DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30027595
Length (bp)795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30027595) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30027595) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30027595) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30027595) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027595

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30027595h1SMcG0015108 Contig1106GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30027595h1SMcG0015108 Contig1106GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30027595h1SMcG0015108 Contig1106GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30027595h1SMcG0018989 Contig1106GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30027595h1SMcG0018989 Contig1106GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30027595h1SMcG0018989 Contig1106GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30027595h1SMcG0015108 Contig1106GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027595h1SMcG0018989 Contig19044uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027595h1SMcG0018989 Contig19044newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30027595h1SMcG0018989 dd_Smed_v4_1333_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027595h1SMcG0018989 dd_Smed_v4_1333_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027595h1SMcG0018989 dd_Smed_v4_1333_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027595h1SMcG0018989 Contig1106GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027595h1SMcG0018989 Contig46555uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027595h1SMcG0018989 Contig46555newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 67.0106 bits (162), Expect = 1.314e-12
Identity = 41/132 (31.06%), Postives = 61/132 (46.21%), Query Frame = 1
Query:  292 DNKGMWQYGQKGEIPDNAVYGGCDS----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGE 672
               G W     GE+P NA+ GG DS    YI RA H+     G +       +V +    H    Y+++       +W   D   +P  A+ AGE      LF+GRA ++G + +G  +P +G  Y+PY GE
Sbjct:  154 SGPGCWVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGG--QWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGE 283          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG32633 (gene:FBgn0052633 transcript:FBtr0073800)

HSP 1 Score: 59.3066 bits (142), Expect = 5.282e-10
Identity = 36/152 (23.68%), Postives = 67/152 (44.08%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD*FLDFEKIKI 744
            W +   G +P NAV  G DS     Y+ RA          ++      +V + +  H    Y+++      +EW   +   +P GA+  G + +   L+ GR  + G L +G   P +G +Y+PY  +  +    ++LC+ + ++D     I
Sbjct:    6 WMHFSNGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELENYEVLSGYN--YEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLCQPERWIDTTATNI 155          

HSP 2 Score: 48.1358 bits (113), Expect = 2.943e-6
Identity = 36/142 (25.35%), Postives = 61/142 (42.96%), Query Frame = 1
Query:  250 GREYELLWKNKDEVDNKGM-------WQYGQKGEIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRP 636
            G+ Y    + + E++N  +       W   + GE+P  AV  G +      Y  R  H     +G +     C ++P+       + Y+++ +      W  T  T +P+GA++AG D N   ++VGR   NG LL     P
Sbjct:   51 GKAYVAYAREEHELENYEVLSGYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLCQPE---RWIDTTATNIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVP 189          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG32633 (gene:FBgn0052633 transcript:FBtr0310431)

HSP 1 Score: 59.3066 bits (142), Expect = 5.282e-10
Identity = 36/152 (23.68%), Postives = 67/152 (44.08%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD*FLDFEKIKI 744
            W +   G +P NAV  G DS     Y+ RA          ++      +V + +  H    Y+++      +EW   +   +P GA+  G + +   L+ GR  + G L +G   P +G +Y+PY  +  +    ++LC+ + ++D     I
Sbjct:    6 WMHFSNGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELENYEVLSGYN--YEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLCQPERWIDTTATNI 155          

HSP 2 Score: 48.1358 bits (113), Expect = 2.943e-6
Identity = 36/142 (25.35%), Postives = 61/142 (42.96%), Query Frame = 1
Query:  250 GREYELLWKNKDEVDNKGM-------WQYGQKGEIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRP 636
            G+ Y    + + E++N  +       W   + GE+P  AV  G +      Y  R  H     +G +     C ++P+       + Y+++ +      W  T  T +P+GA++AG D N   ++VGR   NG LL     P
Sbjct:   51 GKAYVAYAREEHELENYEVLSGYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLCQPE---RWIDTTATNIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVP 189          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 58.9214 bits (141), Expect = 7.327e-10
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  328 EIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKG-EVR 678
             +P  AV GG DS     Y+ R+ H+ +     +V    C +V +    H+K  Y+++V     F W  +    +P  A+ +G       L+VGR  + G L +G   P +G +Y+P+ G EVR
Sbjct:   13 PLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQG--FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVR 134          

HSP 2 Score: 50.447 bits (119), Expect = 5.679e-7
Identity = 42/157 (26.75%), Postives = 64/157 (40.76%), Query Frame = 1
Query:  259 YELLWKNKDEVDNKGMWQYGQKGEIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTD-GTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCR 708
            YE+L K + +V     W        P  AV  G DS     Y  RA+H+ +     +V      +V F  +   K  Y+++      + + W + G  +P  A+  G   N  +L+ GR  Y G L  G        +Y+PY G        +ILCR
Sbjct:  138 YEVLIKQQHDV-----WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTG----YGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILCR 285          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 58.9214 bits (141), Expect = 7.587e-10
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  328 EIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKG-EVR 678
             +P  AV GG DS     Y+ R+ H+ +     +V    C +V +    H+K  Y+++V     F W  +    +P  A+ +G       L+VGR  + G L +G   P +G +Y+P+ G EVR
Sbjct:   24 PLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQG--FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVR 145          

HSP 2 Score: 50.0618 bits (118), Expect = 6.149e-7
Identity = 42/157 (26.75%), Postives = 64/157 (40.76%), Query Frame = 1
Query:  259 YELLWKNKDEVDNKGMWQYGQKGEIPDNAVYGGCDS-----YIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTD-GTFLPEGAIIAGED-NATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCR 708
            YE+L K + +V     W        P  AV  G DS     Y  RA+H+ +     +V      +V F  +   K  Y+++      + + W + G  +P  A+  G   N  +L+ GR  Y G L  G        +Y+PY G        +ILCR
Sbjct:  149 YEVLIKQQHDV-----WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTG----YGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILCR 296          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8HAW0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031394g2 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.549e-14
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRN-----IFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVR 678
            W+     EIPDNA   G   Y+IRA HK +   G +VRG  C ++ F       + YQ++V +        F W       LP+ A++AG D  + LFV R   NG++  G     +   Y+PY GE R
Sbjct:   18 WRPASGSEIPDNAADAGGQCYVIRAEHKGEWVPGKLVRGQACAYISFGGRELPVHSYQVLVRSCTDRFGVGFTWAPVRDGVLPQRALVAGSDRGSPLFVVRGKCNGEVCTGKAVLGHHRAYVPYGGEER 146          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A267EAA7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031394g1 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.566e-14
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRN-----IFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVR 678
            W+     EIPDNA   G + Y+IRA HK +   G +VRG  C ++ F         YQ++V +        F W       LP+ A++AG D  + LFV R   NG++  G     +   Y+PY GE R
Sbjct:   32 WRPASGSEIPDNAADAGGECYVIRAEHKGEWVPGKLVRGQACAYISFGGRELPVQSYQVLVHSCTDRFGIGFTWAPVRDGVLPQRALVAGSDRGSPLFVVRGKCNGEVCTGKAVLGHNRAYVPYGGEER 160          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8JAC8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.060e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRN-----IFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVR 678
            W+     EIPDNA   G + Y+IRA HK +   G +VRG  C ++ F         YQ++V +        F W       LP+ A++AG D  + LFV R   NG++  G     +   Y+PY GE R
Sbjct:   46 WRPASGSEIPDNAADAGGECYVIRAEHKGEWVPGKLVRGQACAYISFGGRELPVQSYQVLVHSCTDRFGIGFTWAPVRDGVLPQRALVAGSDRGSPLFVVRGKCNGEVCTGKAVLGHNRAYVPYGGEER 174          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A267GJC0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031394g3 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.403e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRN-----IFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVR 678
            W+     EIPDNA   G + Y+IRA HK +   G +VRG  C ++ F         YQ++V +        F W       LP+ A++AG D  + LFV R   NG++  G     +   Y+PY GE R
Sbjct:   32 WRPASGSEIPDNAADAGGECYVIRAEHKGEWVPGKLVRGQACAYISFGGRELPVQSYQVLVHSCTDRFGIGFTWAPVRDGVLPQRALVAGSDRGSPLFVVRGKCNGEVCTGKAVLGHHRAYVPYGGEER 160          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8G878 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.564e-13
Identity = 44/129 (34.11%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRN-----IFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVR 678
            W+     EIPDNA   G + Y+IRA HK +   G +VRG  C ++ F         YQ++V +        F W       LP+ A++AG D  + LFV R   NG++  G     +   Y+PY GE R
Sbjct:   46 WRPASGSEIPDNAADAGGECYVIRAEHKGEWVPGKLVRGQACAYISFGGRELPVQSYQVLVHSCTDRFGIGFTWAPVRDGVLPQRALVAGSDRGSPLFVVRGKCNGEVCTGKAVLGHHRAYVPYGGEER 174          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000027124.1 (SMESG000027124.1)

HSP 1 Score: 387.111 bits (993), Expect = 3.444e-138
Identity = 186/188 (98.94%), Postives = 187/188 (99.47%), Query Frame = 1
Query:  151 MNGNNLEKDNVRIVTVTESDNDEPDKSDEEVTDGREYELLWKNKDEVDNKGMWQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD 714
            MNGNNLEKDNVRIVTVTESDNDEPDKSDEEVTDGREYELLWKN+DEVDNKGMWQYGQKGEIPD AVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD
Sbjct:    1 MNGNNLEKDNVRIVTVTESDNDEPDKSDEEVTDGREYELLWKNRDEVDNKGMWQYGQKGEIPDKAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD 188          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000027140.1 (SMESG000027140.1)

HSP 1 Score: 131.339 bits (329), Expect = 4.468e-38
Identity = 66/148 (44.59%), Postives = 90/148 (60.81%), Query Frame = 1
Query:  283 DEVDNKGMWQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENR----NIFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD 714
            D+ DN+  W Y   G+    AVY G  SYIIRAIH +Q  IGT++ G+    V +    H  Y YQ++V  +    +   WK+T G  +PEGAI  G D++ +LFVGRA  NG+LL+GS+R D+GI+Y  +   V    GCDILC+VD
Sbjct:    2 DQTDNETDWVYSDSGKKVPGAVYAGLKSYIIRAIHDDQRIIGTLIDGEDFARVAYNGAVHKDYAYQVLVNTKTPDCSKLVWKFTTGKIIPEGAIRGGHDSSIMLFVGRAVINGELLVGSFRVDSGILYTGFN-SVHSVAGCDILCKVD 148          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000027142.1 (SMESG000027142.1)

HSP 1 Score: 119.398 bits (298), Expect = 2.578e-33
Identity = 58/147 (39.46%), Postives = 83/147 (56.46%), Query Frame = 1
Query:  283 DEVDNKGMWQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNI----FEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRV 711
            D VD +  W Y + G+  ++ VY G +  + RAI      +G+++ G+ C ++        +Y YQ+ VE  N      EWKW  G  +PEGAI+ G D   VLF+GR A +G+LL+GSYR D G + + YK  V    GCDILC+V
Sbjct:    9 DIVDGQTKWLYNESGKYQEDTVYAGLNCRVARAICDGNRLVGSLLEGEKCVYLSSNNTVFEQYEYQVFVEENNCKNTRLEWKWASGKIVPEGAIVGGSDAGNVLFIGRTAIDGRLLVGSYRADKGKITVGYKNRVHIIPGCDILCKV 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029906.1 (SMESG000029906.1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.130e-24
Identity = 46/137 (33.58%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNI----FEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILC 705
            WQ    G IP+++V  G +SYI RA++  +   G IVRG+ C ++ +     S   Y+++V+  N     +EWK + G+ +P+G++I G D    L++GRA    +LL G ++P++G  Y+PY  +   +   D+LC
Sbjct:   18 WQKASNGHIPNDSVNAG-NSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSSRGSVIPKGSVIGGSDEGRPLYIGRARVADKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 153          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074396.1 (SMESG000074396.1)

HSP 1 Score: 92.0485 bits (227), Expect = 7.655e-23
Identity = 47/138 (34.06%), Postives = 72/138 (52.17%), Query Frame = 1
Query:  307 WQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFRKWSHSKYIYQIMVENRNI-----FEWKWTDGTFLPEGAIIAGEDNATVLFVGRAAYNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILC 705
            W     G IP  AV  G  +++ RA H  Q   G  V G     V F    H+K  Y+I+VE+  +     +EWKWT+G  +P+GA++ G ++   L+V R+    Q+++G Y P +G  Y+PY GE       ++LC
Sbjct:   18 WVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLC 155          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG105271.314e-1231.06gene:FBgn0034583 transcript:FBtr0071541[more]
CG326335.282e-1023.68gene:FBgn0052633 transcript:FBtr0073800[more]
CG326335.282e-1023.68gene:FBgn0052633 transcript:FBtr0310431[more]
CG442507.327e-1029.84gene:FBgn0265185 transcript:FBtr0339104[more]
CG442507.587e-1029.84gene:FBgn0265185 transcript:FBtr0339105[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HAW08.549e-1434.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EAA78.566e-1434.11Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8JAC81.060e-1334.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GJC01.403e-1334.11Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8G8781.564e-1334.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027124.13.444e-13898.94SMESG000027124.1[more]
SMESG000027140.14.468e-3844.59SMESG000027140.1[more]
SMESG000027142.12.578e-3339.46SMESG000027142.1[more]
SMESG000029906.15.130e-2433.58SMESG000029906.1[more]
SMESG000074396.17.655e-2334.06SMESG000074396.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027595 ID=SMED30027595|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=795bp
TCACTTGGACCTTTGAACTCATTCAGATTTAGGTAATTATAAATTTTTGG
TAATTATTTCGGTAATTTGACTAGTAAAAATATTTTTTTTATTTTTATTT
TTTCAACGAATTCGGTTTGTGGATTTTCATTATTTCTCATTGAAACGGAA
ATGAACGGGAACAATTTGGAGAAGGATAATGTAAGAATTGTCACAGTGAC
TGAGAGTGATAATGATGAACCAGATAAATCAGATGAAGAAGTGACAGATG
GCAGAGAATACGAATTGTTATGGAAAAATAAGGATGAAGTCGACAATAAA
GGTATGTGGCAGTATGGACAGAAAGGAGAGATTCCTGACAATGCCGTGTA
TGGTGGCTGTGACAGTTATATTATTCGAGCCATTCATAAAGAGCAGACCT
TTATAGGAACTATCGTTAGAGGAGATTTGTGTGGACATGTACCATTCCGT
AAATGGTCACATTCGAAATATATATATCAAATTATGGTTGAAAATAGAAA
TATATTCGAATGGAAATGGACTGATGGAACATTCCTTCCAGAGGGGGCAA
TAATTGCTGGGGAAGATAATGCGACAGTGCTTTTCGTTGGAAGAGCGGCC
TACAACGGTCAACTTCTTATCGGTTCGTATCGGCCGGATAACGGAATCGT
TTATTTACCTTATAAAGGAGAAGTGCGTGAAAGAGTAGGCTGTGATATAT
TATGTCGAGTCGACTGATTTTTGGATTTTGAAAAAATTAAAATATTTTAT
AAAAATATAAAAAGTTAATTAATAAAAATTCCATTTTTCTTTGCC
back to top

protein sequence of SMED30027595-orf-1

>SMED30027595-orf-1 ID=SMED30027595-orf-1|Name=SMED30027595-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MNGNNLEKDNVRIVTVTESDNDEPDKSDEEVTDGREYELLWKNKDEVDNK
GMWQYGQKGEIPDNAVYGGCDSYIIRAIHKEQTFIGTIVRGDLCGHVPFR
KWSHSKYIYQIMVENRNIFEWKWTDGTFLPEGAIIAGEDNATVLFVGRAA
YNGQLLIGSYRPDNGIVYLPYKGEVRERVGCDILCRVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 118..187
e-value: 1.3E-6
score: 35.2
coord: 50..115
e-value: 0.0076
score: 2.5
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 71..174
e-value: 2.6E-17
score: 62.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 43..174