ++G    F+             +F  PHD+   D+G  ++V + H   V KF
Sbjct:   62 LDIRMPGVTPTESDTYLCKSYRLPVDDE-AYVVDYRPHANMDTAHHMLLFGCNVPSSTDDYWDCSAGTCNDKSSIMYAWAKNAPPTKLPEGVGFQVGGKSGSRYFVLQVHYGDVKAFQDKHKDCTGVTVRITPEKQPLIAGIYLSMSLNTVVPPGQEVVNSDIACLYN-RPTIHPFAYRVHTHQLGQVVSGFRV--RHGKWTLIGRQSPQLPQAFYPVEHPLEISPGDIIATRCLFTGKGRMSATYIGGTAKDEMCNLYIMYYM-DAAHATSYMTCVQTGNPKLFENIPEIANVPIPVSPDMMMMMMMGHGHHHTEAEAETNTALQQPKREEEEVLNQDVHLEEDTDWPGVNLKVGQVSGLALDPKN------NLVIFHRGDHVWDENSFDRNFVYQQRGIGPIQESTILVVDPNTSKVLKSTGQNLFFLPHGLTIDRDGNY-WVTDVALHQVFKVGAEKE------TPLLVLGRAFQPGSDRKHFCQPTDVAVDPITGNFFVADGYCNSRIMQFSPNGMFIMQWGEETSSNLPRPGQFRIPHSLTMISDQGQ------LCVADRENGRIQCFHAKTGEFVKQIKHQEFGREVFAVSYAPGGVLYAVNGKPYYGDST--PVQGFMLNFSNGDILDTFIPARKNFEMPHDIAAGDDGT-VYVGDAHANAVWKF 706          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. UniProt/SwissProt
Match: sp|P83388|AMDL_CAEEL (Probable peptidyl-glycine alpha-amidating monooxygenase pamn-1 OS=Caenorhabditis elegans OX=6239 GN=pamn-1 PE=1 SV=2)

HSP 1 Score: 238.039 bits (606), Expect = 1.956e-66
Identity = 194/649 (29.89%), Postives = 309/649 (47.61%), Query Frame = 2
Query:  137 EKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICE-NSHEKILFGWARDAKSFHYPSNTGMAVGGKSN-INYFVLQVHYLKP--TTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECG--GNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDLD-SPISDYTIVEVDPVSGN---VLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGII-------KFTHIFRKSLSIYGIKYNPKNRLIYGITSDG--DIRGSS------FTFNTTS----SQMKPWNTDYSFRAPHDLCLADNGKFIFVAEL 1993
            +K  +QM G      D+Y+  S          Y+V++EP+A++   HHMLL+GC+ P S +  +     C       IL+ WAR+A +   P +   +VG + + I YFVLQVHY +P    + D SG+ + +S K P  +  + +LF     I PQ      +++C ++ ++  +  AFRTH HA+GR +S +    +DG    IGK NPQWPQ F    +++ I  GD + A C FDS  K+    +G+  +DEMCNFY MM   +   +N + +      ++     + P    E  P  P  +  + ++     F I    + +N     KLG+V+G++    +Q      +LV  R    W   +F  D Y   LD  PI+D  I+ +   SGN   + R+   G FY+PHGI   KDG +++ TDV  H V ++ + + ++L +   S   G+  +PG D +H+CKP+ +       ++V DGYCN+RVV    NG  I ++    P        +  D   D +  ++ V DREN ++      G +        FT+I+  + S     +    R I G  ++G     G S      + F  T+     QM P      F  PH L +  +G  IFV ++
Sbjct:   33 QKFTIQMIGYSPQKTDDYVAVSIEA----TPGYVVAFEPMAHADRVHHMLLYGCTMPASEQGFWRGMETCGWGGGSYILYAWARNAPNLVLPKDVAFSVGHEQDGIKYFVLQVHYAQPFAGEVHDFSGVTMHISQKKPMNLAAV-MLFVSGTPIPPQLPAFQNNITCMFESSTPIHPFAFRTHTHAMGRLVSAF--FKHDGHWTKIGKRNPQWPQLFEGIPSKLMIGSGDQMSASCRFDSMDKNRTVNMGAMGVDEMCNFY-MMFHYDAKLDNPYPQGAICAKDYPSKMIDYPKDGFELLPSRPELEHHAHQS--KVPFGIVQEAIHENLG-GVKLGQVAGLAFNNEQQ------LLVFQRAGRVWDASTF--DNYNILLDKKPIADPVILVIS-YSGNQTKLERKLGGGQFYLPHGIYVDKDG-FVYTTDVGSHTVAKWKI-EGNELKNIWTS---GELLMPGSDQHHYCKPTGI-TRVEDQLYVTDGYCNSRVVVLDLNGKRIRQFGL--PGEDAGQFNLPHDIVSDSAGRLL-VTDRENGRVQHMTTQGHVIEEFKSTMFTNIYSAA-SHEDYVFMVPGRPIMGHETEGIAVFVGRSGTGLIEYAFGPTTKGKREQMGP-----QFGQPHCLRVCPDGGHIFVGDI 646          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. UniProt/SwissProt
Match: sp|P10731|AMD_BOVIN (Peptidyl-glycine alpha-amidating monooxygenase OS=Bos taurus OX=9913 GN=PAM PE=1 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 6.850e-53
Identity = 115/291 (39.52%), Postives = 157/291 (53.95%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM--MVTKNTGEENSFSECGGNEFKDLWKNIP 994
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ L L+  P   + G++L+ S    I P  + VN D+SC YK     +  A+R H H LG+ +SGY+V   +GQ  LIG+ +PQ PQ FY     V +  GDIL ARC+F   G+  VT IG T  DEMCN YIM  M  K+     SF  C  N   D+++ IP
Sbjct:   59 LDIRMPGVTPKQSDTYFCMSVRLP-MDEEAFVIDFKPRASMDTVHHMLLFGCNMPASTGNYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPPGGKVVNSDISCHYK-KYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTHIGGTSSDEMCNLYIMYYMEAKHA---VSFMTCTQNVAPDIFRTIP 342          

HSP 2 Score: 152.525 bits (384), Expect = 1.648e-36
Identity = 111/333 (33.33%), Postives = 170/333 (51.05%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEW------QSQDP--MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITS------DGDIRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQH 2056
            G+VSGV+  L  Q  L    ++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  VL+ + + +FY+PHG++  KDG Y W+TDVA HQV + + +       + P + LG+   PG D NHFC+P+ VAVD   G ++V+DGYCN+R+V F P+G +I +W       S  P    + HS+ +            + VADREN +I  F  D       I   S   +++ I Y P   L++ +           ++G  F  N +S ++    KP      F  PHD+  +++G  ++V + H   V KF     +ST+  +H
Sbjct:  512 GQVSGVA--LDPQNNL----VIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNY-WVTDVALHQVFKLDPKS-----KEGPLLTLGRSMQPGSDQNHFCQPTDVAVDPDTGTIYVSDGYCNSRLVQFSPSGKFITQWGEASLESSPKPGQFRVPHSLALVP------PLGQLCVADRENGRIQCFKTDTKEFVREIKHPSFGRNVFAISYIPG--LLFAVNGKPYFEDQEPVQG--FVMNFSSGEIIDVFKP--VRKHFDMPHDIAASEDGT-VYVGDAHTNTVWKF-----TSTEKMEH 814          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. UniProt/SwissProt
Match: sp|P14925|AMD_RAT (Peptidylglycine alpha-amidating monooxygenase OS=Rattus norvegicus OX=10116 GN=Pam PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.965e-52
Identity = 112/290 (38.62%), Postives = 156/290 (53.79%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPS 997
            L ++MPGV    +D Y C S  +P  +E ++++ ++P A+    HHMLLFGC+ P ST   + C          IL+ WAR+A     P   G  VGG++   YFVLQVHY   +   D     SG+ + L+  P   + G++L+ S    I P  + VN D+SC+YK     +  A+R H H LG+ +SGY+V   +GQ  LIG+ NPQ PQ FY     V +  GDIL ARC+F   G+   T IG T  DEMCN YIM   +      SF  C  N   D+++ IP+
Sbjct:   64 LDIRMPGVTPKESDTYFCMSMRLPV-DEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYK-MYPMHVFAYRVHTHHLGKVVSGYRV--RNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYME-AKYALSFMTCTKNVAPDMFRTIPA 348          

HSP 2 Score: 152.91 bits (385), Expect = 1.244e-36
Identity = 104/323 (32.20%), Postives = 166/323 (51.39%), Query Frame = 2
Query: 1124 GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVD-SRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDP--------MFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSD---GDIRG-SSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAK 2032
            G+VSGV+ L +K      ++++ HRG H W   SF  K VYQ+    PI + TI+ +DP +  +L+ + + +FY+PHG++   DG Y W+TDVA HQV + +         + P ++LG+   PG D NHFC+P+ VAV+ S G VFV+DGYCN+R+V F P+G ++ +W  +            + HS+ +          + + VADREN +I  F  D       I   S   +++ I Y P    ++ +      GD      F  N +S ++    KP      F  PHD+  +++G  +++ + H   V KF +  K
Sbjct:  515 GQVSGVA-LDSKN-----NLVIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNNAEILQSSGKNLFYLPHGLSIDTDGNY-WVTDVALHQVFKLDPHS-----KEGPLLILGRSMQPGSDQNHFCQPTDVAVEPSTGAVFVSDGYCNSRIVQFSPSGKFVTQWGEESSGSSPRPGQFSVPHSLALVP------HLDQLCVADRENGRIQCFKTDTKEFVREIKHASFGRNVFAISYIPG--FLFAVNGKPYFGDQEPVQGFVMNFSSGEIIDVFKP--VRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEK 814          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. TrEMBL
Match: A0A1S3I9G3 (peptidyl-glycine alpha-amidating monooxygenase isoform X2 OS=Lingula unguis OX=7574 GN=LOC106162187 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 4.494e-126
Identity = 248/678 (36.58%), Postives = 356/678 (52.51%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKN--IPSY-SMEFDPPNPPSKTISAKTLQNYNFDID----------VLKMDKNWK--VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF--IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMF------------IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFT-HIFRKSLSIYGIKYNPK-NRLIYGITSDG----DIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGN 2068
            L + MPG+     D Y+C+S PVP   EN YIV +EPLA+  +AHHML+FGC  P     S+ C   C      ILF WA++A   + P + G  +GG SN+ + VLQ+HY  PT   D SG+ L  + +    + GI LL S    I P   +   D+SC++K ++  Y   FRTHAH+LG+ I+GY+    +G   LIGKGNPQWPQ FY    +++I   DIL+ RC+FDST KD+ T IG TH DEMCNFY+M  T   G +  F EC GN   D++KN   PS  S+   PPNP  +  +       +   D           L+  KNW    N KLG+V+GV+           +V + HR    W   +F  + + Y +    PI+  TI+  +P +G ++++  + +FY+PHG++   D   +W+TDVA HQV +FN  ++       PS+ LGK F PG D  HFCKP+ VA+   G  FV+DGYCN+R++ +  +G+ I+ W + D               + H +T+ +D      K  V VADREN +I  F YDG  K   H+      +Y + Y P    L+Y I +D     +  G +  F+T   Q   W     F  PHD+ ++ +GK ++VAE+   +V KF           Q  +GN
Sbjct:   40 LDVTMPGITPKVEDYYVCTSVPVPT-GEN-YIVQFEPLASGDMAHHMLMFGCEQPAENRKSWECGQTCRGK-PNILFAWAKNAPPTNLPEDVGFKIGGSSNVRHIVLQIHYKNPTKEPDASGVRLHYTPERQKNIAGIALLLSTQISIPPHQPETISDISCQFKSSTPIYPFGFRTHAHSLGKVITGYQF---NGTYHLIGKGNPQWPQAFYPVKDKIKISNNDILLGRCVFDSTHKDTYTSIGPTHNDEMCNFYMMYYTDANGGQ-PFYECFGNWRPDMFKNGGFPSQESLTALPPNPALEEEAEHGHSRVDSKADDKLDEEKLTPALEAVKNWPDLGNVKLGQVAGVATDSKG------NVHIFHRADRVWDYSTFDPVNNQYLQRNRGPITQDTILSFNP-NGKLIKQWGKNLFYLPHGLS-IDDQDNIWVTDVAMHQVFKFNKGEEK------PSLTLGKEFEPGNDRYHFCKPTDVAILPTGEFFVSDGYCNHRIIKYAADGSVIKSWGTIDGELAADKYPKPGAFKLPHGLTLAKD------KKQVCVADRENGRIQCFDYDGNFKSQIHLTEFGHKVYAVAYTPHFGGLMYAINADQSNPEENEGFTIKFDTGKLQ-DTWKPQGGFSRPHDVAVSPDGKCVYVAEIGSNRVWKFHSTFDVGIHKSQKKMGN 689          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. TrEMBL
Match: A0A267DQ57 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016756g3 PE=4 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 6.620e-126
Identity = 262/770 (34.03%), Postives = 395/770 (51.30%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVP-NHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPS--FPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKS-AQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGN------EFKDLWKNIPSYSMEFDPPN-------------PPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDL---DSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMFIV-HSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMK-PWNTDYSFRAPHDLCLADNGKFIFVAELHLK-KVIKFEIA---AKSSTKHHQHSVGNNFNQIHDMVKQINPVYIGVLMVAVTVFILICIVTMKYYRRCQXXXXXXXXXX------XXXXDKEGFKPLTQEDDGNDDGNSDPETEEYPALRG 2332
            LK++MPG    ++D Y+CSS  VP N  +  YIV ++ L++ S+AHH+LL+GC  P   EP     C  IC +   KI++ WAR+A     P+NTG  +GG S+I Y V+QVHYL   +  D+S + L+LSS+P  +  GIFL+ +Y G IQP  +   LDVSC+Y G+SE    AFRTHAHAL R+I GY++S +   ++ IG+ +PQW Q FY +   + I+ GD L ARC++D+TG+     IGSTH DEMCNFYIM  T    +      CGG       E + LW+ IP  S+++ P                P K +                 D      ++LG++SGV+     +      V V HRG+  W   +F  D    D    +  I++ T++E+D  SG V+    RG+F+MPH +     G + WITDV  HQV++F+        D  P + +G R  P      FC+P+     S G VFVADGYCN+RVV   P+G++  E+QS D + +V HS+ + E      +  +V VADRE  ++  + ++          K    S+Y + Y+P+ R +Y ++  G       T + TS  ++  W    SF  PH + +A  G  + VAE+ +  ++ KF ++   A+S++  H         +   +V+      +  L++ + + +++  V +   RR  SG     R           +D+EGF+PLTQED       SD E E  P   G
Sbjct:   36 LKVEMPGAAPTHDDSYLCSSTKVPANAGKELYIVGFQALSDMSVAHHVLLYGCQRP-QVEPGKVGDCGGICSSGGSKIVYAWARNAPELRLPANTGFVIGGASSIQYIVIQVHYLHGRSQPDRSAVNLQLSSRPQPFTAGIFLMMAYSGSIQPGAQHATLDVSCKYSGSSEMRPFAFRTHAHALSRAIVGYRLSPDLQDVQEIGRASPQWAQAFYPARPGISIRNGDYLAARCVYDATGETQAHHIGSTHNDEMCNFYIMFSTPAGAKLGDIFSCGGGGPDASTESRRLWRKIPQDSLDYLPSEAPADAFAYAAKATAPRKGVPHPPPAAAAAHKVAAVPDWPRPGGRQLGQISGVAAGPDGR------VFVFHRGARVWGPGAFDPDNRLSDALQSEGAINEDTVLELD-ASGGVISGWGRGVFFMPHSLHIDAQGNF-WITDVGLHQVLKFSP-------DHKPLLTVGVRLTPADGKRGFCQPADAVTSSAGDVFVADGYCNHRVVMLGPDGSFKREFQSADGVLVVPHSLALIE------ADRLVCVADRERARVECWNWETGRSERRFASKEFGDSVYAVAYSPEARQMYAVSGSGH----GLTVDPTSGAVRQAWG---SFTRPHAMAVAAGGAALLVAEIQVPGRLWKFSVSGLTAQSNSPDHFAGQRTVHERALVLVRDSQASLLIGLLLLLPLLVVVLAVALLKLRRRDSGRIGAGRKSLLGGGPGGIRDREGFQPLTQED-------SDEEAETGPGAGG 769          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. TrEMBL
Match: A0A1S3IAE2 (peptidyl-glycine alpha-amidating monooxygenase A isoform X1 OS=Lingula unguis OX=7574 GN=LOC106162187 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.420e-125
Identity = 246/670 (36.72%), Postives = 355/670 (52.99%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKN--IPSY-SMEFDPPNPPSKTISAKTLQNYNFDID----------VLKMDKNWK--VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF--IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMF------------IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFT-HIFRKSLSIYGIKYNPK-NRLIYGITSDG----DIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTK 2044
            L + MPG+     D Y+C+S PVP   EN YIV +EPLA+  +AHHML+FGC  P     S+ C   C      ILF WA++A   + P + G  +GG SN+ + VLQ+HY  PT   D SG+ L  + +    + GI LL S    I P   +   D+SC++K ++  Y   FRTHAH+LG+ I+GY+    +G   LIGKGNPQWPQ FY    +++I   DIL+ RC+FDST KD+ T IG TH DEMCNFY+M  T   G +  F EC GN   D++KN   PS  S+   PPNP  +  +       +   D           L+  KNW    N KLG+V+GV+           +V + HR    W   +F  + + Y +    PI+  TI+  +P +G ++++  + +FY+PHG++   D   +W+TDVA HQV +FN  ++       PS+ LGK F PG D  HFCKP+ VA+   G  FV+DGYCN+R++ +  +G+ I+ W + D               + H +T+ +D      K  V VADREN +I  F YDG  K   H+      +Y + Y P    L+Y I +D     +  G +  F+T   Q   W     F  PHD+ ++ +GK ++VAE+   +V KF     + T+
Sbjct:   40 LDVTMPGITPKVEDYYVCTSVPVPT-GEN-YIVQFEPLASGDMAHHMLMFGCEQPAENRKSWECGQTCRGK-PNILFAWAKNAPPTNLPEDVGFKIGGSSNVRHIVLQIHYKNPTKEPDASGVRLHYTPERQKNIAGIALLLSTQISIPPHQPETISDISCQFKSSTPIYPFGFRTHAHSLGKVITGYQF---NGTYHLIGKGNPQWPQAFYPVKDKIKISNNDILLGRCVFDSTHKDTYTSIGPTHNDEMCNFYMMYYTDANGGQ-PFYECFGNWRPDMFKNGGFPSQESLTALPPNPALEEEAEHGHSRVDSKADDKLDEEKLTPALEAVKNWPDLGNVKLGQVAGVATDSKG------NVHIFHRADRVWDYSTFDPVNNQYLQRNRGPITQDTILSFNP-NGKLIKQWGKNLFYLPHGLS-IDDQDNIWVTDVAMHQVFKFNKGEEK------PSLTLGKEFEPGNDRYHFCKPTDVAILPTGEFFVSDGYCNHRIIKYAADGSVIKSWGTIDGELAADKYPKPGAFKLPHGLTLAKD------KKQVCVADRENGRIQCFDYDGNFKSQIHLTEFGHKVYAVAYTPHFGGLMYAINADQSNPEENEGFTIKFDTGKLQ-DTWKPQGGFSRPHDVAVSPDGKCVYVAEIGSNRVWKFHSTFDAQTQ 681          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. TrEMBL
Match: A0A210PFJ8 (Peptidyl-glycine alpha-amidating monooxygenase B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15005 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.122e-124
Identity = 272/722 (37.67%), Postives = 383/722 (53.05%), Query Frame = 2
Query:   80 MLNLRDLFMFLVVIYLANGE---KLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFST--EPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLK------PTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDP-------------------------PNPPSKTI--SAKTLQNY-NFDIDVLKMDKNWK------VNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSF-IKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKY-LWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQS------------QDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDG-IIKFTHIFRKSLSIYGIKYNP-KNRLIYGI------TSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSST 2041
            ML +  L  F     +A  +    + L+M  V    +D+YIC+S+ +P +   SYIV +EPLAN++ AHH+LLFGCS PF+T  E ++ CR IC    E+ILF WAR+A     P + G  VGG S + + V+Q+HY K      PT   D+SG+ L L+ +   Y  GIFLL +Y   I P T+KV+ D+SC +  +   Y   FR HAH+LGR I+GY V+   GQ ++IGKGNPQWPQ+FY  S +V IKPGD L+ RC ++STG+   T IG T  DEMCNFYIM   K    +  F +C GN    L  N+P  S    P                         PN   K    S   LQ+Y NF  D +  DK         ++  +G+V GV+       K G  V V HRG+  W   SF  ++V+Q+   SPI   TI+  D  S ++LR+  + IFYMPHGIT   D  Y +W+TDV  HQVM F    D       P++ LG +F PG D +HFCKP+ VAV S G  FVADGYCN+R++ F  +GT+I+ + +            +    I HS+T+ ED      K ++ VADREN +I  F ++G   K  H       ++ I+Y P  + L++ +       S   +RG     N T +  + WNT    + PHD+ +  +   ++V EL+  KV +F++  +S +
Sbjct:    8 MLVVLSLVTFATAQSIAPSKVDSMMDLRMKNVSVNKDDQYICTSYRMPVNE--SYIVQFEPLANANTAHHILLFGCSEPFNTQEEGAWSCRMICR-GEEQILFAWARNAPELVLPPDVGFKVGGASKVKHIVVQIHYAKALPSFRPT---DQSGIRLHLTQQRQRYEAGIFLLLAYSLTIPPNTKKVSADISCGFTASGNIYPFGFRAHAHSLGRVITGYHVN-KAGQYKMIGKGNPQWPQSFYPVSNKVVIKPGDKLVGRCTYNSTGRMKTTVIGPTAGDEMCNFYIMYY-KEVSTQIPFPQCVGNNVPSLITNLPPGSDVQLPYNATLEAAAHGHRSHMQGHEDSDVAPNTIDKPTDGSKPGLQHYVNFQSDFMS-DKAMSSSSVSGLDYPIGQVGGVAT----DNKGG--VYVFHRGNRVWDGSSFNFQNVFQQQT-SPIEQETIITYDKDS-HILRKFGKNIFYMPHGITV--DQNYNIWVTDVGLHQVMMFPAGSDQ------PNLTLGVKFQPGSDNSHFCKPTDVAVLSTGEFFVADGYCNSRIMKFSKDGTFIKSFGNGLMTIQADGFPPEGSFDIPHSLTVAED------KGLLCVADRENGRIQCFDFNGNFQKQIHPAEFGPRLFAIEYCPLHDGLLFAVNGPPLDNSQTTVRGFIIDIN-TGTLSETWNTQDGLKNPHDVAVDPHNLRVYVGELNPNKVWRFDMMGESGS 697          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. TrEMBL
Match: V4A092 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_128636 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 5.744e-123
Identity = 246/676 (36.39%), Postives = 362/676 (53.55%), Query Frame = 2
Query:  182 DEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCS-SPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNP------------------------------PSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQ--EDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMF-------------IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRK---SLSIYGIKYNPKNR----LIYGITSDG-DIRGSSFTFN-TTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSST 2041
            D YIC+S+ +P   +  YIV +E LAN+S AHH+LLFGCS  P  T P++ C  +C+ S E+I+F WA++A     P + G  VGG S I   VLQ+HY   +   D+SG+ + ++ +   YV GIFL+ SY   I P    V+ DVSC+Y G +E +  A+RTHAH LG  I+GY+    +    +IGKGNPQWPQ FY  + ++ +KPGD ++ARC ++ST +D+ T IG T  DEMCNFY M  T +   E +F +CGG+++ ++   +P+ S    PPNP                               S+        +Y FD      ++ W    +LG+VSGV+       K G +V + HRGS  W   SF  D Y       + I + TI+  D   G ++R     +F+MPHG++   D   +W+TDVA HQ MRF    D       P ++LG+RF P  D NHFCKP+ +A+ S G  F++DGYCN RV+ F  +G +++++ +QD +F             + HSITI ED      KN+V VADREN +I  F ++G  KF+HI +       ++ I+Y P +      + G   DG +     FT +  T   ++ WN      +PHD+ +      ++VAEL  K V KF ++ K+ +
Sbjct:    1 DSYICASYEMPQ--DEVYIVKFEALANASTAHHILLFGCSDGPALTTPTWGCPPLCK-SREQIMFAWAKNAPPTVLPKDVGFRVGGGSTIRNIVLQIHYAHSSPYPDQSGIRVYVTRQKYKYVAGIFLMMSYSITIPPHKSVVHADVSCKYNGKTEIHPFAYRTHAHELGTVITGYQY---NKTYYMIGKGNPQWPQAFYPVTEKITVKPGDNMLARCTYNSTQRDTPTYIGPTGKDEMCNFYTMFYT-DASVETTFGQCGGSQYPEIVDQLPAGSDTRLPPNPLLDEMAGHHHHHPQAQTPPSTGTGNNNRLHQSRPYPGTDYPDYQFDHPANVNNQQWPTGHRLGQVSGVATG-----KNG-NVYIFHRGSRKWEWDSF--DAYNVFTLQTATIPEKTILVYD-KDGTLIRAFGENLFFMPHGLSV-DDNDNIWVTDVALHQAMRFPAGKDK------PDLILGERFKPESDENHFCKPTDIAILSTGEFFISDGYCNGRVMKFSADGKFLKQFGTQD-LFATDDGEPPNGAFDVPHSITIAED------KNLVCVADRENGRIQCFDFEG--KFSHIIKVKEFGSRLFAIEYTPLHDGMLFAVNGPVYDGVETVVQGFTVDIKTGKLLQSWNIPQGLNSPHDVAVNSVDHSVYVAELD-KVVWKFIMSHKAGS 643          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 370.933 bits (951), Expect = 3.358e-114
Identity = 241/682 (35.34%), Postives = 350/682 (51.32%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYN----FDIDVLKMDK-----------------NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW-------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNP-KNRLIYGITSD------GDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTK 2044
            + ++MPGV+   +D Y C + PVP   E +YIV + P A+   AHHMLL+GC +P ST+  + C   +  CE+   KI++ WAR+A     P + G  VGG + I YFVLQ+HY       D     SGL L ++SKP  ++ G++L+ S    I P     N D++C Y  +   Y  AFRTH H LG+ +SGY++   +GQ  LIG+ +PQ PQ FY  S  +++K GD L ARC+F   G+ S T IG T  DEMCNFY+M    N      + +C  +    L+++IP+   E + P P S       +   N     D   L+  K                 +W +V  +LG+VSG+++          ++++ HRG H W   SF  K VYQ+    PI   TI+ VDP  GNVL+ + + +FY+PHGIT  KD  Y W+TDVA HQV +      SK   + P +VLG+ F PG D +HFCKP+ VAVD   G +FV+DGYCN R++ F P G Y+ +W       + + P  I HS+    D      K  + VADREN ++  F  D       I R      +Y + Y P +  LIY +  +        +RG    ++T             F+ PHD+ +  +G  ++V +     VIKF  + K+  +
Sbjct:   60 VDIRMPGVVPSASDSYYCVAVPVPTSWE-AYIVDFVPHASMDTAHHMLLYGCRNPTSTKGYWDCGREQGTCED-EAKIMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFRDHHKDCSGLTLRMTSKPQPFIAGMYLMMSVDTVIPPGKTVTNADIACTYL-SYPMYPFAFRTHTHRLGKVVSGYRI--RNGQWTLIGRQSPQLPQAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNK-HSIPYMDCMDHGSSSLFRSIPN---EANVPIPVSPDHMMNMMHGSNQKDGEDGAALQQPKREQEEVLDQGTHLEELADWPEVELQLGQVSGLAVDSDD------NLVIFHRGDHRWEMNSFDNKAVYQQRSLGPIQQSTILVVDPSKGNVLKASGKNMFYLPHGITTDKDNNY-WVTDVALHQVFKL-----SKDGTEKPLLVLGEAFKPGSDKSHFCKPTDVAVDPETGNIFVSDGYCNTRILKFSPEGKYLSDWGAGSLDRRRRVPFQIPHSLAFVPD------KRELLVADRENGRVQCFMADTGEFVKEIKRDEFGGEVYAVSYAPVQGGLIYVVNGESPYGQSAPLRGFVLNYSTKEILDTFAPDTQKFKMPHDIVVTKDGS-VYVGDATSDSVIKFVPSEKAEHR 713          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 214.927 bits (546), Expect = 1.187e-57
Identity = 117/293 (39.93%), Postives = 168/293 (57.34%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPS 997
            + ++MPGV+   +D Y C + PVP   E +YIV + P A+   AHHMLL+GC +P ST+  + C   +  CE+   KI++ WAR+A     P + G  VGG + I YFVLQ+HY       D     SGL L ++SKP  ++ G++L+ S    I P     N D++C Y  +   Y  AFRTH H LG+ +SGY++   +GQ  LIG+ +PQ PQ FY  S  +++K GD L ARC+F   G+ S T IG T  DEMCNFY+M    N      + +C  +    L+++IP+
Sbjct:   60 VDIRMPGVVPSASDSYYCVAVPVPTSWE-AYIVDFVPHASMDTAHHMLLYGCRNPTSTKGYWDCGREQGTCED-EAKIMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFRDHHKDCSGLTLRMTSKPQPFIAGMYLMMSVDTVIPPGKTVTNADIACTYL-SYPMYPFAFRTHTHRLGKVVSGYRI--RNGQWTLIGRQSPQLPQAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNK-HSIPYMDCMDHGSSSLFRSIPN 346          

HSP 2 Score: 179.104 bits (453), Expect = 7.375e-46
Identity = 122/353 (34.56%), Postives = 177/353 (50.14%), Query Frame = 2
Query: 1100 NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW-------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNP-KNRLIYGITSD------GDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDMVKQ 2101
            +W +V  +LG+VSG+++          ++++ HRG H W   SF  K VYQ+    PI   TI+ VDP  GNVL+ + + +FY+PHGIT  KD  Y W+TDVA HQV +      SK   + P +VLG+ F PG D +HFCKP+ VAVD   G +FV+DGYCN R++ F P G Y+ +W       + + P  I HS+    D      K  + VADREN ++  F  D       I R      +Y + Y P +  LIY +  +        +RG    ++T             F+ PHD+ +  +G  ++V +     VIKF  + K+ T      V  N   IH  + Q
Sbjct:  502 DWPEVELQLGQVSGLAVDSDD------NLVIFHRGDHRWEMNSFDNKAVYQQRSLGPIQQSTILVVDPSKGNVLKASGKNMFYLPHGITTDKDNNY-WVTDVALHQVFKL-----SKDGTEKPLLVLGEAFKPGSDKSHFCKPTDVAVDPETGNIFVSDGYCNTRILKFSPEGKYLSDWGAGSLDRRRRVPFQIPHSLAFVPD------KRELLVADRENGRVQCFMADTGEFVKEIKRDEFGGEVYAVSYAPVQGGLIYVVNGESPYGQSAPLRGFVLNYSTKEILDTFAPDTQKFKMPHDIVVTKDGS-VYVGDATSDSVIKFVPSEKTET-----FVQANLKPIHKPLAQ 830          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Cavefish
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:103031431])

HSP 1 Score: 214.927 bits (546), Expect = 1.313e-57
Identity = 117/293 (39.93%), Postives = 168/293 (57.34%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPS 997
            + ++MPGV+   +D Y C + PVP   E +YIV + P A+   AHHMLL+GC +P ST+  + C   +  CE+   KI++ WAR+A     P + G  VGG + I YFVLQ+HY       D     SGL L ++SKP  ++ G++L+ S    I P     N D++C Y  +   Y  AFRTH H LG+ +SGY++   +GQ  LIG+ +PQ PQ FY  S  +++K GD L ARC+F   G+ S T IG T  DEMCNFY+M    N      + +C  +    L+++IP+
Sbjct:   60 VDIRMPGVVPSASDSYYCVAVPVPTSWE-AYIVDFVPHASMDTAHHMLLYGCRNPTSTKGYWDCGREQGTCED-EAKIMYAWARNAPPTKLPKDVGFKVGGDTRITYFVLQIHYGDIKNFRDHHKDCSGLTLRMTSKPQPFIAGMYLMMSVDTVIPPGKTVTNADIACTYL-SYPMYPFAFRTHTHRLGKVVSGYRI--RNGQWTLIGRQSPQLPQAFYPVSNDIEVKYGDTLAARCVFTGEGRSSKTRIGGTSNDEMCNFYMMYYMDNK-HSIPYMDCMDHGSSSLFRSIPN 346          

HSP 2 Score: 176.792 bits (447), Expect = 4.375e-45
Identity = 116/334 (34.73%), Postives = 171/334 (51.20%), Query Frame = 2
Query: 1100 NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW-------QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNP-KNRLIYGITSD------GDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTK 2044
            +W +V  +LG+VSG+++          ++++ HRG H W   SF  K VYQ+    PI   TI+ VDP  GNVL+ + + +FY+PHGIT  KD  Y W+TDVA HQV +      SK   + P +VLG+ F PG D +HFCKP+ VAVD   G +FV+DGYCN R++ F P G Y+ +W       + + P  I HS+    D      K  + VADREN ++  F  D       I R      +Y + Y P +  LIY +  +        +RG    ++T             F+ PHD+ +  +G  ++V +     VIKF  + K+  +
Sbjct:  502 DWPEVELQLGQVSGLAVDSDD------NLVIFHRGDHRWEMNSFDNKAVYQQRSLGPIQQSTILVVDPSKGNVLKASGKNMFYLPHGITTDKDNNY-WVTDVALHQVFKL-----SKDGTEKPLLVLGEAFKPGSDKSHFCKPTDVAVDPETGNIFVSDGYCNTRILKFSPEGKYLSDWGAGSLDRRRRVPFQIPHSLAFVPD------KRELLVADRENGRVQCFMADTGEFVKEIKRDEFGGEVYAVSYAPVQGGLIYVVNGESPYGQSAPLRGFVLNYSTKEILDTFAPDTQKFKMPHDIVVTKDGS-VYVGDATSDSVIKFVPSEKAEHR 816          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Cavefish
Match: moxd1 (monooxygenase DBH like 1 [Source:NCBI gene;Acc:103035147])

HSP 1 Score: 86.2705 bits (212), Expect = 6.337e-17
Identity = 70/275 (25.45%), Postives = 124/275 (45.09%), Query Frame = 2
Query:  188 YICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCSSPFST----------EPSFP-CRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKP---TTIEDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRKVNLDVSCRYKGNSEAY---------TLAFRTHAHALGRSISGYKVSLNDGQIELIGKG-NPQWPQTFYK----SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM 910
            Y C  + +P+  +  +I+  EPL    + ++ HH+LL+ C S  +            P+ P   + CE     ++F WA   + F YP + GM++G   +  Y ++++H+  P   T + D SGL L  + K   Y  G+    +  S Y  + P       +  C  +   E+            A   HAH  GR+I   +      Q+EL     + Q+   F +    S + QI PGD L+  C++++ G++++T  G +  +EMC  Y++
Sbjct:  232 YWCQMYKMPDVQQKHHIIRIEPLIQKGHENLVHHILLYQCDSSLNESELDLGHNCFHPNMPDSFTTCET----VIFAWAIGGEGFTYPPHVGMSIGTDIDPVYVLMEMHFDNPALQTDVVDSSGLRLFYTPKLRTYDAGVIETGVWVSLYHMLPPGMEDFITEGHCTQECLQESLESEMPSGVSVFAALLHAHLAGRAI---RTRHFRQQVELPPMALDDQFDFNFQEFQPLSPERQILPGDSLITECVYNTKGRNNMTWGGLSTRNEMCLSYLL 499          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Cavefish
Match: dbh (dopamine beta-hydroxylase (dopamine beta-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-990621-3])

HSP 1 Score: 73.9442 bits (180), Expect = 3.927e-13
Identity = 65/274 (23.72%), Postives = 117/274 (42.70%), Query Frame = 2
Query:  128 ANGEKLKLQMPGV-LAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFG-CSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTI---EDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRKVNLDVSCRYKGNSEA------YTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYI 907
            A+ + +++  PG+ +      Y C  + +P +   ++IV YE +  S   +  +  G C S         CR         +L  WA  A+ F+YP + G+ +GG+ +  +  L+VHY  P  I   +D SG+ L  +     +  GI    L+++    I P+     L   C       A      +  A + H H  GR++    V     ++E++ +         + S   Q+  GD L+ +C F++  ++  T  G   M+EMC  Y+
Sbjct:  207 ADVQSIEVLAPGITIPSQETTYWCHIYQLPANMPKNHIVMYESVVTS--GNEAIYSGSCDSKMKPANLNYCR--------HVLAAWALGAEPFYYPMDAGLPIGGEGSSRFLRLEVHYHNPLIISGRQDSSGIRLWYTRSLRRFDAGIMELGLVYTPVMAIPPRQSSFPLSGYCIPACTRTALPQGGIHIFASQLHTHLAGRTVRTVLVR-GGKEVEVVQEDK-------HYSTHYQVLHGDALVTKCTFNTEDRNKPTVGGFGIMEEMCVNYV 462          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003037.1 (pep scaffold:Pmarinus_7.0:GL480308:28740:39707:1 gene:ENSPMAG00000002773.1 transcript:ENSPMAT00000003037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 2.709e-52
Identity = 140/472 (29.66%), Postives = 220/472 (46.61%), Query Frame = 2
Query:  767 QTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYS--MEFDPPNPP----------SKTISAKTLQN-----YNFDIDVLKMDKNWKVNK-KLGEVSGVSILLTKQYKLGYSVLVLHRGSHAW-TERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEWQSQD----------PMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS--IYGIKYNPKN-RLIYGITS-------DGDI-RGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQ 2053
            Q FY  A+ ++++ GDI+ ARC+F   G    T +G    DEMCN YIM  T +  + N    C       L++ IP+ +      P   P          SKT + KT ++     +  +  VL+ D  W      LG+V+G+++           + V HR    W   RSF  +D + ED   PI++ TI+  DPVSG+++    +G+FY+PHG++   +GK LW+TDVA HQV R           K P + LG+R  PG   +HFCKP+ VAVD R    F++DGYCN R+  F  +GT++ EW ++            + +V  ++      G    + + VADREN ++  F  D   +   I   +    ++ + Y P +  L+Y +          G++ +G    ++T          D     PHD+ +  NG  +FV +    +V KF     S    H+
Sbjct:    1 QAFYPRAEPMEVRLGDIVAARCVFSGLGMSETTYVGMNSDDEMCNLYIMYST-DASQGNPSIRCMKRGEARLFRGIPAIANVPVLMPNRSPEKLAYLTKGISKTGTIKTQRSIDRPSFPRNFHVLEQDTQWHPEGVTLGQVTGLAVDTDDL------IYVFHRADRIWDPRRSFNNRDEFLEDHLGPIAEDTILAFDPVSGHLVHSFGKGMFYLPHGLSIDFEGK-LWVTDVALHQVFRLATGG-----GKEPLLTLGQRMRPGDGASHFCKPTDVAVDPRLRLAFISDGYCNGRIAVFSLDGTFVREWGTEGSKPGEFRIPHALTLVSRVSDDAGNDGGGDSSALCVADRENGRVQCFRADDGTRTRTIEHAAFGGRVFSLAYTPASGGLLYVLNGAPLTGEEGGEMPKGFVLRYDTGDILSTFVPKDERMHMPHDVAVLGNGSAVFVGDTISGRVWKFTPVETSLEAIHR 459          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010103.1 (pep scaffold:Pmarinus_7.0:GL481541:935:16119:1 gene:ENSPMAG00000009144.1 transcript:ENSPMAT00000010103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 9.708e-16
Identity = 65/270 (24.07%), Postives = 114/270 (42.22%), Query Frame = 2
Query:  188 YICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCSSPF---------------STEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIE---DKSGLLLELSSKPPDYVVGIFL--LFSYYGK-IQPQTRKVNLDVSCRYK------GNSEAYTLAFR-THAHALGRSISGYKVSLNDGQIELIGKG---NPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMC 895
            Y C  F +P  ++  +++  +P+    N    HH+L++ C +                 ST P   C+++        +  WA   ++F YP+N G ++G   +  + +LQ+HY     +    D SG     + +   Y  G+    +F+Y    I P T +      C  K       NS    LA R  H H  G S+       N  QI  +G+    +  + +T Y +    + PGD ++  C++++ G+++ T  G   MDEMC
Sbjct:   17 YSCKLFQLPKLDKKHHLIKVKPVIQAGNERYVHHLLVYVCLNTLNVSYVGSQAECYKYSSTHPFATCKTV--------MAAWAVGGETFDYPANAGFSLGLDEDPQFLLLQMHYDNAGLVSRANDSSGFRFYYTPELRTYEAGLLETGIFAYSQHFIPPNTARFTSYGICNTKTFYTSNANSTLQVLAVRFLHTHLAGISVQARHFR-NGTQIGNLGRDMGYDFDFQETRYLNKLTSVLPGDQIITECIYNTAGRNTTTAGGLGTMDEMC 277          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Sea Lamprey
Match: moxd1l (monooxygenase, DBH-like 1, like [Source:NCBI gene;Acc:553484])

HSP 1 Score: 68.9366 bits (167), Expect = 2.282e-12
Identity = 65/278 (23.38%), Postives = 111/278 (39.93%), Query Frame = 2
Query:  188 YICSSFPVPNHNENSYIVSYEP---LANSSIAHHMLLFGCSSPFST----------EPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTT---IEDKSGLLLELSSKPPDYVVGIF------------------LLFSYYGKIQPQTRKVNLDVSCRY---KGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKG---NPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVT--EIGSTHMDEMC 895
            Y C  FPVP  +   +++   P     N +  HH+LL+ CS+  +            P+ P      +    I+ GWA    +F YP   G ++G + +  + +L+ HY  P     + D SGL   ++ +   Y  G+                    + S YG       +V+L   C +   + + E    A   HAH LG ++   +      QI  +G+    +  + +  Y      + PGD L+  C + ST +   T  ++G +  DEMC
Sbjct:  169 YQCEIFPVPKLDRKHHLIKVVPRLQANNEAFVHHILLYTCSASVNASHVGASHECNHPNMP--DSFTHCFGGIMAGWAVGGGTFDYPPEAGFSLGAQGDPQFVMLETHYDNPAQLAGVADSSGLRFYITPELRAYDSGMLEVGVNPQPTHFIPPMTPSFMRSIYGH-----ERVSL-CPCGHTQARQSGEIQVFATILHAHLLGAAMQ-VRHFRQGKQIGHLGRDMGYDFNYQEARYLKELTAVLPGDELITECTYRSTSRSHTTTFKVGLSTQDEMC 437          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Sea Lamprey
Match: moxd1 (monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:570584])

HSP 1 Score: 66.6254 bits (161), Expect = 6.767e-12
Identity = 65/277 (23.47%), Postives = 115/277 (41.52%), Query Frame = 2
Query:  248 EPL---ANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSH--------------EKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKP---TTIEDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRKVNLDVSCRYKGNSEAY---------TLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNP---QWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIG--STHMDEMCNFYIMMVTK-NTGEENSFSECGGN 964
            EPL    +  + HH+LL+ C+            +I ++ H              E ILF WA    +F YP + G+++G   +  + +++ HY  P   + I D SGL L  +++   Y  G+    +  S Y  + P          C  +  +EA            A   HAH  GR +   +    D ++ L+ + +     + +     ++  + PGD L   C++++ G+ ++T  G  STH +EMC  Y++   + N     S  E  G 
Sbjct:    3 EPLVKPGHEGMVHHILLYQCALGLH-------EAILQSGHRCYQANMPEEFRSCESILFAWAIGGGAFLYPPHVGLSLGEPGDPVFVLMETHYDNPLQLSGIRDNSGLRLHYTAQLRAYDAGVMETGVWVSLYHMVPPHAPHWVSQGHCTRECLNEALGTERPQGVSVFAVLLHAHLAGRELL-VRHWRGDRELPLLARDSEYDFNFQELHMLPSERLLLPGDHLTTECVYNTEGRVNMTWWGGQSTH-NEMCLAYVLYYPRVNLSRCQSLPEINGQ 270          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000578.1 (pep scaffold:Pmarinus_7.0:GL478884:14758:39469:-1 gene:ENSPMAG00000000517.1 transcript:ENSPMAT00000000578.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 4.262e-10
Identity = 66/276 (23.91%), Postives = 119/276 (43.12%), Query Frame = 2
Query:  185 EYICSSFPVPNHNENSYIVSYEPL---ANSSIAHHMLLFGCSSPFSTE---PSFPC-RSICENSHEK-----ILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKP-------TTIEDKSGLLLELSSKPPDYVVGIF---LLFSYYGKIQPQTRK------------VNLDVSCRYKGNSEAYTLAFRT--HAHALGRSISGYKVSLNDGQIELIGKG---NPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMC 895
             Y+C+   +PN  +  +++  +PL    N+   HHM+++ C +  +      +F C  S+   +H       +L  WA   ++F YP++ G ++G  ++    +L++HY  P       T + D SGL L  +     Y  GI    +L + Y  I P+T              V  + +   +G        F T  H+H  G +I   +   N  QI  +G+    +    +T Y +    + PGD ++  C + +T +   T  G + M+EMC
Sbjct:    7 NYVCNVMQLPNLTKKHHLIKVQPLVQAGNTRFVHHMIVYACETNVNMSYINTTFQCYSSMGATNHPSARCLSVLAAWAVGGETFDYPADAGYSLGMDADPKVVMLEMHYNNPQAASGTHTGVSDSSGLRLYYTPNLRKYDTGILETGILPNIYHFIPPKTTSFTSYGICNTRSFVTANSNDTLQGQVSGTMNVFATMLHSHLAGIAIQ-VRHFRNGNQIGNLGRDMGYDFGLQETRYLNNLTAVLPGDQVVTECTYRTTTRTVTTTGGLSTMNEMC 281          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Nematostella
Match: EDO34395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPI1])

HSP 1 Score: 214.157 bits (544), Expect = 1.013e-62
Identity = 111/269 (41.26%), Postives = 159/269 (59.11%), Query Frame = 2
Query:  155 MPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCR----SIC-ENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHY------LKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKV----SLNDGQIELIGKGNPQWPQTFY--KSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM 910
            MP V  + +D Y C++ PV   ++ +YIV Y+P A    AHHMLLFGCS+P S EP + C      +C + S EKI++ W ++A +   P      VG  S++ Y VLQVHY      +K   ++D SG+ +  + + P  +  I LL S  G I P+ +  +LD++C+Y+  +  +  AFR HAH LG  I+GY+V    + ND + +LIGKG+PQ PQ FY  K    +IK GD++  RC F+S  KD  T IG+T  DEMCNFY+M
Sbjct:    1 MPNVHPVKHDSYFCTALPV--ESDETYIVGYDPHAEMHTAHHMLLFGCSTPASNEPHWNCGDMGVGVCGKGSGEKIMYAWGKNAPTLELPEGVAFKVGQASSVKYLVLQVHYGHVDKFVKNPDLKDSSGITIRTTHERPKQLASILLLVSG-GSIPPKQKVAHLDMACKYQNPAVMHPFAFRVHAHTLGTVITGYRVQNAENANDAKWDLIGKGDPQRPQAFYPVKDKHTEIKAGDVVAGRCTFNSMKKDKTTYIGATMKDEMCNFYMM 266          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Nematostella
Match: EDO42139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F4])

HSP 1 Score: 226.098 bits (575), Expect = 7.422e-62
Identity = 123/304 (40.46%), Postives = 170/304 (55.92%), Query Frame = 2
Query:   98 LFMFLVVIYLANGE----KLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSI----CENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTI--EDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGK--DSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEF 970
            L + ++ +  A G+    +L ++MPG  A  ND+Y+C+S PV  H +  YIVS+E  A   +AHHM+L GC  P S +  + C  +    C +  E ILF WA++A     P      +G K NINY VLQVHY     +   D SG +L  ++  P Y+ GI+LL+S    I P T++V++D++C+Y+ +   Y  A+RTHAH LGR ISGY+V   D +  L+GKG+PQ PQ FY     V I  GD + ARC FDS G   D    IG+T  DEMCNFY+M     +       EC  N  
Sbjct:    6 LLVSILAVLGAQGDLRYKELSVKMPGAAAKQNDDYLCTSVPV--HADEEYIVSFEAEATEEVAHHMILSGCKIPGSRKKVWGCGLMGGLECASGQE-ILFAWAKNAPPKKLPKGVAFQIGKKFNINYLVLQVHYRHKAKVGQSDHSGFVLHTTTTRPHYIAGIYLLWSGDADIPPDTQEVHVDLACKYQDDHPIYAFAYRTHAHGLGRVISGYRV--QDSKWSLLGKGDPQAPQAFYPIDHPVTISKGDTVAARCTFDSRGHKLDHHVHIGATGADEMCNFYLMYYRDASARPLRQDECNSNRL 304          

HSP 2 Score: 144.436 bits (363), Expect = 2.397e-35
Identity = 101/335 (30.15%), Postives = 167/335 (49.85%), Query Frame = 2
Query: 1097 KNWKV--NKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKD-VYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW---------QSQDPMF---IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSL--SIYGIKYNPKNRLIYGITSDGDIRGS------SFTFNTTSSQMK---PWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEI 2023
            +NW +   + LG+VS V++ +        +V+V HRGS AW  +SF +D V+QE   +PI ++T+   D  +G ++    R  FYMPHG+T   +    WITDVA HQV ++     S+     P +VLG+   PG D  HFC+P+ VA+++ G  +VADGYCN+RV+ F P G  +E++          S  P+    +VHS+ +      D + + ++VADREN ++             I  K    S+Y + +N  +  +  + +   + G        FT  T+   +    P   ++ F  PHD+  + +   +FV +    +V K  +
Sbjct:  409 ENWPLLGQETLGQVSAVALDMRG------NVVVFHRGSRAWDLKSFDRDNVFQER--TPIREHTVTTFDRKTGKIIGRWGRDRFYMPHGLTIDHEDN-TWITDVALHQVHKYGTDGSSE-----PVLVLGEMLRPGSDDKHFCQPNDVAIETTGVFYVADGYCNSRVMKFSPEGKLLEQYGKAMSARGLGSPPPLGVFDVVHSLAL------DQTHHHLYVADRENGRVQRLDTKKGRFDREITNKEFGASVYAVDFNSHDGGVLHVVNGESVFGGKRIAVQGFTVRTSDGALLGKWPGQGNF-FTQPHDIASSADNNELFVTQTGPNRVWKLTL 722          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Nematostella
Match: EDO34601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNT2])

HSP 1 Score: 210.69 bits (535), Expect = 1.880e-61
Identity = 111/268 (41.42%), Postives = 158/268 (58.96%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCR----SICEN-SHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHY------LKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQ-VQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM 910
            ++++MP V  + +D Y C++ PV   ++ ++IV YEP A    AHHMLLFGCS+P S E  + C      +C + S E+I++ W R+A   + P      VG  S++ Y VLQVHY      +K   + D SG+ L+ +   P ++  I L  S  G+I P  +  +LD+ C Y   +  +  AFR HAH+LG  I+GY+V   DG+  LIGKG+PQ PQ FY   Q V IK GD L ARC +++  KD +T IG+T  DEMCNFY+M
Sbjct:    8 IEMKMPNVRPLKHDSYFCTAVPV--KSDEAFIVGYEPHAEMHTAHHMLLFGCSTPASKEGFWNCGDMGVGVCASGSPERIMYAWGRNAPKLNLPKGVAFKVGQASSVKYLVLQVHYGHVDKFVKNPKLHDSSGVTLQTTHMRPKFLAAILLQASG-GEIPPHKKAAHLDMGCAYSNKATMHPFAFRVHAHSLGSVITGYRV--RDGKWTLIGKGDPQRPQAFYPIKQEVDIKDGDTLAARCTYNTMKKDRITYIGATMKDEMCNFYMM 270          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Nematostella
Match: EDO44959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU62])

HSP 1 Score: 70.4774 bits (171), Expect = 1.254e-12
Identity = 73/306 (23.86%), Postives = 123/306 (40.20%), Query Frame = 2
Query:  116 VIYLANGEKLKLQMPGVLAMNN-----------DEYICSSFPVPNHNENSYIVSYEPLANS---SIAHHMLLFGCSSPF----------STEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTT---IEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQ-----PQTRKVNLDVSC-----RYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQ--IELIGKGNPQWPQTFYK--SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIM 910
             + L N  K K Q+P  L+  +             Y+C  F  P      +IV Y PL NS      HHML++GC S F           T+ + P  +I   S    +  WA   + F+YP + G+A G      Y VL++HY  P     + D SG+    ++K   +  GI  L++ +  I      P+  +      C     R     +     F    H   + I  +   + DG+   E+I + +  +    ++    +V +KPGD ++  C + +  K+     G    +EMC  +++
Sbjct:  144 TLILLNVHKKKPQLPAQLSHFDLRHNLTIPSRLTSYMCKPFEFPQPASKHHIVKYMPLINSKNLGRVHHMLVYGCHSSFPRSNLSHVGECTDKNMP-PAIQRCSGAAPIAAWAIGGEDFYYPEHVGLAFGDGHGPRYVVLEIHYDNPQNDLGVYDDSGIRFFFTNKTRQFDAGI--LWAGWAPISAMVIPPRQEEWTSIGYCPSNCTRLSSLPDKGINIFAGMEHTHLQGIKVWTRHVRDGKELPEIIREEHYDFNYQEFQVLRNEVHVKPGDDIIQMCKYQTKNKNYPVVGGLGTTEEMCMSFLL 446          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Nematostella
Match: EDO49634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFN8])

HSP 1 Score: 70.4774 bits (171), Expect = 1.542e-12
Identity = 61/269 (22.68%), Postives = 106/269 (39.41%), Query Frame = 2
Query:  188 YICSSFPVPNHNENSYIVSYEPLA---NSSIAHHMLLFGCSSPF-----------STEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIE---DKSGLLLELSSKPPDYVVGIFLL---FSYYGKIQPQ----------TRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNP---QWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMC 895
            Y C  F +P   +  +IV ++P+    N+ I HH ++  C   F           + E + P   +       ++  W      F YP + G  +G      YFV++VHY  P  +    D SG+    +     Y  G+  +    + +  I P+           ++ N +VS   K     +  AF  H H  GR+     V  N  ++  I + +     +    + + +V   PGD L+  C++++  +  VT  G    DEMC
Sbjct:  207 YSCHVFTIPKFTKKHHIVRFDPVVQSENAGIVHHFIVMACDKDFPEHLSNDTSECTDEANMPAEVLKCRGRGVLVGAWGVGGGPFVYPDHVGSPLGLDFQGRYFVMEVHYNNPDKLAGKIDNSGVRFFYTDSLRKYDAGVLNVGASVTPWMLIPPKQKEWTTTTYCNKRCNENVSVTQKSRRIKFFSAF-LHTHLAGRATWTKHVR-NGVELPEIARDDNYDFNFQDIQFLNKEVHFLPGDELIHECVYNTMDRTGVTFGGEATNDEMC 473          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 352.443 bits (903), Expect = 1.583e-107
Identity = 244/684 (35.67%), Postives = 359/684 (52.49%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRS---ICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDK-----------------NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW------QSQDPMF-IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS--IYGIKYNPK-NRLIYGITSD-----GDIRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQ 2053
            + L+MPGV   N+D Y+C +FPVP  N++SYIV + P A+ +  HHM+LFGC SP S   S+ C      C++    I++ WAR+A     P + G  VG  S ++YFVLQVHY   +   D     SGL L ++SKP  +V GI+LL S    I P     N DV+C Y  +   Y  AFRTH H LG+ +SGY++   +G+  LIG+ +PQ PQ FY  + ++ ++ GD + ARC+F   G+ S T IG T  DEMCNFY MM   +      F  C  +  ++ +++IP+   E + P   S    +  +   +   D + +DK                 +W + N +LG+VSG+++          ++++ HRG H W   SF  +  YQ     PI    I+ VDP  G +L+ + R +FY+PHGITA +D  Y W+TDVA HQV++  V  D +  D+T  + LG+ F PG D +HFC+P+ VA+D   G VFV+DGYCN R++ F  +G Y+ +W      + Q   F I HS+    D      +  V VADREN +I  F  D       I ++     ++ I Y+P  + LIY +  D       +RG  F  N TS ++     P      F+ PHDL    +G  +FV +   ++V KF     S+ K H+
Sbjct:   51 MDLRMPGVSPSNSDTYLCMAFPVPT-NQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDCGGALGTCKDD-PSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFRDHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDY-ASYPIYPFAFRTHTHRLGKVVSGYRI--RNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFY-MMYYMDRRHAVPFMSCMESGSREQFRHIPA---EANVPIAVSPDQMSSMMHMGHAADDSVLLDKRRGGQGADQDYHLEQVTDWPEGNLQLGQVSGLAL------DSDSNLVIFHRGDHHWDLDSFDGRARYQHRSLGPIQQSAILVVDPAKGRILKASGRNMFYLPHGITADRDNNY-WVTDVALHQVLK--VSSDGR--DRT-LLALGEAFTPGSDSSHFCQPTDVAIDPHTGNVFVSDGYCNARILKFSADGKYLSQWGAGSLDRRQRARFQIPHSLAFLSD------RREVCVADRENGRIQCFIADTGEFVKEIKKEEFGGKVFAISYSPAGDGLIYAVNGDSPYHSAPLRG--FVINYTSREILDTFSP-KRKQDFKMPHDLVGGPDGS-VFVGDAGSEEVFKF-----SAEKSHR 698          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 352.058 bits (902), Expect = 2.572e-107
Identity = 244/684 (35.67%), Postives = 359/684 (52.49%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRS---ICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDK-----------------NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW------QSQDPMF-IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS--IYGIKYNPK-NRLIYGITSD-----GDIRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQ 2053
            + L+MPGV   N+D Y+C +FPVP  N++SYIV + P A+ +  HHM+LFGC SP S   S+ C      C++    I++ WAR+A     P + G  VG  S ++YFVLQVHY   +   D     SGL L ++SKP  +V GI+LL S    I P     N DV+C Y  +   Y  AFRTH H LG+ +SGY++   +G+  LIG+ +PQ PQ FY  + ++ ++ GD + ARC+F   G+ S T IG T  DEMCNFY MM   +      F  C  +  ++ +++IP+   E + P   S    +  +   +   D + +DK                 +W + N +LG+VSG+++          ++++ HRG H W   SF  +  YQ     PI    I+ VDP  G +L+ + R +FY+PHGITA +D  Y W+TDVA HQV++  V  D +  D+T  + LG+ F PG D +HFC+P+ VA+D   G VFV+DGYCN R++ F  +G Y+ +W      + Q   F I HS+    D      +  V VADREN +I  F  D       I ++     ++ I Y+P  + LIY +  D       +RG  F  N TS ++     P      F+ PHDL    +G  +FV +   ++V KF     S+ K H+
Sbjct:   80 MDLRMPGVSPSNSDTYLCMAFPVPT-NQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDCGGALGTCKDD-PSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFRDHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDY-ASYPIYPFAFRTHTHRLGKVVSGYRI--RNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFY-MMYYMDRRHAVPFMSCMESGSREQFRHIPA---EANVPIAVSPDQMSSMMHMGHAADDSVLLDKRRGGQGADQDYHLEQVTDWPEGNLQLGQVSGLAL------DSDSNLVIFHRGDHHWDLDSFDGRARYQHRSLGPIQQSAILVVDPAKGRILKASGRNMFYLPHGITADRDNNY-WVTDVALHQVLK--VSSDGR--DRT-LLALGEAFTPGSDSSHFCQPTDVAIDPHTGNVFVSDGYCNARILKFSADGKYLSQWGAGSLDRRQRARFQIPHSLAFLSD------RREVCVADRENGRIQCFIADTGEFVKEIKKEEFGGKVFAISYSPAGDGLIYAVNGDSPYHSAPLRG--FVINYTSREILDTFSP-KRKQDFKMPHDLVGGPDGS-VFVGDAGSEEVFKF-----SAEKSHR 727          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 353.599 bits (906), Expect = 3.892e-107
Identity = 245/680 (36.03%), Postives = 363/680 (53.38%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPS-KTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW------QSQDPMF-IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS--IYGIKYNPK-NRLIYGITSD-----GDIRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDM 2092
            + L+MPGV   N+D Y+C +FPVP  N++SYIV + P A+ +  HHM+LFGC SP S   S+ C      C++    I++ WAR+A     P + G  VG  S ++YFVLQVHY   +   D     SGL L ++SKP  +V GI+LL S    I P     N DV+C Y  +   Y  AFRTH H LG+ +SGY++   +G+  LIG+ +PQ PQ FY  + ++ ++ GD + ARC+F   G+ S T IG T  DEMCNFY MM   +      F  C  +  ++ +++IP+   E + P   S   +S+     +  D  + ++    + N +LG+VSG+++          ++++ HRG H W   SF  +  YQ     PI    I+ VDP  G +L+ + R +FY+PHGITA +D  Y W+TDVA HQV++  V  D +  D+T  + LG+ F PG D +HFC+P+ VA+D   G VFV+DGYCN R++ F  +G Y+ +W      + Q   F I HS+    D      +  V VADREN +I  F  D       I ++     ++ I Y+P  + LIY +  D       +RG  F  N TS ++     P      F+ PHDL    +G  +FV +   ++V KF     S+ K H+ SV     Q+ ++
Sbjct:   51 MDLRMPGVSPSNSDTYLCMAFPVPT-NQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDCGGALGTCKDD-PSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFRDHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDY-ASYPIYPFAFRTHTHRLGKVVSGYRI--RNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFY-MMYYMDRRHAVPFMSCMESGSREQFRHIPA---EANVPIAVSPDQMSSMMHMGHAADYHLEQVTDWPEGNLQLGQVSGLAL------DSDSNLVIFHRGDHHWDLDSFDGRARYQHRSLGPIQQSAILVVDPAKGRILKASGRNMFYLPHGITADRDNNY-WVTDVALHQVLK--VSSDGR--DRT-LLALGEAFTPGSDSSHFCQPTDVAIDPHTGNVFVSDGYCNARILKFSADGKYLSQWGAGSLDRRQRARFQIPHSLAFLSD------RREVCVADRENGRIQCFIADTGEFVKEIKKEEFGGKVFAISYSPAGDGLIYAVNGDSPYHSAPLRG--FVINYTSREILDTFSP-KRKQDFKMPHDLVGGPDGS-VFVGDAGSEEVFKF-----SAEKSHR-SVKKAGIQVQEL 693          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 351.288 bits (900), Expect = 4.680e-106
Identity = 247/697 (35.44%), Postives = 365/697 (52.37%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDK-----------------NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW------QSQDPMF-IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS--IYGIKYNPK-NRLIYGITSD-----GDIRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDM 2092
            + L+MPGV   N+D Y+C +FPVP  N++SYIV + P A+ +  HHM+LFGC SP S   S+ C      C++    I++ WAR+A     P + G  VG  S ++YFVLQVHY   +   D     SGL L ++SKP  +V GI+LL S    I P     N DV+C Y  +   Y  AFRTH H LG+ +SGY++   +G+  LIG+ +PQ PQ FY  + ++ ++ GD + ARC+F   G+ S T IG T  DEMCNFY MM   +      F  C  +  ++ +++IP+   E + P   S    +  +   +   D + +DK                 +W + N +LG+VSG+++          ++++ HRG H W   SF  +  YQ     PI    I+ VDP  G +L+ + R +FY+PHGITA +D  Y W+TDVA HQV++  V  D +  D+T  + LG+ F PG D +HFC+P+ VA+D   G VFV+DGYCN R++ F  +G Y+ +W      + Q   F I HS+    D      +  V VADREN +I  F  D       I ++     ++ I Y+P  + LIY +  D       +RG  F  N TS ++     P      F+ PHDL    +G  +FV +   ++V KF     S+ K H+ SV     Q+ ++
Sbjct:   51 MDLRMPGVSPSNSDTYLCMAFPVPT-NQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDCGGALGTCKDD-PSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFRDHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDY-ASYPIYPFAFRTHTHRLGKVVSGYRI--RNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFY-MMYYMDRRHAVPFMSCMESGSREQFRHIPA---EANVPIAVSPDQMSSMMHMGHAADDSVLLDKRRGGQGADQDYHLEQVTDWPEGNLQLGQVSGLAL------DSDSNLVIFHRGDHHWDLDSFDGRARYQHRSLGPIQQSAILVVDPAKGRILKASGRNMFYLPHGITADRDNNY-WVTDVALHQVLK--VSSDGR--DRT-LLALGEAFTPGSDSSHFCQPTDVAIDPHTGNVFVSDGYCNARILKFSADGKYLSQWGAGSLDRRQRARFQIPHSLAFLSD------RREVCVADRENGRIQCFIADTGEFVKEIKKEEFGGKVFAISYSPAGDGLIYAVNGDSPYHSAPLRG--FVINYTSREILDTFSP-KRKQDFKMPHDLVGGPDGS-VFVGDAGSEEVFKF-----SAEKSHR-SVKKAGIQVQEL 710          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Medaka
Match: pam (peptidylglycine alpha-amidating monooxygenase [Source:NCBI gene;Acc:101164528])

HSP 1 Score: 350.903 bits (899), Expect = 1.017e-105
Identity = 247/697 (35.44%), Postives = 365/697 (52.37%), Query Frame = 2
Query:  143 LKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC---RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDK----SGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDK-----------------NW-KVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSR-GYVFVADGYCNNRVVCFYPNGTYIEEW------QSQDPMF-IVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS--IYGIKYNPK-NRLIYGITSD-----GDIRGSSFTFNTTSSQM----KPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDM 2092
            + L+MPGV   N+D Y+C +FPVP  N++SYIV + P A+ +  HHM+LFGC SP S   S+ C      C++    I++ WAR+A     P + G  VG  S ++YFVLQVHY   +   D     SGL L ++SKP  +V GI+LL S    I P     N DV+C Y  +   Y  AFRTH H LG+ +SGY++   +G+  LIG+ +PQ PQ FY  + ++ ++ GD + ARC+F   G+ S T IG T  DEMCNFY MM   +      F  C  +  ++ +++IP+   E + P   S    +  +   +   D + +DK                 +W + N +LG+VSG+++          ++++ HRG H W   SF  +  YQ     PI    I+ VDP  G +L+ + R +FY+PHGITA +D  Y W+TDVA HQV++  V  D +  D+T  + LG+ F PG D +HFC+P+ VA+D   G VFV+DGYCN R++ F  +G Y+ +W      + Q   F I HS+    D      +  V VADREN +I  F  D       I ++     ++ I Y+P  + LIY +  D       +RG  F  N TS ++     P      F+ PHDL    +G  +FV +   ++V KF     S+ K H+ SV     Q+ ++
Sbjct:   80 MDLRMPGVSPSNSDTYLCMAFPVPT-NQDSYIVDFIPHASMNTVHHMILFGCQSPSSASSSWDCGGALGTCKDD-PSIMYAWARNAPPTKLPKDVGFRVGKGSGMSYFVLQVHYGDVSAFRDHHRDCSGLTLRMTSKPQPFVAGIYLLMSVDTVIPPGKTVTNADVACDY-ASYPIYPFAFRTHTHRLGKVVSGYRI--RNGKWTLIGRQSPQLPQAFYPVNTELSVQYGDTVAARCVFTGEGRTSETVIGGTSDDEMCNFY-MMYYMDRRHAVPFMSCMESGSREQFRHIPA---EANVPIAVSPDQMSSMMHMGHAADDSVLLDKRRGGQGADQDYHLEQVTDWPEGNLQLGQVSGLAL------DSDSNLVIFHRGDHHWDLDSFDGRARYQHRSLGPIQQSAILVVDPAKGRILKASGRNMFYLPHGITADRDNNY-WVTDVALHQVLK--VSSDGR--DRT-LLALGEAFTPGSDSSHFCQPTDVAIDPHTGNVFVSDGYCNARILKFSADGKYLSQWGAGSLDRRQRARFQIPHSLAFLSD------RREVCVADRENGRIQCFIADTGEFVKEIKKEEFGGKVFAISYSPAGDGLIYAVNGDSPYHSAPLRG--FVINYTSREILDTFSP-KRKQDFKMPHDLVGGPDGS-VFVGDAGSEEVFKF-----SAEKSHR-SVKKAGIQVQEL 739          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Planmine SMEST
Match: SMESG000057300.1 (SMESG000057300.1)

HSP 1 Score: 1543.1 bits (3994), Expect = 0.000e+0
Identity = 754/759 (99.34%), Postives = 757/759 (99.74%), Query Frame = 2
Query:   80 MLNLRDLFMFLVVIYLANGEKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEWQSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDMVKQINPVYIGVLMVAVTVFILICIVTMKYYRRCQXXXXXXXXXXXXXXDKEGFKPLTQEDDGNDDGNSDPETEEYPALRGHLSKKPKV 2356
            M+NLRDLFMFLVVIYLANGEKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENS EKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIG THMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGY+FVADGYCNNRVVCFYPNGTYIEEWQSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLSIYGIKYNPKN+LIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDMVKQINPVYIGVLMVAVTVFILICIVTMKYYRRCQSGYSKKRRYGKSYKDKEGFKPLTQEDDGNDDGNSDPETEEYPALRGHLSKKPKV
Sbjct:    1 MVNLRDLFMFLVVIYLANGEKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSREKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARCLFDSTGKDSVTEIGYTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDLWKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDLDSPISDYTIVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYIFVADGYCNNRVVCFYPNGTYIEEWQSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLSIYGIKYNPKNQLIYGITSDGDIRGSSFTFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAAKSSTKHHQHSVGNNFNQIHDMVKQINPVYIGVLMVAVTVFILICIVTMKYYRRCQSGYSKKRRYGKSYKDKEGFKPLTQEDDGNDDGNSDPETEEYPALRGHLSKKPKV 759          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Planmine SMEST
Match: SMESG000073851.1 (SMESG000073851.1)

HSP 1 Score: 167.933 bits (424), Expect = 3.355e-45
Identity = 100/286 (34.97%), Postives = 155/286 (54.20%), Query Frame = 2
Query:   98 LFMFLVVIYLA-NGEKLKLQMPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC--------RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHY------LKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYI 907
            +F+ L +++L+    ++ L+MP V     D+YIC +  +   N+  +I  + P A++S AHH+L+  C+ P S +P + C        + IC+ S  KILF WA  A  F  P +  + +G      Y V+Q HY       KP +  D+SG+ + +  KP   + GI+LL +  G I P    V ++ +C Y G +  +  A+R H H+LG+ +SGY +   +     IGK +PQ  Q FY     V+I PGD L ARC+ ++ G D + +IG+T  DEMCNFYI
Sbjct:    2 IFLCLYLLFLSIESHEILLKMPKVRPTKEDQYICHALDL--KNDTLFITGFNPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICK-SGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSI-PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWT--EIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYI 279          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Planmine SMEST
Match: SMESG000073851.1 (SMESG000073851.1)

HSP 1 Score: 161.77 bits (408), Expect = 2.310e-43
Identity = 96/266 (36.09%), Postives = 142/266 (53.38%), Query Frame = 2
Query:  155 MPGVLAMNNDEYICSSFPVPNHNENSYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPC--------RSICENSHEKILFGWARDAKSFHYPSNTGMAVGGKSNINYFVLQVHY------LKPTTIEDKSGLLLELSSKPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAHALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYK-SAQVQIKPGDILMARCLFDSTGKDSVTEIGSTHMDEMCNFYI 907
            MP V     D+YIC +  +   N+  +I  + P A++S AHH+L+  C+ P S +P + C        + IC+ S  KILF WA  A  F  P +  + +G      Y V+Q HY       KP +  D+SG+ + +  KP   + GI+LL +  G I P    V ++ +C Y G +  +  A+R H H+LG+ +SGY +   +     IGK +PQ  Q FY     V+I PGD L ARC+ ++ G D + +IG+T  DEMCNFYI
Sbjct:    1 MPKVRPTKEDQYICHALDL--KNDTLFITGFNPKASASHAHHILIHSCTEPGSVKPYWNCEEMNAKDSKPICK-SGLKILFSWAMAASGFRLPKDVSVMIGKAVGKQYLVIQSHYKNVDYFRKPNSEPDESGIEITVQRKPTSKLAGIYLL-ATDGSI-PGHSTVFMEAACSYTGKTVLHPFAYRVHTHSLGKLVSGYVIHRKNWT--EIGKKSPQVEQMFYPVKGTVKIYPGDTLAARCIMENKG-DKLVKIGNTRKDEMCNFYI 258          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Planmine SMEST
Match: SMESG000042480.1 (SMESG000042480.1)

HSP 1 Score: 129.413 bits (324), Expect = 6.281e-32
Identity = 98/299 (32.78%), Postives = 149/299 (49.83%), Query Frame = 2
Query: 1052 TLQNYNFDIDVLKMDKNWKVNKKL---GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEV--DPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW---QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS---------IYGIKYNPKNRLIYGITS--DGDIRGSSFTFN 1888
            TL+N N       +  NW  +K L   G+VSG+S    K Y     + + HR      ERSF  K+ YQ+  D PI + TI+++  D  +  V+ E    +FY+PHGI A  D  ++  TD+A HQV+R     +       P ++LG+ F PG D NHFCKP+       G +FVADGYCN+R+V F  +G +I E+   + +  + I H + + E      SK+++  ADREN ++    Y   +K T    K +          +Y + +N  N L+Y ++   D   R   F +N
Sbjct:   48 TLENAN-------LVPNWPSSKLLDYLGQVSGLS-FCPKGY-----LYIFHRADVEMDERSFNNKNQYQKLSDGPIKESTIIKINNDIDNAKVVGEFGSNLFYLPHGIFA--DKHHMIATDLARHQVLRIPHNSNK------PDLILGEIFTPGNDANHFCKPTHAVAAEDGTIFVADGYCNSRIVKFDKHGKFIGEFGNAKDKSRLSIPHHLVLIE------SKDLICAADRENMRVQ--CYSAGLKVTSKSGKLIKTIKDEKFGPVYAVGFNKLNNLMYVVSDMVDDTDRSRVFIYN 317          
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Planmine SMEST
Match: SMESG000042480.1 (SMESG000042480.1)

HSP 1 Score: 129.413 bits (324), Expect = 6.574e-32
Identity = 98/299 (32.78%), Postives = 149/299 (49.83%), Query Frame = 2
Query: 1052 TLQNYNFDIDVLKMDKNWKVNKKL---GEVSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFI-KDVYQEDLDSPISDYTIVEV--DPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNVRDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCNNRVVCFYPNGTYIEEW---QSQDPMFIVHSITIKEDESGDISKNIVWVADRENRKIIGFGYDGIIKFTHIFRKSLS---------IYGIKYNPKNRLIYGITS--DGDIRGSSFTFN 1888
            TL+N N       +  NW  +K L   G+VSG+S    K Y     + + HR      ERSF  K+ YQ+  D PI + TI+++  D  +  V+ E    +FY+PHGI A  D  ++  TD+A HQV+R     +       P ++LG+ F PG D NHFCKP+       G +FVADGYCN+R+V F  +G +I E+   + +  + I H + + E      SK+++  ADREN ++    Y   +K T    K +          +Y + +N  N L+Y ++   D   R   F +N
Sbjct:   49 TLENAN-------LVPNWPSSKLLDYLGQVSGLS-FCPKGY-----LYIFHRADVEMDERSFNNKNQYQKLSDGPIKESTIIKINNDIDNAKVVGEFGSNLFYLPHGIFA--DKHHMIATDLARHQVLRIPHNSNK------PDLILGEIFTPGNDANHFCKPTHAVAAEDGTIFVADGYCNSRIVKFDKHGKFIGEFGNAKDKSRLSIPHHLVLIE------SKDLICAADRENMRVQ--CYSAGLKVTSKSGKLIKTIKDEKFGPVYAVGFNKLNNLMYVVSDMVDDTDRSRVFIYN 318          
The following BLAST results are available for this feature:
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAM2.534e-10133.08peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM5.191e-5338.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM5.978e-5338.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM6.666e-5338.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
PAM7.011e-5338.41peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pamn-11.538e-6729.89Probable peptidyl-glycine alpha-amidating monooxyg... [more]
pghm-15.864e-4329.81Probable peptidylglycine alpha-hydroxylating monoo... [more]
pgal-15.727e-3530.98Probable peptidyl-alpha-hydroxyglycine alpha-amida... [more]
pgal-15.727e-3530.98Probable peptidyl-alpha-hydroxyglycine alpha-amida... [more]
tbh-17.650e-1825.67Tyramine beta-hydroxylase [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phm6.415e-4235.29gene:FBgn0283509 transcript:FBtr0072203[more]
Phm6.415e-4235.29gene:FBgn0283509 transcript:FBtr0072202[more]
Pal16.710e-3428.65gene:FBgn0283510 transcript:FBtr0339422[more]
Pal19.547e-3426.95gene:FBgn0283510 transcript:FBtr0339423[more]
Pal19.547e-3426.95gene:FBgn0283510 transcript:FBtr0088385[more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam2.870e-8737.83peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam2.257e-6140.27peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam6.085e-4732.15peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.790e-4132.84peptidylglycine alpha-amidating monooxygenase [Sou... [more]
dbh6.594e-1826.64dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam1.475e-11034.48peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.392e-5237.72peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.695e-5237.72peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam5.544e-4937.89peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam7.856e-4838.25peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pam1.142e-10133.24peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Pam4.686e-5339.18peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Pam4.751e-5339.18peptidylglycine alpha-amidating monooxygenase [Sou... [more]
Dbh3.178e-2027.21dopamine beta hydroxylase [Source:MGI Symbol;Acc:M... [more]
Moxd25.166e-1424.27monooxygenase, DBH-like 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08478|AMDA_XENLA2.724e-11034.78Peptidyl-glycine alpha-amidating monooxygenase A O... [more]
sp|P12890|AMDB_XENLA3.437e-10934.23Peptidyl-glycine alpha-amidating monooxygenase B O... [more]
sp|P83388|AMDL_CAEEL1.956e-6629.89Probable peptidyl-glycine alpha-amidating monooxyg... [more]
sp|P10731|AMD_BOVIN6.850e-5339.52Peptidyl-glycine alpha-amidating monooxygenase OS=... [more]
sp|P14925|AMD_RAT1.965e-5238.62Peptidylglycine alpha-amidating monooxygenase OS=R... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I9G34.494e-12636.58peptidyl-glycine alpha-amidating monooxygenase iso... [more]
A0A267DQ576.620e-12634.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3IAE21.420e-12536.72peptidyl-glycine alpha-amidating monooxygenase A i... [more]
A0A210PFJ81.122e-12437.67Peptidyl-glycine alpha-amidating monooxygenase B O... [more]
V4A0925.744e-12336.39Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam3.358e-11435.34peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.187e-5739.93peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.313e-5739.93peptidylglycine alpha-amidating monooxygenase [Sou... [more]
moxd16.337e-1725.45monooxygenase DBH like 1 [Source:NCBI gene;Acc:103... [more]
dbh3.927e-1323.72dopamine beta-hydroxylase (dopamine beta-monooxyge... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003037.12.709e-5229.66pep scaffold:Pmarinus_7.0:GL480308:28740:39707:1 g... [more]
ENSPMAT00000010103.19.708e-1624.07pep scaffold:Pmarinus_7.0:GL481541:935:16119:1 gen... [more]
moxd1l2.282e-1223.38monooxygenase, DBH-like 1, like [Source:NCBI gene;... [more]
moxd16.767e-1223.47monooxygenase, DBH-like 1 [Source:NCBI gene;Acc:57... [more]
ENSPMAT00000000578.14.262e-1023.91pep scaffold:Pmarinus_7.0:GL478884:14758:39469:-1 ... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343951.013e-6241.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421397.422e-6240.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346011.880e-6141.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449591.254e-1223.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496341.542e-1222.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pam1.583e-10735.67peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam2.572e-10735.67peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam3.892e-10736.03peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam4.680e-10635.44peptidylglycine alpha-amidating monooxygenase [Sou... [more]
pam1.017e-10535.44peptidylglycine alpha-amidating monooxygenase [Sou... [more]
back to top
BLAST of Peptidyl-glycine alpha-amidating monooxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057300.10.000e+099.34SMESG000057300.1[more]
SMESG000073851.13.355e-4534.97SMESG000073851.1[more]
SMESG000073851.12.310e-4336.09SMESG000073851.1[more]
SMESG000042480.16.281e-3232.78SMESG000042480.1[more]
SMESG000042480.16.574e-3232.78SMESG000042480.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027602 ID=SMED30027602|Name=Peptidyl-glycine alpha-amidating monooxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=2625bp
CCCAGTTTAAAAAAGTTTTTTTTATCTGAACTAGAATACCAAAACCAATA
ATAAATATTACATAATAAATTCAGTTAAAATGCTAAATTTAAGGGATTTA
TTTATGTTCCTAGTTGTAATTTATTTGGCTAATGGTGAAAAATTAAAACT
GCAGATGCCTGGTGTATTAGCTATGAATAATGACGAATACATATGTTCTT
CATTTCCTGTTCCAAATCATAACGAGAATTCATATATTGTTTCCTATGAA
CCCTTAGCTAATAGTTCTATAGCTCACCATATGCTTCTTTTTGGATGTTC
TTCACCGTTTTCTACTGAACCATCGTTTCCATGCAGATCAATATGCGAAA
ATTCACATGAAAAAATATTATTTGGATGGGCTAGAGATGCTAAATCATTT
CACTATCCATCTAATACTGGAATGGCCGTCGGAGGCAAATCAAACATTAA
CTATTTTGTACTTCAAGTACATTATCTGAAACCTACAACTATTGAAGATA
AATCTGGATTGTTATTGGAATTGTCATCGAAACCACCGGATTATGTAGTT
GGAATATTTCTCCTCTTTTCCTATTATGGAAAAATTCAGCCTCAGACACG
AAAAGTTAATTTAGACGTGAGCTGCAGATATAAAGGAAATAGTGAAGCGT
ACACATTAGCTTTCCGAACTCATGCGCACGCCTTGGGTCGTTCCATCTCT
GGATATAAAGTTTCATTGAATGATGGTCAAATTGAACTAATAGGTAAAGG
AAATCCTCAGTGGCCTCAAACATTTTACAAATCTGCTCAAGTCCAGATAA
AACCAGGAGATATACTTATGGCGCGTTGTCTATTTGACTCGACGGGGAAA
GATTCTGTTACAGAAATCGGATCTACTCATATGGATGAAATGTGCAATTT
TTATATCATGATGGTTACAAAAAATACTGGCGAAGAAAATAGTTTTTCAG
AATGCGGCGGAAATGAATTCAAAGATTTATGGAAAAACATTCCCAGTTAT
TCAATGGAATTTGATCCGCCAAACCCACCTTCCAAAACAATATCTGCAAA
AACGTTACAAAATTACAATTTTGATATTGATGTACTAAAAATGGATAAAA
ATTGGAAAGTAAATAAAAAACTCGGTGAAGTAAGCGGAGTTTCAATTTTG
TTGACTAAGCAATATAAACTTGGATATTCAGTTCTTGTTCTTCACCGTGG
ATCTCATGCATGGACAGAGAGATCATTTATTAAGGATGTTTATCAAGAGG
ATTTAGATTCCCCTATATCTGATTATACAATTGTTGAAGTAGATCCGGTT
TCAGGAAATGTCTTAAGAGAAGCTGCTCGGGGCATATTTTATATGCCACA
CGGCATAACTGCAACAAAGGATGGGAAATACCTTTGGATTACAGATGTCG
CATTTCATCAAGTGATGCGTTTTAATGTTAGAGACGATTCTAAGTTGATT
GACAAAACACCAAGTATTGTTCTTGGGAAGCGATTTATCCCAGGGAGAGA
CATGAATCATTTTTGTAAACCCAGTCAAGTTGCAGTTGACAGCCGAGGAT
ATGTTTTTGTGGCCGATGGATATTGTAATAATCGTGTAGTTTGTTTTTAT
CCAAATGGAACTTATATTGAAGAATGGCAGTCACAAGATCCTATGTTTAT
TGTACATAGTATTACAATTAAAGAAGATGAGTCTGGAGATATTAGTAAAA
ATATTGTTTGGGTGGCTGATAGAGAGAACCGAAAAATTATCGGATTTGGT
TATGATGGCATTATTAAGTTTACTCACATTTTTAGGAAATCTCTTTCTAT
TTATGGAATCAAATATAATCCTAAAAATCGACTTATTTACGGTATAACCA
GTGATGGTGACATCAGAGGAAGCTCGTTTACTTTCAATACAACTTCCTCG
CAAATGAAACCTTGGAATACAGATTATTCATTTCGTGCGCCCCATGACTT
GTGTCTTGCTGACAATGGGAAGTTCATATTCGTGGCTGAATTACATTTAA
AAAAGGTTATAAAATTCGAAATAGCTGCTAAATCATCCACCAAGCACCAC
CAGCATTCGGTCGGCAATAATTTCAATCAGATTCATGATATGGTTAAACA
AATAAATCCTGTCTACATTGGGGTGCTTATGGTAGCTGTAACGGTGTTCA
TACTGATCTGTATTGTTACAATGAAGTATTATCGTCGTTGCCAATCTGGT
TACAGTAAAAAACGACGTTATGGGAAATCTTATAAAGACAAAGAAGGATT
TAAGCCTTTGACTCAAGAAGATGATGGCAATGATGATGGGAATAGTGATC
CGGAAACAGAAGAATATCCGGCTTTGCGTGGACATTTATCCAAGAAACCA
AAAGTGTGACATTTTGATTTCTTTGTATTTCTTCAGTTTTCATTGTTTGT
ATGACTTCTTGCTCTTCTGCTTCATTTGTCCTAGAACAATATAATTCGCC
GTAGAACATTACATTAGGTGAAATTTATAACCTCTGGTGTTTTTATTAAT
GTTAAAATATAATTTAAATGCAATTATTTTTTTATCGTTTATCATGACAT
TGAGATGTCTGTGATTTGTTGTTCTATTTTGTCCTTTTCTCGTTTTGTTG
TGTGATATTACACATTTTCTATGGA
back to top

protein sequence of SMED30027602-orf-1

>SMED30027602-orf-1 ID=SMED30027602-orf-1|Name=SMED30027602-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=760bp
MLNLRDLFMFLVVIYLANGEKLKLQMPGVLAMNNDEYICSSFPVPNHNEN
SYIVSYEPLANSSIAHHMLLFGCSSPFSTEPSFPCRSICENSHEKILFGW
ARDAKSFHYPSNTGMAVGGKSNINYFVLQVHYLKPTTIEDKSGLLLELSS
KPPDYVVGIFLLFSYYGKIQPQTRKVNLDVSCRYKGNSEAYTLAFRTHAH
ALGRSISGYKVSLNDGQIELIGKGNPQWPQTFYKSAQVQIKPGDILMARC
LFDSTGKDSVTEIGSTHMDEMCNFYIMMVTKNTGEENSFSECGGNEFKDL
WKNIPSYSMEFDPPNPPSKTISAKTLQNYNFDIDVLKMDKNWKVNKKLGE
VSGVSILLTKQYKLGYSVLVLHRGSHAWTERSFIKDVYQEDLDSPISDYT
IVEVDPVSGNVLREAARGIFYMPHGITATKDGKYLWITDVAFHQVMRFNV
RDDSKLIDKTPSIVLGKRFIPGRDMNHFCKPSQVAVDSRGYVFVADGYCN
NRVVCFYPNGTYIEEWQSQDPMFIVHSITIKEDESGDISKNIVWVADREN
RKIIGFGYDGIIKFTHIFRKSLSIYGIKYNPKNRLIYGITSDGDIRGSSF
TFNTTSSQMKPWNTDYSFRAPHDLCLADNGKFIFVAELHLKKVIKFEIAA
KSSTKHHQHSVGNNFNQIHDMVKQINPVYIGVLMVAVTVFILICIVTMKY
YRRCQSGYSKKRRYGKSYKDKEGFKPLTQEDDGNDDGNSDPETEEYPALR
GHLSKKPKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036939Cu2_ascorb_mOase_N_sf
IPR000720PHM/PAL
IPR0110426-blade_b-propeller_TolB-like
IPR001258NHL_repeat
IPR000323Cu2_ascorb_mOase_N
IPR024548Cu2_monoox_C
IPR014784Cu2_ascorb_mOase-like_C
IPR020611Cu2_ascorb_mOase_CS-1
IPR013017NHL_repeat_subgr
IPR008977PHM/PNGase_F_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0005515protein binding
GO:0016715oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
GO:0004497monooxygenase activity
GO:0005507copper ion binding
Vocabulary: biological process
TermDefinition
GO:0006518peptide metabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000720Peptidylglycine alpha-hydroxylating monooxygenase/peptidyl-hydroxyglycine alpha-amidating lyasePRINTSPR00790PAMONOXGNASEcoord: 218..237
score: 45.71
coord: 96..115
score: 37.14
coord: 366..384
score: 38.35
coord: 55..76
score: 53.25
coord: 263..282
score: 55.0
coord: 430..449
score: 40.0
IPR024548Copper type II ascorbate-dependent monooxygenase, C-terminalPFAMPF03712Cu2_monoox_Ccoord: 157..285
e-value: 8.5E-29
score: 100.1
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 327..657
e-value: 1.7E-67
score: 230.0
IPR000323Copper type II, ascorbate-dependent monooxygenase, N-terminalPFAMPF01082Cu2_monooxygencoord: 26..137
e-value: 3.2E-24
score: 85.6
IPR001258NHL repeatPFAMPF01436NHLcoord: 478..506
e-value: 7.2E-6
score: 25.8
IPR036939Copper type II, ascorbate-dependent monooxygenase, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.310coord: 12..157
e-value: 8.6E-41
score: 141.3
IPR014784Copper type II, ascorbate-dependent monooxygenase-like, C-terminalGENE3DG3DSA:2.60.120.230coord: 158..310
e-value: 1.9E-48
score: 165.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 719..759
NoneNo IPR availablePANTHERPTHR10680PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASEcoord: 20..645
NoneNo IPR availablePANTHERPTHR10680:SF32coord: 20..645
NoneNo IPR availableCDDcd14958NHL_PAL_likecoord: 338..647
e-value: 1.34649E-79
score: 255.266
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.659
NoneNo IPR availableSUPERFAMILYSSF63829Calcium-dependent phosphotriesterasecoord: 361..650
NoneNo IPR availableTMHMMTMhelixcoord: 675..697
IPR020611Copper type II, ascorbate-dependent monooxygenase, histidine-cluster-1 conserved sitePROSITEPS00084CU2_MONOOXYGENASE_1coord: 66..73
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 477..509
score: 11.246
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 543..559
score: 6.004
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 409..451
score: 6.25
IPR008977PHM/PNGase F domain superfamilySUPERFAMILYSSF49742PHM/PNGase Fcoord: 154..283
IPR008977PHM/PNGase F domain superfamilySUPERFAMILYSSF49742PHM/PNGase Fcoord: 17..153