Protein polyglycylase TTLL10

Overview
NameProtein polyglycylase TTLL10
Smed IDSMED30027593
Length (bp)1656
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein polyglycylase TTLL10 (SMED30027593) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein polyglycylase TTLL10 (SMED30027593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein polyglycylase TTLL10 (SMED30027593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein polyglycylase TTLL10 (SMED30027593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027593h1SMcG0015647 SmedASXL_012853SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027593h1SMcG0015647 dd_Smed_v4_14858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027593h1SMcG0015647 dd_Smed_v4_14858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027593h1SMcG0015647 dd_Smed_v4_14858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027593h1SMcG0015647 dd_Smed_v6_14858_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027593h1SMcG0015647 dd_Smed_v6_14858_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30027593h1SMcG0015647 dd_Smed_v6_14858_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30027593h1SMcG0015647 Contig10358newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027593h1SMcG0015647 Contig10358uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30027593h1SMcG0015647 dd_Smed_v4_14858_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Human
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 285.804 bits (730), Expect = 1.493e-87
Identity = 157/439 (35.76%), Postives = 237/439 (53.99%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISID------------------------------MDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRT----KATPMMIRNTKS 1396
            F + G+NG+ +ISS      + +I +    DY LKW +V S+  +  F E +Q++  +PN+ ++T K  LL +LR   R     S     +                               M+ F PETY ++  +E + F+   ++  IWI KPT  NQG GI L+R++E +  + +K  +  +         R P  R++QRYI NPLLV+ +KFD+R+Y+LIA TTP+++ +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVWSME  NRY++        ++K+WV      RM+ IM   FL+ K KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK+ +P ++  T D+V+E F K      +LPL  L   +FV   +G+ +   + G +    +  P+  R  KS
Sbjct:  159 FYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLVLETFRKSLRGQKMLPL--LSQRRFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKS 595          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Human
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 285.804 bits (730), Expect = 1.493e-87
Identity = 157/439 (35.76%), Postives = 237/439 (53.99%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISID------------------------------MDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRT----KATPMMIRNTKS 1396
            F + G+NG+ +ISS      + +I +    DY LKW +V S+  +  F E +Q++  +PN+ ++T K  LL +LR   R     S     +                               M+ F PETY ++  +E + F+   ++  IWI KPT  NQG GI L+R++E +  + +K  +  +         R P  R++QRYI NPLLV+ +KFD+R+Y+LIA TTP+++ +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVWSME  NRY++        ++K+WV      RM+ IM   FL+ K KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK+ +P ++  T D+V+E F K      +LPL  L   +FV   +G+ +   + G +    +  P+  R  KS
Sbjct:  159 FYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLVLETFRKSLRGQKMLPL--LSQRRFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKS 595          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Human
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 192.2 bits (487), Expect = 5.111e-55
Identity = 105/304 (34.54%), Postives = 161/304 (52.96%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISID------------------------------MDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWV 1003
            F + G+NG+ +ISS      + +I +    DY LKW +V S+  +  F E +Q++  +PN+ ++T K  LL +LR   R     S     +                               M+ F PETY ++  +E + F+   ++  IWI KPT  NQG GI L+R++E +  + +K  +  +         R P  R++QRYI NPLLV+ +KFD+R+Y+LIA TTP+++ +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVWSME  NRY++        ++K+WV
Sbjct:   86 FYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWV 389          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Human
Match: TTLL9 (tubulin tyrosine ligase like 9 [Source:HGNC Symbol;Acc:HGNC:16118])

HSP 1 Score: 127.872 bits (320), Expect = 1.022e-31
Identity = 101/339 (29.79%), Postives = 168/339 (49.56%), Query Frame = 2
Query:  263 FTKIANPSDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISRRP---TGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYA-NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANL--ESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            + ++ +  + D+Y  W DV       D  +  E  +I +H  N   +T K  ++++L++F +  +  +    +   D F P+T+ +    E   F E   K     WI KP   +QG GI L R    L +I+   KD  S +  +        + QRYI NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   +  N  D   +HLTN  VQK  P+Y   K    W++++F +YL +    E+   + ++ + N+F   ++S+ ++V +S KH        FEL+G+D +ID D K WL+EVN +P+L  +     +    L+E+T  VV
Sbjct:   46 WVEVKDEGEWDFY--WCDVSWLRENFDHTYMDEHVRI-SHFRNHYELTRKNYMVKNLKRFRKQLEREAGKLEAAKCD-FFPKTFEM--PCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFR---RLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDQYVHLTNVAVQKTSPDYHP-KKGCKWTLQRFRQYLASKHGPEAVETLFRD-IDNIFVKSLQSV-QKVIISDKH-------CFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVV 365          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Human
Match: TTLL9 (tubulin tyrosine ligase like 9 [Source:HGNC Symbol;Acc:HGNC:16118])

HSP 1 Score: 126.716 bits (317), Expect = 1.503e-31
Identity = 101/339 (29.79%), Postives = 168/339 (49.56%), Query Frame = 2
Query:  263 FTKIANPSDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISRRPT---GRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYA-NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANL--ESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            + ++ +  + D+Y  W DV       D  +  E  +I +H  N   +T K  ++++L++F +  +  +    +   D F P+T+ +    E   F E   K     WI KP   +QG GI L R    L +I+   KD  S +  +        + QRYI NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   +  N  D   +HLTN  VQK  P+Y   K    W++++F +YL +    E+   + ++ + N+F   ++S+ ++V +S KH        FEL+G+D +ID D K WL+EVN +P+L  +     +    L+E+T  VV
Sbjct:   14 WVEVKDEGEWDFY--WCDVSWLRENFDHTYMDEHVRI-SHFRNHYELTRKNYMVKNLKRFRKQLEREAGKLEAAKCD-FFPKTFEM--PCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFR---RLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDQYVHLTNVAVQKTSPDYHP-KKGCKWTLQRFRQYLASKHGPEAVETLFRD-IDNIFVKSLQSV-QKVIISDKH-------CFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVV 333          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Celegans
Match: ttll-9 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:Q564U4])

HSP 1 Score: 113.62 bits (283), Expect = 4.840e-27
Identity = 86/281 (30.60%), Postives = 137/281 (48.75%), Query Frame = 2
Query:  344 FTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKC---NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYH-PGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPAL 1171
            F+E KQ+I H  N   +T K  L+++ ++  R  K  S   +  + + FLP +Y +    E   F E   K     IWI KP    QG GI L R  + +     KD +           ++Q Y+ NP LV  KKFD+R Y+L+ +  P     H  G+ R S   Y+ DS D   +HLTN  V K   +Y+  +    WS+ +  R+  + +    ++SK        N + +++ +   SV++ + Q    FEL+G+D + D + K WL+EVN +P+L
Sbjct:   75 FSE-KQMICHFRNDFELTRKDFLIKNYKK-ARKAKEKSGIDVVSEFN-FLPSSYVL--PTEYHLFVEEFRKYPNDTIWIMKPVAGAQGKGIFLFRKLKHVQEWKKKDSSGS----EALPYVVQCYVHNPYLVGGKKFDVRIYVLVTSFRPLNAWVHREGFARFSHSRYSTDSVDDAFVHLTNVAVAKTAADYDPERG-LKWSLPKLFRFFKS-VHGQSKLSKT------MNDLTNVIIESLKSVQNLIIQDNHCFELYGYDILFDENLKPWLLEVNASPSL 338          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 83.5741 bits (205), Expect = 1.135e-16
Identity = 78/308 (25.32%), Postives = 140/308 (45.45%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETY------------YINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDY---ANDSDK-LLIHLTNQYVQKKDPNY---ESVKDDTV---WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNC---SVLKQKL 1204
            Q +N  P S  +T K  L +++ +         + SI  +   F+PE Y            ++  + E+      +     +I KPT+  QG GI       S+ +I ++              ++ RY+ +P LVN+ KFD+R Y+ + +  P +  +Y  G  RL+   Y   A+ +D    +HLTN  + K   ++   ES+  + +   W++    RY+  N     ++    ++++    + SI   V  + +  L      FELFGFD ++D   K WL+EVN++P+L  +    S+LK +L
Sbjct:  122 QRLNQFPRSTELTKKDRLYENIER---------SKSIFGESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFF---ANSMADIPAEGPL-----------LVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVE-NEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRL 405          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 83.5741 bits (205), Expect = 1.188e-16
Identity = 78/309 (25.24%), Postives = 141/309 (45.63%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETY------------YINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDY-----ANDSDKLLIHLTNQYVQKKDPNY---ESVKDDTV---WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNC---SVLKQKL 1204
            Q +N  P S  +T K  L +++ +         + SI  +   F+PE Y            ++  + E+      +     +I KPT+  QG GI       S+ +I ++              ++ RY+ +P LVN+ KFD+R Y+ + +  P +  +Y  G  RL+   Y     + DS++  +HLTN  + K   ++   ES+  + +   W++    RY+  N     ++    ++++    + SI   V  + +  L      FELFGFD ++D   K WL+EVN++P+L  +    S+LK +L
Sbjct:  175 QRLNQFPRSTELTKKDRLYENIER---------SKSIFGESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFF---ANSMADIPAEGPL-----------LVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEY-VHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVE-NEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRL 458          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 79.7221 bits (195), Expect = 1.461e-15
Identity = 72/282 (25.53%), Postives = 119/282 (42.20%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLR-QFERLTKLISNTSISIDMDSFLPETYYI-NNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV--WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTN 1180
            Q +NH P +  I  K  L   +R Q ER            + D  +P TY +  +  EL  + E     ++ I KP    +G GIS+ R  +      +               + Q YI  PL +N  KFD+R Y  +    P  V +Y  G +R +   Y++    +    +HLTN Y   K    + V +  V  W++     + +       +I +  ++ V      S  + +   +   L Q    +ELFG D ++D D+K WL+EVN++P+L + 
Sbjct:  153 QKVNHFPGAFHIGRKDRLWMHIRKQQERFEG---------EFD-IMPFTYILPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKDFPTTAT--------------LVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTN-YSINKLAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQRE-IEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSG 407          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 79.7221 bits (195), Expect = 1.461e-15
Identity = 72/282 (25.53%), Postives = 119/282 (42.20%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLR-QFERLTKLISNTSISIDMDSFLPETYYI-NNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV--WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTN 1180
            Q +NH P +  I  K  L   +R Q ER            + D  +P TY +  +  EL  + E     ++ I KP    +G GIS+ R  +      +               + Q YI  PL +N  KFD+R Y  +    P  V +Y  G +R +   Y++    +    +HLTN Y   K    + V +  V  W++     + +       +I +  ++ V      S  + +   +   L Q    +ELFG D ++D D+K WL+EVN++P+L + 
Sbjct:  153 QKVNHFPGAFHIGRKDRLWMHIRKQQERFEG---------EFD-IMPFTYILPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKDFPTTAT--------------LVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTN-YSINKLAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQRE-IEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSG 407          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Fly
Match: TTLL3A (gene:FBgn0031854 transcript:FBtr0079305)

HSP 1 Score: 129.028 bits (323), Expect = 6.183e-31
Identity = 91/259 (35.14%), Postives = 131/259 (50.58%), Query Frame = 2
Query:  560 NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGR-IIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVK---DDTVWSMEQFNRYLNANLESYPQISK--NWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVY 1315
            N+WI KP +  +G GI L      +DN L K L   N+S     R ++Q+YI  PL++   KFDIR + LI NT P +V  Y   YLR S ++Y+  +    +HLTN  +QKK  N +  K    + +W    F  YL        QI K   W++ +F    K+I+    L+ +  + +R   FELFG DFMI  +F  WLIE+N +P L    SV  +  P  +E+   VVI+       +T+  P   LG F+  Y
Sbjct:  416 NMWIVKPANKCRGRGIIL------MDN-LKKILGVVNLSIASKSRYVVQKYIERPLILFQTKFDIRQWFLITNTQPLVVWFYRESYLRFSSQEYSLSNHHESVHLTNYAIQKKYTNGKRDKRLPSENMWDCYSFQAYLR-------QIGKYNMWLERIFPGMRKAIV-GCMLASQENMDRRPNTFELFGADFMICENFYPWLIEINSSPDLGATTSVTARMCPQCLEDVVKVVID------RRTD--PKAELGNFELAY 651          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Fly
Match: TTLL1A (gene:FBgn0030823 transcript:FBtr0074403)

HSP 1 Score: 122.865 bits (307), Expect = 1.179e-29
Identity = 92/326 (28.22%), Postives = 162/326 (49.69%), Query Frame = 2
Query:  329 IDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQF----ERLTKLIS-----NTSISIDMDSF-----LPETYYINNSNEL--KTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLT-SPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPF-LVLYHPGYLRLSLEDY-ANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALD---TNCSVLKQKLPVLIENTFDVVI 1240
            ID  +     Q+INH PNS  ++ K  L+++++++    ER    ++     +T + I    +     +P T+ + +  ++  + F+ N    + WI KP   +QG GI L+     L        T  P I+R     +I +YI NPLL+  KKFD+R ++L+    P    LY  G+ R   E Y   + D + +HLTN  +QK +  Y S+     W ++    YL++       +    V ++  +R+ + +R    +V   ++     FE++G+D +ID++ K WLIE+N +P++    TN  +LK +   LI+N  DVV+
Sbjct:  102 IDHPYRMRSDQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDTKLGIGGTRYKHLDIIPMTFVLPSDYQMFVEVFHRN--PASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDARTFYPQINRDTC--VISKYIDNPLLIGGKKFDLRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDETEIDNVFMHLTNVSIQKTNQEYNSIHGGK-WPLQNLWLYLDS-------LRGEGVSDMLWSRITATIRHSLDAVAPVMANDRHCFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTTNDRMLKSR---LIDNVLDVVV 412          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Fly
Match: TTLL1B (gene:FBgn0052238 transcript:FBtr0073344)

HSP 1 Score: 113.235 bits (282), Expect = 2.096e-26
Identity = 102/376 (27.13%), Postives = 170/376 (45.21%), Query Frame = 2
Query:  284 SDIDYYLKWTDVHS-----QIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER---------LTKLISNTSIS---IDMDSFLPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIRDKESLDNIL--SKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPF-LVLYHPGYLRLSLEDY---ANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDT---NCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLP-LENLGLFQFVYSDD 1324
             D D++  W  V +      +D  +     Q+INH PN   ++ K  L+++++++ +           K  SN S     + +D F+P T+ +    +   F E   K   + WI KP   +QG GI LI     L      +K    P I++     +I RYI NPLL+  KKFD+R Y+L+A+  P    L+  G+ R     Y     + D + +HLTN  VQK    Y ++     WS++    YL              V +     +  ++     +V   ++     FE +G+D +ID+  K WL+EVN +P+L +   N  +LK K   LI+N   VV+       ++ N +P  + LG F+ +  ++
Sbjct:  101 GDDDWHFYWAGVQTCRNIFSVDSGYRMHDNQMINHFPNHYELSRKDLLVKNIKRYRKDLERDGNPLAEKTESNNSSGTRYLYLD-FVPTTFVL--PADYNMFVEEYRKFPLSTWIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKE--SYVISRYIDNPLLIGGKKFDLRLYVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMYVHLTNVSVQKHGGEYNTLHGGK-WSVQNLALYLEGTRGKE-------VTDRLFGAISWLIVHSLRAVAPVMASDRHCFECYGYDIIIDNALKPWLVEVNASPSLTSTTVNDRILKYK---LIDNILSVVLPPDGVPDVRWNKVPSADALGNFELLIDEE 460          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0300402)

HSP 1 Score: 106.686 bits (265), Expect = 8.472e-24
Identity = 85/313 (27.16%), Postives = 140/313 (44.73%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYI-NNSNELKTFYENIEKCNI-WIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV-----WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLS--------VKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVI 1240
            Q INH+P S  I  K +  ++L   +R     SN         F+P TY I N+   L+  +    + N  WI KP    +G GI +I     +              RRP   I+Q+YI  PLL+N  KFD+R Y+L+ +  P  V +YH G  R +   Y+  +D L    +HLTN  + K   NY   +D        W+++    YL          ++    +     ++S++ +  L+        ++  +  +   FELFGFD ++DSD   WL+EVN++P+L +   +       L++   +  +
Sbjct:  374 QKINHLPGSFRIGRKDSCWKNL---QRQMGKHSNKEFG-----FMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPK------------RRPL--IVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYL---------ANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTAL 655          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0300401)

HSP 1 Score: 106.686 bits (265), Expect = 8.472e-24
Identity = 85/313 (27.16%), Postives = 140/313 (44.73%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYI-NNSNELKTFYENIEKCNI-WIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV-----WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLS--------VKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVI 1240
            Q INH+P S  I  K +  ++L   +R     SN         F+P TY I N+   L+  +    + N  WI KP    +G GI +I     +              RRP   I+Q+YI  PLL+N  KFD+R Y+L+ +  P  V +YH G  R +   Y+  +D L    +HLTN  + K   NY   +D        W+++    YL          ++    +     ++S++ +  L+        ++  +  +   FELFGFD ++DSD   WL+EVN++P+L +   +       L++   +  +
Sbjct:  374 QKINHLPGSFRIGRKDSCWKNL---QRQMGKHSNKEFG-----FMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPK------------RRPL--IVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYL---------ANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTAL 655          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Zebrafish
Match: ttll10 (tubulin tyrosine ligase-like family, member 10 [Source:ZFIN;Acc:ZDB-GENE-081104-350])

HSP 1 Score: 281.567 bits (719), Expect = 6.025e-87
Identity = 148/382 (38.74%), Postives = 222/382 (58.12%), Query Frame = 2
Query:  221 NGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLI--SNTSISIDMDSFLPETYYINNSNELKTFY--ENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRR----------PTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDD 1324
            NG+ ++ S      + +I + +  DY LKW +  S   +  F    Q++  IPN+ ++T K  LL SLR+++R++  I   + +  + ++ F P T+ ++  +E + F+   + +K ++WI KPT LNQG GI L+R ++          T+   S R          P  RI+QRYI NPLL+  +KFD+R+Y LIA T P++V +  GY+RL+   Y  +SD +  HLTNQY+QKK+P Y  +K++TVWSME FN Y+N        + K+W    FT RM+ I+   F +VK KL  ++G F+L G DF+ID DFK WL+E+N NPAL TNC VLK  +P  +  T D+ +E F K     NLLPL +   F  +YS +
Sbjct:  107 NGASIVVSYCESRGWQRIYDKTRTDYKLKWCETKSPATYYRFRAGYQLLYQIPNNKVLTTKIGLLNSLREYDRVSSKINYGHGNRRMKLEDFCPITFRMDMKDEREAFFNESSSDKYSMWICKPTGLNQGRGIFLLRPEDITAYREKLQYTTEQQSNRKPNRKSPYNAPQARIVQRYIQNPLLLKGRKFDVRSYFLIACTQPYMVFFRHGYIRLTCNPYDPNSDNITAHLTNQYMQKKNPLYSFLKEETVWSMEHFNAYINETYMLPKGLPKDWALGPFTKRMQHIIMHCFQAVKAKLDCKLGYFDLIGCDFLIDEDFKVWLLEMNCNPALHTNCEVLKDVIPQTVTETLDLSLEIFNKSCCGLNLLPLRSQKDFLLLYSSE 488          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Zebrafish
Match: ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:ZFIN;Acc:ZDB-GENE-030131-1582])

HSP 1 Score: 122.479 bits (306), Expect = 9.755e-30
Identity = 100/331 (30.21%), Postives = 158/331 (47.73%), Query Frame = 2
Query:  287 DIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKC--NIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISR---RPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNA--NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            D ++   W DV       D  +  E  +I  H  N   +T K  ++++L+++ +  +       +   D F P T+ +   +E   F E  +K   N WI KP   +QG GI L R    L +I+   KD +     +   +    + QRYI NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   ++  S D   +HLTN  VQK  P+Y+  K    W M+Q   YL A    E+   + K  + NVF   + S+ + + ++ KH        FEL+G+D ++D D K WLIEVN +P+L  +          L+E+T  +V
Sbjct:   54 DAEWDFNWCDVGWLRENFDHSYMEEHVRIC-HFRNHYELTRKNLMVKNLKRYRKTLEREVGRLEAAKCD-FFPRTFEL--PSEYHIFVEEFKKSPGNTWIMKPVARSQGKGIFLFR---KLKDIIDWRKDGSRSEEQKDEAQVESYVAQRYIENPYLIAGRKFDLRVYVLVTSYIPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQKTAPDYDPEKG-CKWQMQQLRWYLTAKHGFETVQTLFKE-IDNVFIRSLLSVQKTI-INDKH-------CFELYGYDILLDQDLKPWLIEVNASPSLTASSQEDYDLKYRLLEDTLHIV 367          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Zebrafish
Match: ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:ZFIN;Acc:ZDB-GENE-030131-1582])

HSP 1 Score: 122.094 bits (305), Expect = 1.077e-29
Identity = 100/331 (30.21%), Postives = 158/331 (47.73%), Query Frame = 2
Query:  287 DIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKC--NIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISR---RPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNA--NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            D ++   W DV       D  +  E  +I  H  N   +T K  ++++L+++ +  +       +   D F P T+ +   +E   F E  +K   N WI KP   +QG GI L R    L +I+   KD +     +   +    + QRYI NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   ++  S D   +HLTN  VQK  P+Y+  K    W M+Q   YL A    E+   + K  + NVF   + S+ + + ++ KH        FEL+G+D ++D D K WLIEVN +P+L  +          L+E+T  +V
Sbjct:   54 DAEWDFNWCDVGWLRENFDHSYMEEHVRIC-HFRNHYELTRKNLMVKNLKRYRKTLEREVGRLEAAKCD-FFPRTFEL--PSEYHIFVEEFKKSPGNTWIMKPVARSQGKGIFLFR---KLKDIIDWRKDGSRSEEQKDEAQVESYVAQRYIENPYLIAGRKFDLRVYVLVTSYIPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQKTAPDYDPEKG-CKWQMQQLRWYLTAKHGFETVQTLFKE-IDNVFIRSLLSVQKTI-INDKH-------CFELYGYDILLDQDLKPWLIEVNASPSLTASSQEDYDLKYRLLEDTLHIV 367          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Zebrafish
Match: ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:ZFIN;Acc:ZDB-GENE-100922-236])

HSP 1 Score: 122.865 bits (307), Expect = 7.249e-29
Identity = 102/363 (28.10%), Postives = 169/363 (46.56%), Query Frame = 2
Query:  200 GFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK-CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGR--IIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLES----YPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
             F +V T  S+++  +L+   F ++ +P+  D+ L WT  H +       +  Q +NH P S  +T K  L +++++ ++        S      S +P+T+ +    E + F  +  K    WI KP   ++G GI L+                 NIS+ P     ++ RYI NPLL++  KFD+R Y+L+ +  P ++ LY  G  R +   Y + +  +    +HLTN  V KK  +Y S  D  V      WSM    RYL    +       QI    +K V +  +      +  S K  +  R   FEL+GFD +IDS+ K WL+EVN++P+L  +  +  +    +I + F +V
Sbjct:   61 AFKIVRTE-SRLVRGILVNHGFHEV-HPNSNDFNLMWTGSHLKPYLLRSLQDFQKVNHFPRSYELTRKDRLYKNIQRMQQ--------SHGFHNFSIVPQTFVL--PAEYQEFSNSFSKDKGPWIIKPVASSRGRGIYLVS----------------NISQIPLDENILVSRYISNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVKYDHATANIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEI-----HIATSCKMFVPHRCNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFSLV 390          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Zebrafish
Match: ttll1 (tubulin tyrosine ligase-like family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1326])

HSP 1 Score: 119.398 bits (298), Expect = 9.501e-29
Identity = 106/383 (27.68%), Postives = 182/383 (47.52%), Query Frame = 2
Query:  254 KMDFTKIANPSDIDYYLKWTDVHS-----QIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTKLISNTSISIDMDS-------FLPETYYINNSNELKTFYENIEKC--NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGR---IIQRYIMNPLLVNSKKFDIRAYMLIANTTPF-LVLYHPGYLRLSLEDYA---NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCS---VLKQKLPVLIENTFDVVIECFEKCKMKTNL-LPLENLGLFQFVYSDD 1324
            K  + ++ +  D ++Y  W  + +      +D  +     Q++NH PN   +T K  ++++++++ R L K   N++++   DS       F+P T+ +     L  F E   K   + WI KP    QG GI LI +K S     S+D  +       +G+   +I  YI NPLL+  KKFD+R Y+L+    P    +Y  G+ R     Y    ++ D + +HLTN  +QK   +Y  V     W++     YL +     P ++     N   +++  I+ Q   +V   ++     FE +G+D +ID   K WLIEVN +P+L ++ +   +LK     LI +T ++V    E    + N  LP E LG +Q +Y ++
Sbjct:   22 KRGWIQVTDSEDWNFY--WMSIQTIRTVFSVDTGYRLTDDQMVNHFPNHYELTRKDLMIKNIKRYRRELEK--ENSALAEKDDSGKYIYLDFVPVTFMLPADYNL--FVEEFRKSPSSTWIMKPCGKAQGKGIFLI-NKLSQIKKWSRDSRTSTFVAANSGKEAYVISLYIDNPLLIGGKKFDLRLYVLVTTYRPLKCYMYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHGDDYNHVHGGK-WTVSNLRLYLESTRG--PDVT-----NHLFDQIHWIIVQSLKAVAPVMNNDKHCFECYGYDIIIDDRLKPWLIEVNASPSLTSSTANDRILKYN---LINDTLNIVTPNAEIPDCRWNRSLPKEALGHYQVLYDEE 386          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Xenopus
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:NCBI gene;Acc:101733827])

HSP 1 Score: 302.753 bits (774), Expect = 1.584e-95
Identity = 165/436 (37.84%), Postives = 259/436 (59.40%), Query Frame = 2
Query:  236 ISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSK--DLTSPNISRRP-----TGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRN-SPTLNSNNRETDRK------RKPNKSTTTFIKRIQRP 1501
            +++  +   + +I +    DY LKW ++ S   +  F   +Q++  IPN+ ++T+K  LL SLR++ER+ + ++   + + M  F PET+ ++   E +TF+   ++   WI KPT LNQG GI L++ +E +  + S+  DL   +  ++P       RI QRYI NPLL++ +KFD+R+YM+IA+TTP+ V +  GY+RL+  +Y   SD L  HLTNQY+QKK+P Y  +K++TVW ME+FN Y+N    S   + ++WV N FT RM+ IM   FLSVK KL  R+G F+L G DF++D DFK WL+E+N NPAL TNC VL++ +P ++  T D+ +E F K +   +++PL     F  +Y+ +   +  +Y  R++ T        SPS+N SP    + RE   K      +KP  S+   I  + +P
Sbjct:   20 VTAYCVSKGWQRIYDSKREDYRLKWCELKSSNTYYVFKAGEQLVYQIPNNKLLTSKIGLLNSLREYERVMQRLNRIRV-LKMSDFFPETFRLDLKEERETFFSLFKE--TWICKPTGLNQGRGIFLLKSQEQISTLKSQFQDLNDESTVKKPRFRCPQARITQRYIPNPLLLDERKFDVRSYMVIASTTPYFVFFSHGYVRLTCNNYDPKSDDLTGHLTNQYMQKKNPLYSELKEETVWGMERFNNYVNEKFASDKGLPQDWVLNNFTKRMQQIMMHCFLSVKSKLDCRLGFFDLIGCDFLVDEDFKVWLLEMNCNPALHTNCEVLREVIPGVVNETLDLTLEIFTKSQKNQHIMPLNAQNKFILLYNGENNEHAVKYL-RSRTT--------SPSKNPSPLQTESCREQPVKNTEKTPKKPKFSSDHGIVNVIKP 443          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 126.331 bits (316), Expect = 8.870e-30
Identity = 100/353 (28.33%), Postives = 166/353 (47.03%), Query Frame = 2
Query:  227 SKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQID-WEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK-CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDY---ANDSDKLLIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV-IEC 1246
            S+++ S+L    F ++ N +  D+ + WT  H +       T F Q +NH P S  +T K  L +++++ ++        S        LP+TY +    E + F     K    WI KP   ++G G+ LI               SP++       ++ RYI NPLL++  KFD+R Y+LI +  P ++ LY  G  R +   Y   A +     +HLTN  V KK  +Y S  D  V      WSM    RYL  + +    +  + V+++    + S    +  + K  ++ R   FEL+GFD +ID + K WL+EVN++P+L  +  +  +    +I + F +V +EC
Sbjct:   69 SRLVRSILSAHGFQEV-NANSNDFNIMWTGSHVKPHIMRSLTNF-QKVNHFPRSYELTRKDRLYKNVQRMQQ--------SHGFKNFHLLPQTYLL--PAEYQDFCTAFAKDRGPWIVKPVASSRGRGVYLI--------------NSPSLISMEDNILVSRYIGNPLLIDGFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAAL-MSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGVEC 394          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 120.939 bits (302), Expect = 6.840e-29
Identity = 97/349 (27.79%), Postives = 163/349 (46.70%), Query Frame = 2
Query:  227 SKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQID-WEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK-CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDY---ANDSDKLLIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            S+++ S+L    F ++ N +  D+ + WT  H +       T F+++ NH P S  +T K  L +++++ ++        S        LP+TY +    E + F     K    WI KP   ++G G+ LI               SP++       ++ RYI NPLL++  KFD+R Y+LI +  P ++ LY  G  R +   Y   A +     +HLTN  V KK  +Y S  D  V      WSM    RYL  + +    +    V+++    + S    +  + K  ++ R   FEL+GFD +ID + K WL+EVN++P+L  +  +  +    +I + F +V
Sbjct:   88 SRLVRSILSAHGFQEV-NANSNDFNIMWTGSHVKPHIMRSLTNFQKV-NHFPRSYELTRKDRLYKNVQRMQQ--------SHGFKNFHLLPQTYLL--PAEYQDFCTAFAKDRGPWIVKPVASSRGRGVYLI--------------NSPSLISMEDNILVSRYIGNPLLIDGFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAALMSQ-VEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLV 409          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Xenopus
Match: ablim2 (actin binding LIM protein family member 2 [Source:Xenbase;Acc:XB-GENE-490231])

HSP 1 Score: 114.005 bits (284), Expect = 2.040e-26
Identity = 87/284 (30.63%), Postives = 133/284 (46.83%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSF-LPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNY----ESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFT-NRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCS 1186
            Q +NH P +  +  K  L    R  +R+  +   +       +F LP  Y    +   K      +K + WI KPTDL++G GI + +D         KDL            I+Q+YI NPLL++  KFD+R Y+ + +  P  V +Y  G +R + E +   S D +  HLTN  + K   +Y    E V     W++ QF  YL+  L+         V +V    ++ +I+    L++   +      FELFGFD +ID   K WL+EVN +PAL  +CS
Sbjct:   88 QRLNHHPRTSQMIKKDCLA---RHLKRMKGIYGPSYYEFSPVAFILPNEYTAFVAQYTKE--RRDKKSSYWICKPTDLSRGRGIFIFQD--------IKDLA------YDCAVIVQKYITNPLLISGYKFDLRIYVCVTSFCPLTVYVYQEGLVRFATEKFDLSSLDNVFSHLTNTSINKYSASYNTEKERVGSGCKWTLGQFRSYLHG-LD---------VDDVLLWQKIYNIVTMTLLAIAPYIPPTPNCFELFGFDILIDDTLKPWLLEVNYSPALSLDCS 342          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 111.694 bits (278), Expect = 4.153e-25
Identity = 80/265 (30.19%), Postives = 127/265 (47.92%), Query Frame = 2
Query:  488 FLPETYYINNSNELKTFYENIEK-CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDY---ANDSDKLLIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV-IEC 1246
             LP+TY +    E + F     K    WI KP   ++G G+ LI               SP++       ++ RYI NPLL++  KFD+R Y+LI +  P ++ LY  G  R +   Y   A +     +HLTN  V KK  +Y S  D  V      WSM    RYL  + +    +  + V+++    + S    +  + K  ++ R   FEL+GFD +ID + K WL+EVN++P+L  +  +  +    +I + F +V +EC
Sbjct:  130 LLPQTYLL--PAEYQDFCTAFAKDRGPWIVKPVASSRGRGVYLI--------------NSPSLISMEDNILVSRYIGNPLLIDGFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAAL-MSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGVEC 377          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Mouse
Match: Ttll10 (tubulin tyrosine ligase-like family, member 10 [Source:MGI Symbol;Acc:MGI:1921855])

HSP 1 Score: 292.352 bits (747), Expect = 9.260e-93
Identity = 151/392 (38.52%), Postives = 229/392 (58.42%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTK---LISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSR 1345
            F + GTNG+ +IS+      + +  +    DY LKW ++  + ++  F E +Q++  +PN+ ++T K  LL +LR+  R L+K   L S  +  + M+ F PETY ++  +E + F+   ++  +WI KPT  NQG GI LIR +E    + +K  +  +         R P  R++QRY+ NPLL++ KKFD+R+YMLIA   P++V +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVW+ME  NRY+N        + ++WV   FT RM+ IM   FL+VK KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK  +P ++  T D+ +E  +K      +LPL +   F  +Y+ +    W R
Sbjct:   55 FYIGGTNGASIISNYCESKGWQRTQDSHCEDYKLKWCEIKCRDNYCSFREGQQLLFQLPNNKLLTTKIGLLSALREHARTLSKARMLPSTQTKVLKMEEFFPETYRLDIRDERQAFFALFDETQMWICKPTASNQGKGIFLIRSQEEAAALQAKTQSIEDDPIYRKMPFRAPQARVVQRYVQNPLLLDGKKFDVRSYMLIACAMPYMVFFGHGYARLTLSLYNPHSSDLSGHLTNQFMQKKSPLYTLLKESTVWTMEHLNRYINDKFRKTKGLPRDWVFTTFTKRMQQIMSHCFLAVKSKLECKLGYFDLIGCDFLIDENFKVWLLEMNANPALHTNCEVLKAVIPGVVIETLDLALETCQKSLHSQKMLPLLSQRRFVLLYNGETTDLWPR 446          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Mouse
Match: Ttll10 (tubulin tyrosine ligase-like family, member 10 [Source:MGI Symbol;Acc:MGI:1921855])

HSP 1 Score: 295.434 bits (755), Expect = 2.077e-91
Identity = 151/392 (38.52%), Postives = 229/392 (58.42%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTK---LISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSR 1345
            F + GTNG+ +IS+      + +  +    DY LKW ++  + ++  F E +Q++  +PN+ ++T K  LL +LR+  R L+K   L S  +  + M+ F PETY ++  +E + F+   ++  +WI KPT  NQG GI LIR +E    + +K  +  +         R P  R++QRY+ NPLL++ KKFD+R+YMLIA   P++V +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVW+ME  NRY+N        + ++WV   FT RM+ IM   FL+VK KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK  +P ++  T D+ +E  +K      +LPL +   F  +Y+ +    W R
Sbjct:  144 FYIGGTNGASIISNYCESKGWQRTQDSHCEDYKLKWCEIKCRDNYCSFREGQQLLFQLPNNKLLTTKIGLLSALREHARTLSKARMLPSTQTKVLKMEEFFPETYRLDIRDERQAFFALFDETQMWICKPTASNQGKGIFLIRSQEEAAALQAKTQSIEDDPIYRKMPFRAPQARVVQRYVQNPLLLDGKKFDVRSYMLIACAMPYMVFFGHGYARLTLSLYNPHSSDLSGHLTNQFMQKKSPLYTLLKESTVWTMEHLNRYINDKFRKTKGLPRDWVFTTFTKRMQQIMSHCFLAVKSKLECKLGYFDLIGCDFLIDENFKVWLLEMNANPALHTNCEVLKAVIPGVVIETLDLALETCQKSLHSQKMLPLLSQRRFVLLYNGETTDLWPR 535          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Mouse
Match: Ttll10 (tubulin tyrosine ligase-like family, member 10 [Source:MGI Symbol;Acc:MGI:1921855])

HSP 1 Score: 295.819 bits (756), Expect = 3.160e-91
Identity = 151/392 (38.52%), Postives = 229/392 (58.42%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTK---LISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSR 1345
            F + GTNG+ +IS+      + +  +    DY LKW ++  + ++  F E +Q++  +PN+ ++T K  LL +LR+  R L+K   L S  +  + M+ F PETY ++  +E + F+   ++  +WI KPT  NQG GI LIR +E    + +K  +  +         R P  R++QRY+ NPLL++ KKFD+R+YMLIA   P++V +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVW+ME  NRY+N        + ++WV   FT RM+ IM   FL+VK KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK  +P ++  T D+ +E  +K      +LPL +   F  +Y+ +    W R
Sbjct:  173 FYIGGTNGASIISNYCESKGWQRTQDSHCEDYKLKWCEIKCRDNYCSFREGQQLLFQLPNNKLLTTKIGLLSALREHARTLSKARMLPSTQTKVLKMEEFFPETYRLDIRDERQAFFALFDETQMWICKPTASNQGKGIFLIRSQEEAAALQAKTQSIEDDPIYRKMPFRAPQARVVQRYVQNPLLLDGKKFDVRSYMLIACAMPYMVFFGHGYARLTLSLYNPHSSDLSGHLTNQFMQKKSPLYTLLKESTVWTMEHLNRYINDKFRKTKGLPRDWVFTTFTKRMQQIMSHCFLAVKSKLECKLGYFDLIGCDFLIDENFKVWLLEMNANPALHTNCEVLKAVIPGVVIETLDLALETCQKSLHSQKMLPLLSQRRFVLLYNGETTDLWPR 564          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Mouse
Match: Ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:MGI Symbol;Acc:MGI:1913589])

HSP 1 Score: 124.405 bits (311), Expect = 3.949e-30
Identity = 102/367 (27.79%), Postives = 169/367 (46.05%), Query Frame = 2
Query:  263 FTKIANPSDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTG--------------------------------RIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYA-NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNW---VKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            + ++ +  + D+Y  W DV       D  +  E  +I +H  N   +T K  ++++L++F +  +  S  + +   D F P+T+ +    E   F E   K     WI KP   +QG GI L R    L +I+  D       ++PTG                                 + QRY+ NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   +  N  D   +HLTN  VQK  P+Y  +K    W +++F +YL +  +  P+  +     + N+F   ++S+ ++V +S KH        FEL+G+D +ID D K WL+EVN +P+L  +     +    L+E+T  VV
Sbjct:   46 WVEVKDEGEWDFY--WCDVSWLRENFDHTYMDEHVRI-SHFRNHYELTRKNYMVKNLKRFRKYLERESGKTEAAKCD-FFPKTFEM--PCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFR---RLKDIM--DWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLPVENYVAQRYVENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDHYVHLTNVAVQKTSPDYH-LKKGCKWMLQRFRQYLAS--KHGPKAVETLFSDMDNIFIKSLQSV-QKVIISDKH-------CFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVV 390          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Mouse
Match: Ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:MGI Symbol;Acc:MGI:1913589])

HSP 1 Score: 124.02 bits (310), Expect = 5.604e-30
Identity = 108/396 (27.27%), Postives = 180/396 (45.45%), Query Frame = 2
Query:  263 FTKIANPSDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTG--------------------------------RIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYA-NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNW---VKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLE-NLGLFQFVYSD 1321
            + ++ +  + D+Y  W DV       D  +  E  +I +H  N   +T K  ++++L++F +  +  S  + +   D F P+T+ +    E   F E   K     WI KP   +QG GI L R    L +I+  D       ++PTG                                 + QRY+ NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   +  N  D   +HLTN  VQK  P+Y  +K    W +++F +YL +  +  P+  +     + N+F   ++S+ ++V +S KH        FEL+G+D +ID D K WL+EVN +P+L  +     +    L+E+T  VV        M+  L   E  +G F  +++D
Sbjct:   46 WVEVKDEGEWDFY--WCDVSWLRENFDHTYMDEHVRI-SHFRNHYELTRKNYMVKNLKRFRKYLERESGKTEAAKCD-FFPKTFEM--PCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFR---RLKDIM--DWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLPVENYVAQRYVENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDHYVHLTNVAVQKTSPDYH-LKKGCKWMLQRFRQYLAS--KHGPKAVETLFSDMDNIFIKSLQSV-QKVIISDKH-------CFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVV-------DMEARLTGKEKRVGGFDLMWND 412          
BLAST of Protein polyglycylase TTLL10 vs. UniProt/SwissProt
Match: sp|Q5XI57|TTL10_RAT (Protein polyglycylase TTLL10 OS=Rattus norvegicus OX=10116 GN=Ttll10 PE=2 SV=2)

HSP 1 Score: 305.449 bits (781), Expect = 2.043e-94
Identity = 165/462 (35.71%), Postives = 258/462 (55.84%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERL---TKLISNTSISI-DMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEK 1555
            F + GTNG+ +IS+      + +  +    DY LKW ++  + ++  F E +Q++  +PN+ ++T K  LL +LR+  R     +L+ +T   +  MD F PETY ++  +E + F+   ++  +WI KPT  NQG GI LIR +E    + +K  +  +         R P  R++QRY+ NPLL++ KKFD+R+YMLIA   P++V +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +KD TVWSME  NRY+N        + ++WV   FT RM+ IM   FL+VK KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK+ +P ++  T D+ +E  +K      +LPL++   F  +Y+ +    W R           + +++ P R  P  NSN+  +  +   +  T+T +    RP++     +R  P+  + K
Sbjct:  176 FYIGGTNGASIISNYCESKGWQRTQDSRCEDYKLKWCEIKCRDNYCSFREGQQLLFQLPNNKLLTTKIGLLSALREHARTLSKARLMPSTQAKVLKMDEFFPETYRLDIRDERQAFFTLFDETQMWICKPTASNQGKGIFLIRSQEEAAALQAKTQSIEDDPIYRKMPFRAPQARVVQRYVQNPLLLDGKKFDVRSYMLIACAMPYMVFFGHGYARLTLSLYNPHSSDLSGHLTNQFMQKKSPLYMLLKDSTVWSMEHLNRYINDKFRKSKGLPRDWVFTTFTKRMQQIMSHCFLAVKSKLECKLGYFDLIGCDFLIDENFKVWLLEMNSNPALHTNCEVLKEVIPGVVMETLDLALETCQKSLHSQKMLPLQSQRRFVLLYNGETTDLWPR-----------LGSSRPPIR-LPYANSNHARSTCEISSSSLTSTRVTIADRPAARKSMSSRTAPICASRK 625          
BLAST of Protein polyglycylase TTLL10 vs. UniProt/SwissProt
Match: sp|A4Q9F3|TTL10_MOUSE (Protein polyglycylase TTLL10 OS=Mus musculus OX=10090 GN=Ttll10 PE=1 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.846e-90
Identity = 151/392 (38.52%), Postives = 229/392 (58.42%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTK---LISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSR 1345
            F + GTNG+ +IS+      + +  +    DY LKW ++  + ++  F E +Q++  +PN+ ++T K  LL +LR+  R L+K   L S  +  + M+ F PETY ++  +E + F+   ++  +WI KPT  NQG GI LIR +E    + +K  +  +         R P  R++QRY+ NPLL++ KKFD+R+YMLIA   P++V +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVW+ME  NRY+N        + ++WV   FT RM+ IM   FL+VK KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK  +P ++  T D+ +E  +K      +LPL +   F  +Y+ +    W R
Sbjct:  173 FYIGGTNGASIISNYCESKGWQRTQDSHCEDYKLKWCEIKCRDNYCSFREGQQLLFQLPNNKLLTTKIGLLSALREHARTLSKARMLPSTQTKVLKMEEFFPETYRLDIRDERQAFFALFDETQMWICKPTASNQGKGIFLIRSQEEAAALQAKTQSIEDDPIYRKMPFRAPQARVVQRYVQNPLLLDGKKFDVRSYMLIACAMPYMVFFGHGYARLTLSLYNPHSSDLSGHLTNQFMQKKSPLYTLLKESTVWTMEHLNRYINDKFRKTKGLPRDWVFTTFTKRMQQIMSHCFLAVKSKLECKLGYFDLIGCDFLIDENFKVWLLEMNANPALHTNCEVLKAVIPGVVIETLDLALETCQKSLHSQKMLPLLSQRRFVLLYNGETTDLWPR 564          
BLAST of Protein polyglycylase TTLL10 vs. UniProt/SwissProt
Match: sp|Q4R7H0|TTL10_MACFA (Protein polyglycylase TTLL10 OS=Macaca fascicularis OX=9541 GN=TTLL10 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 1.726e-89
Identity = 164/460 (35.65%), Postives = 247/460 (53.70%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLR----QFERLTKLISNTSISID--------------------------MDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWN-WSRYFGRT---KATPMMIRNTKSPSRNSPTLNSNNRETDRKRKP 1459
            F + G NG+ +ISS      + +I +    DY LKW +V S+  +  F E +Q++  +PN+ ++T K  LL +LR       + +K    T   +                           M+ F PETY ++  +E + F+   ++  IWI KPT  NQG GI L+R++E +  + +K   + +         R P  R++QRYI NPLL++ +KFD+R+Y+LIA TTP+++ +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+DTVWSME+ NRY+N        + K+WV    T RM+ IM   FL+ K KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK+ +P ++  T D+ +E F+K      +LPL  L   +FV   +G+ + W R  G     +  P   R  K  S   PT  + ++   R+  P
Sbjct:   86 FYIGGNNGAAIISSYCKSKGWRRIQDSRREDYVLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRAWAMSKASKAPGGTQARLGKDATAPTLEDLPWTSPGHLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRRAEDDPIHHKSPFRGPQARVVQRYIQNPLLLDGRKFDVRSYLLIACTTPYMIFFSHGYARLTLSLYDPHSSDLSGHLTNQFMQKKSPLYVLLKEDTVWSMERLNRYINTTFWKARGLPKDWVFTTLTKRMQQIMAHCFLAAKSKLECKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLALETFQKSLRGQKMLPL--LSQRRFVLLHNGEADVWPRLGGSCSLRRRLPPPTRQAK--SSGPPTPRAPDQPGTRRPVP 541          
BLAST of Protein polyglycylase TTLL10 vs. UniProt/SwissProt
Match: sp|Q6ZVT0|TTL10_HUMAN (Inactive polyglycylase TTLL10 OS=Homo sapiens OX=9606 GN=TTLL10 PE=1 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 7.170e-87
Identity = 157/439 (35.76%), Postives = 237/439 (53.99%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISID------------------------------MDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS-------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRT----KATPMMIRNTKS 1396
            F + G+NG+ +ISS      + +I +    DY LKW +V S+  +  F E +Q++  +PN+ ++T K  LL +LR   R     S     +                               M+ F PETY ++  +E + F+   ++  IWI KPT  NQG GI L+R++E +  + +K  +  +         R P  R++QRYI NPLLV+ +KFD+R+Y+LIA TTP+++ +  GY RL+L  Y   S  L  HLTNQ++QKK P Y  +K+ TVWSME  NRY++        ++K+WV      RM+ IM   FL+ K KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK+ +P ++  T D+V+E F K      +LPL  L   +FV   +G+ +   + G +    +  P+  R  KS
Sbjct:  159 FYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLVLETFRKSLRGQKMLPL--LSQRRFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKS 595          
BLAST of Protein polyglycylase TTLL10 vs. UniProt/SwissProt
Match: sp|Q23SI8|TTLL1_TETTS (Probable alpha-tubulin polyglutamylase Ttll1 OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=Ttll1 PE=3 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 4.890e-30
Identity = 93/309 (30.10%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDS------FLPETYYINNSNELKTFYENIEKC--NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSP-NISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYAND---SDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNW--VKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVI 1240
            QIINH PN   +T K  ++++ +++++  +  ++     D +       F+P+T+ +    E   F E   +     WI KP   +QG GI L+R  + L  I     ++P          ++ RYI NPLLV  +KFD+R Y L+ +  P  V LY  G+ R   E Y  D    D + IHLTN  +QK    Y S K    WS++    YL   +      +K +  + N+    +KS+ + + ++ KH        FE++G+D +ID + K WLIE+N +P+L     + K+    LI+N + +VI
Sbjct:   63 QIINHFPNHYELTRKDLMVKNFKRYKKELEKENSPYCQKDENGNYLYLDFIPQTFTL--PGEYSLFVEEFHRNPNATWIVKPASRSQGKGIFLLRKIQQLKKIGGGTNSNPLQAFSLKEAYVVSRYIDNPLLVGGRKFDLRIYALVTSYRPLKVYLYAMGFGRFCNEQYTQDIAEMDNMFIHLTNVAIQKFSDKY-SEKHGGKWSLQSLRYYLEM-VYGTDMANKCFDDINNIIIMSLKSV-QSIIINDKH-------CFEMYGYDILIDENCKPWLIEINASPSLTVTGKIDKELKTELIKNVYQIVI 359          
BLAST of Protein polyglycylase TTLL10 vs. TrEMBL
Match: R7UBF8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_182727 PE=4 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 5.040e-118
Identity = 185/425 (43.53%), Postives = 269/425 (63.29%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKD------LTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKT--WLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKR 1453
            + L G NG  +I   L  + + KI +  D  Y  KW ++ +QI++  F E +Q++NHIPN  ++TNK  L+ SLR+++R+   +   S  +D   F+PETY +++ NE + FYE   + +IWI KPT  NQG GI L R  E +  +++++      L   N   RP  RIIQRYI NPLL++ +KFDIRAYMLIANTTP+LVLYH GY+RL + DYA +++ L+ HLTNQY+QKKDP Y+  K+DTVWSM++FN Y+N NL     + +NWV +  TNRMK IM   F +VKH+L  +VG  +L+G DFM+D + K   WLIE+NVNP+L TNC  LK+ +P +++ T  + IECFEK +    LLPL++L  F  +++       ++  G T+A+   I  T  PS+      ++++   R R
Sbjct:    5 YYLGGGNGVSIIEETLSGLGYKKIKDKQDESYRFKWVELKAQINYHTFREGEQMVNHIPNCHLLTNKLGLVNSLREYDRMCTNVKKKSSKLD---FIPETYKLDDKNERELFYELFTEGDIWICKPTGKNQGKGIFLARHIEEVTQVVAENEAINQRLKESNRPTRPLNRIIQRYIPNPLLLDGRKFDIRAYMLIANTTPYLVLYHKGYVRLCMHDYATNAESLVAHLTNQYIQKKDPQYKDSKEDTVWSMDKFNDYVNKNLAQDKGLEQNWVYDTLTNRMKQIMTYCFTAVKHRLQCKVGYSDLYGLDFMVDDEMKASVWLIEINVNPSLATNCEALKEVMPPMVKETIYLSIECFEKSRRNRPLLPLQSLQNFTILHNGSP----AKATGATRASHRSITAT-PPSKLQSASAADDQGNKRSR 421          
BLAST of Protein polyglycylase TTLL10 vs. TrEMBL
Match: A0A1I8J2I4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016686g1 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 2.053e-116
Identity = 178/388 (45.88%), Postives = 249/388 (64.18%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESL-DNILSKDLTSPNI-----SRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESY-----------PQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVY 1315
            ++  G NG  ++ + + ++ +TK  + +  D+ L WT+    +++  F E +Q++NHIPN ++I NK  LL SLR+FER++  +S+  +S+ M  F PETY ++   E + F+E  +   IWI KPT LNQG GI LIRD     + +  KD   P+      + +  GRI+QRYIMNPLL++ +KFD+RAYMLI +T P+LVL+H GYLRLS+  Y  D   L  HLTNQY+QKKD  YE VK+DTVWSM Q N YLN+ LES            P   K+WV N     MKSI+  +F +VKHKL+ R+G FEL+G DFMID ++K +LIEVN NPA+  NC +LK  LP LI+ T  + ++CF+K K    LLPL++LG FQ ++
Sbjct:  154 YLAQGHNGQALVEAAMSRLGWTKTTDKTSDDWKLSWTETKGMVNYGNFREGRQLVNHIPNCELICNKLGLLTSLREFERVSVSMSSRQLSMQMTDFFPETYVLDYPREREAFFEAFKPGEIWINKPTGLNQGKGIFLIRDLAKFREELQQKDEQKPSAGNQAKAGKSMGRIVQRYIMNPLLIHGRKFDVRAYMLIGSTAPYLVLFHHGYLRLSIHKYDTDDSNLCTHLTNQYIQKKDEKYEEVKNDTVWSMAQLNDYLNSLLESENKEAEDGKRAPPPPEKDWVFNGMEKHMKSILLHMFSAVKHKLTARLGYFELYGIDFMIDDNYKLFLIEVNTNPAMHVNCQLLKDLLPPLIDRTIHIALDCFDKSKKGLQLLPLKSLGSFQVLH 541          
BLAST of Protein polyglycylase TTLL10 vs. TrEMBL
Match: A0A1I8IYK1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.846e-115
Identity = 178/388 (45.88%), Postives = 249/388 (64.18%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESL-DNILSKDLTSPNI-----SRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESY-----------PQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVY 1315
            ++  G NG  ++ + + ++ +TK  + +  D+ L WT+    +++  F E +Q++NHIPN ++I NK  LL SLR+FER++  +S+  +S+ M  F PETY ++   E + F+E  +   IWI KPT LNQG GI LIRD     + +  KD   P+      + +  GRI+QRYIMNPLL++ +KFD+RAYMLI +T P+LVL+H GYLRLS+  Y  D   L  HLTNQY+QKKD  YE VK+DTVWSM Q N YLN+ LES            P   K+WV N     MKSI+  +F +VKHKL+ R+G FEL+G DFMID ++K +LIEVN NPA+  NC +LK  LP LI+ T  + ++CF+K K    LLPL++LG FQ ++
Sbjct:  222 YLAQGHNGQALVEAAMSRLGWTKTTDKTSDDWKLSWTETKGMVNYGNFREGRQLVNHIPNCELICNKLGLLTSLREFERVSVSMSSRQLSMQMTDFFPETYVLDYPREREAFFEAFKPGEIWINKPTGLNQGKGIFLIRDLAKFREELQQKDEQKPSAGNQAKAGKSMGRIVQRYIMNPLLIHGRKFDVRAYMLIGSTAPYLVLFHHGYLRLSIHKYDTDDSNLCTHLTNQYIQKKDEKYEEVKNDTVWSMAQLNDYLNSLLESENKEAEDGKRAPPPPEKDWVFNGMEKHMKSILLHMFSAVKHKLTARLGYFELYGIDFMIDDNYKLFLIEVNTNPAMHVNCQLLKDLLPPLIDRTIHIALDCFDKSKKGLQLLPLKSLGSFQVLH 609          
BLAST of Protein polyglycylase TTLL10 vs. TrEMBL
Match: A0A1I8ILK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.333e-115
Identity = 182/411 (44.28%), Postives = 255/411 (62.04%), Query Frame = 2
Query:  191 TKNGFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESL-DNILSKDLTSPNISR----RPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISK------------NWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATP 1372
             +N ++L G NG+ ++   + KM +T+ ++    ++ L+WT+    I++    +  Q++NHIPN ++I NK  LL SLR+FER+T  + N    + +  F PETY ++   E + F+E  +   IWI KPT LNQG GI L+RD     + + +K+    N S     +  GRI+QRYIM+PLL+  +KFDIR Y+LIA+TTPFLVLYH GYLRLS+  Y  +   L  HLTNQY+QKKD  YE VKDDTVWSMEQFN YLN   +  P  S             NWV      +MK+I++ +F +VKHKL+ R+G FEL+G DFM+DSD+K +LIEVN NPA+  NC +L   LP LIE+T  + +ECFEK K + +LLPL+N   F  ++   G  N S    +  ++P
Sbjct:   38 VQNVYLLQGHNGAALVEMAMDKMGWTRTSDKLSDNWKLRWTETKGVINYSALRDGDQLVNHIPNCELICNKLGLLMSLREFERVTISVQNRLPKLQLSDFFPETYVLDYPKEREAFFEAFKPGEIWINKPTGLNQGKGIYLVRDPVQFREELRAKEEAKANGSSSRNGKAMGRIVQRYIMSPLLIKERKFDIRVYLLIASTTPFLVLYHRGYLRLSIHKYDTNDANLCTHLTNQYIQKKDQRYEEVKDDTVWSMEQFNDYLNGLRKRDPGSSSGAKQPQAGPPEDNWVFQGMERQMKAILQHMFNAVKHKLAARLGYFELYGIDFMVDSDYKMYLIEVNTNPAMHVNCKLLSDLLPPLIESTIQIALECFEKSKRRQSLLPLKNAQNFHVLHC-GGSGNTSTPRAQRGSSP 447          
BLAST of Protein polyglycylase TTLL10 vs. TrEMBL
Match: A0A267EL85 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010750g1 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.150e-114
Identity = 185/421 (43.94%), Postives = 260/421 (61.76%), Query Frame = 2
Query:  194 KNGFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESL-DNILSKDLTSPNISR----RPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISK------------NWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSR 1405
            +N ++L G NG+ ++   + KM +T+ ++    ++ L+WT+    I++    +  Q++NHIPN ++I NK  LL SLR+FER+T  + N    + +  F PETY ++   E + F+E  +   IWI KPT LNQG GI L+RD     + + +K+    N S     +  GRI+QRYIM+PLL+  +KFDIR Y+LIA+TTPFLVLYH GYLRLS+  Y  +   L  HLTNQY+QKKD  YE VKDDTVWSMEQFN YLN   +  P  S             NWV      +MK+I++ +F +VKHKL+ R+G FEL+G DFM+DSD+K +LIEVN NPA+  NC +L   LP LIE+T  + +ECFEK K + +LLPL+N   F  ++   G  N S    +  ++P  +R +   SR
Sbjct:   39 QNVYLLQGHNGAALVEMAMDKMGWTRTSDKLSDNWKLRWTETKGVINYSALRDGDQLVNHIPNCELICNKLGLLMSLREFERVTISVQNRLPKLQLSDFFPETYVLDYPKEREAFFEAFKPGEIWINKPTGLNQGKGIYLVRDPVQFREELRAKEEAKANGSSSRNGKAMGRIVQRYIMSPLLIKERKFDIRVYLLIASTTPFLVLYHRGYLRLSIHKYDTNDANLCTHLTNQYIQKKDQRYEEVKDDTVWSMEQFNDYLNGLRKRDPGSSSGAKQPQAGPPEDNWVFQGMERQMKAILQHMFNAVKHKLAARLGYFELYGIDFMVDSDYKMYLIEVNTNPAMHVNCKLLSDLLPPLIESTIQIALECFEKSKRRQSLLPLKNAQNFHVLHC-GGSGNTSTPRAQRGSSPQALRYSNVQSR 458          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Cavefish
Match: ttll10 (tubulin tyrosine ligase like 10 [Source:NCBI gene;Acc:103030118])

HSP 1 Score: 299.286 bits (765), Expect = 6.268e-92
Identity = 154/387 (39.79%), Postives = 229/387 (59.17%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLT-KLISNTSIS-IDMDSFLPETYYINNSNELKTFYE-----NIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNIS------RRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDD 1324
            F   G NG+ ++      + + +I + +  DY LKW ++ S   +  F   +Q++  IPN+ ++T K  LL  LR++ER++ K+I       + MD F P+T+ ++  +E + F+      N  K N+WI KPT LNQG GI L++D E +  +  +   + N+       R P   I+QRYI NPLL+  KKFD+R+Y LIA TTP++V +  GY+RL+ + Y  +S+ L  HLTNQY+QKK+P Y  +K++TVWSME+FN Y+N        +  +WV  VF  RM+ IM Q FL+ K KL  ++G F+L G DF+ID +FK WL+E+N NPAL TNC VLK  +P  +  T D+  E F K +    LLPL +   F  +Y  +
Sbjct:  140 FFSGGGNGASIVIPYCESLGWQRIHDKTREDYKLKWCELKSSRTYYSFRAGEQLVFQIPNNKILTTKIGLLNCLREYERVSSKIIHRPGFRRMKMDEFFPDTFRMDVKDEREAFFAQQEGLNAGKGNMWICKPTGLNQGRGIFLLQDLEDITALRDRMEKAGNLLNKKIPFRTPQAHIVQRYIQNPLLLRGKKFDVRSYFLIACTTPYMVFFRHGYVRLTCDLYDPNSNNLSAHLTNQYMQKKNPLYSILKEETVWSMERFNDYINEKFMEPKGLPIDWVLRVFAKRMQQIMMQCFLAAKAKLECKLGYFDLIGCDFLIDENFKVWLLEMNCNPALHTNCEVLKDVVPQTVTETLDLAFEIFNKSRCGLKLLPLSSQRDFVLLYCGE 526          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Cavefish
Match: ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:ZFIN;Acc:ZDB-GENE-030131-1582])

HSP 1 Score: 120.553 bits (301), Expect = 4.673e-29
Identity = 103/353 (29.18%), Postives = 167/353 (47.31%), Query Frame = 2
Query:  233 MISSVL----MKMDFTKIANPSDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKC--NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRP-----TGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNA--NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            MI+S+L     +  + +I    + D+   W DV       D  +  E  +I  H  N   +T K  ++++L+++ +              D F P T+ +   +E   F E  ++   +IWI KP   +QG GI L R  + +         S N   +         + QRYI NP L+  +KFD+R Y+L+ +  P    LY  G+ R S   ++  S D   +HLTN  VQK  P+Y+  K    W M+Q  RYL A    E+   + K+ + N+F   + S+ ++V ++ KH        FEL+G+D ++D   K WLIEVN +P+L  +     +    L+E+T +VV
Sbjct:   38 MINSILDVLRQRPGWVEIKEDGEWDF--NWCDVGWLRENFDHSYMEEHVRIC-HFRNHYELTRKNLMVKNLKRYRKTLDREVGRLEGAKCD-FFPCTFEL--PSEYHLFVEEFKRSPGSIWIMKPVARSQGKGIFLFRKLKDIMEWKKVQRFSLNFEDQRDEAPVESYVAQRYIENPYLIGGRKFDLRVYVLVTSYLPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQKTAPDYDPEKG-CKWQMQQLRRYLTAKHGSEAVETLFKD-IDNIFIRSLLSV-QKVIINDKH-------CFELYGYDILLDQHLKPWLIEVNASPSLTASSQEDYEMKYRLLEDTLNVV 374          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 121.709 bits (304), Expect = 1.642e-28
Identity = 101/360 (28.06%), Postives = 170/360 (47.22%), Query Frame = 2
Query:  200 GFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLES----YPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            GF +V T  S+++  +L+   F ++ +P+  DY L WT  H +       +  Q +NH P S  +T K  L +++++ ++ T    N  I       +P+T+ +    +    Y + +K   WI KP   ++G GI L+              +SP+        ++ RYI NPLL++  KFD+R Y+L+ +  P ++ +Y  G  R +   Y +    +    +HLTN  V KK  +Y S  D  V      WSM    RYL    +       QI    +K V +  +     Q+  + K  +  R   FEL+GFD +IDS+ K WL+EVN++P+L  +  +  +    +I + F +V
Sbjct:   61 GFKIVRTE-SRLVRGILVNHGFHEV-HPNSNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQ-TYGFQNFHI-------VPQTFVLPAEYQEFCNYFSKDK-GPWIIKPVASSRGRGIYLV--------------SSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEI-----QIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLV 390          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 121.709 bits (304), Expect = 2.041e-28
Identity = 101/360 (28.06%), Postives = 170/360 (47.22%), Query Frame = 2
Query:  200 GFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLES----YPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            GF +V T  S+++  +L+   F ++ +P+  DY L WT  H +       +  Q +NH P S  +T K  L +++++ ++ T    N  I       +P+T+ +    +    Y + +K   WI KP   ++G GI L+              +SP+        ++ RYI NPLL++  KFD+R Y+L+ +  P ++ +Y  G  R +   Y +    +    +HLTN  V KK  +Y S  D  V      WSM    RYL    +       QI    +K V +  +     Q+  + K  +  R   FEL+GFD +IDS+ K WL+EVN++P+L  +  +  +    +I + F +V
Sbjct:   61 GFKIVRTE-SRLVRGILVNHGFHEV-HPNSNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQ-TYGFQNFHI-------VPQTFVLPAEYQEFCNYFSKDK-GPWIIKPVASSRGRGIYLV--------------SSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEI-----QIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLV 390          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 120.939 bits (302), Expect = 2.884e-28
Identity = 101/360 (28.06%), Postives = 170/360 (47.22%), Query Frame = 2
Query:  200 GFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLES----YPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            GF +V T  S+++  +L+   F ++ +P+  DY L WT  H +       +  Q +NH P S  +T K  L +++++ ++ T    N  I       +P+T+ +    +    Y + +K   WI KP   ++G GI L+              +SP+        ++ RYI NPLL++  KFD+R Y+L+ +  P ++ +Y  G  R +   Y +    +    +HLTN  V KK  +Y S  D  V      WSM    RYL    +       QI    +K V +  +     Q+  + K  +  R   FEL+GFD +IDS+ K WL+EVN++P+L  +  +  +    +I + F +V
Sbjct:   61 GFKIVRTE-SRLVRGILVNHGFHEV-HPNSNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQ-TYGFQNFHI-------VPQTFVLPAEYQEFCNYFSKDK-GPWIIKPVASSRGRGIYLV--------------SSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEI-----QIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLV 390          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Sea Lamprey
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 311.997 bits (798), Expect = 6.727e-102
Identity = 150/382 (39.27%), Postives = 234/382 (61.26%), Query Frame = 2
Query:  203 FILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSIS--IDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRR------PTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDD 1324
            F + G NG+ ++S   ++  + +  + +  DY LKW ++ S+  +  F E +Q++  I N+ ++T+K  LL SLR +ER+   +  TS    + MD F P T  ++   E   F+++ ++   WI KPT LNQG GI L+R    +  +  + L   +   R      P  RI+QRY+ NPLL++ +KFD+R+YMLIA+  P +VL+  GY RLS + Y+ +S+ L  HLTNQY+QKK P Y+ VK++TVW+M +FN ++N +   +  + K+WV   FT RM+ +M   FL+ K KL  ++GLF+L G DF+ID DFK WL+E+N NPAL TNC VLK+ +P ++  T D+ +E FEK +    ++PL+    F  +Y+ D
Sbjct:    4 FYIGGNNGAALVSEYCLRRGWERTLDRTREDYRLKWCELKSRSAYTAFREGQQLLYQIQNNKVLTSKIGLLCSLRDYERIISKLQVTSQPRMLKMDDFFPHTLRLDVRGERDEFFDSYQEGEKWICKPTGLNQGRGIFLLRSAGDVAALRERLLLDADAGPRTPRAHVPQARIVQRYVTNPLLLDGRKFDVRSYMLIASAAPPIVLFRHGYARLSCQSYSPESNDLTAHLTNQYMQKKSPVYQEVKEETVWTMSRFNDHVNEHCAPHKGLPKDWVLTTFTKRMQQVMTHCFLATKSKLEGKLGLFDLIGCDFLIDEDFKVWLLEMNCNPALQTNCMVLKEVIPQVVNETLDLALETFEKVRRGQRVMPLQTRRDFTLLYNGD 385          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 99.3673 bits (246), Expect = 2.524e-22
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  470 SIDMDSFLPETY-YINNSNELKTFYENIEKC--------------------NIWIYKPTDLNQGN----GI-------SLIRDKESLDNILSKDLTSPNISRRPTGR-IIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYES----VKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIE 1243
            S D D+FL   Y +++    L+   E   +C                    N W+ KP  +++G     G+        ++R  E  D  L KD           GR I+Q+Y+  PLL+++ KFDIR + L+ +  P  V  Y   YLR S + +  D+    IHL N  +QK   N +     +  D +W   QF  YL +       +   W + V    MK  +     + +  +  R G FEL+G DF++  D + WL+E+N +P +  +  V  +    + ++   VV++
Sbjct:  241 SPDWDAFLQRYYRFVHGGERLRGVAELAPQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVEC-DTALVKD-----------GRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDNLDTSIHLCNNSIQKHFENAQGRSAQLPRDNIWHGRQFVSYLESL-----GLGFAW-EGVVVPGMKQAIIHALQAAQDVVDARRGSFELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVVLD 518          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 99.3673 bits (246), Expect = 3.031e-22
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  470 SIDMDSFLPETY-YINNSNELKTFYENIEKC--------------------NIWIYKPTDLNQGN----GI-------SLIRDKESLDNILSKDLTSPNISRRPTGR-IIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYES----VKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIE 1243
            S D D+FL   Y +++    L+   E   +C                    N W+ KP  +++G     G+        ++R  E  D  L KD           GR I+Q+Y+  PLL+++ KFDIR + L+ +  P  V  Y   YLR S + +  D+    IHL N  +QK   N +     +  D +W   QF  YL +       +   W + V    MK  +     + +  +  R G FEL+G DF++  D + WL+E+N +P +  +  V  +    + ++   VV++
Sbjct:  268 SPDWDAFLQRYYRFVHGGERLRGVAELAPQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVEC-DTALVKD-----------GRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDNLDTSIHLCNNSIQKHFENAQGRSAQLPRDNIWHGRQFVSYLESL-----GLGFAW-EGVVVPGMKQAIIHALQAAQDVVDARRGSFELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVVLD 545          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008895.1 (pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 gene:ENSPMAG00000008053.1 transcript:ENSPMAT00000008895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 2.136e-18
Identity = 78/310 (25.16%), Postives = 138/310 (44.52%), Query Frame = 2
Query:  227 SKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQ-IDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEK-CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDSDKL---LIHLTNQYVQKKDPNYESVKDDTV------WSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMI 1120
            S+++ ++L    F ++ +PS  D+ L WT  H +       T+F Q +NH P S  +T K  L +++   +R+ +   +   +I     +P T+ +    E + F     K    WI KP   ++G G+ L+               SPN        ++ RY+ NPLL++  KFD+R Y+L+ +  P ++ LY  G  R +   Y  +S  +    +HLTN  V KK  +Y S  D  V      WSM    R L  +      +    ++++    + S+ + +  SV+  +  R   F + G   ++
Sbjct:   74 SRLVRNILGSHGFHEV-HPSSNDFNLMWTGTHPKPFSLRSLTDF-QKVNHFPRSYELTRKDRLCKNV---QRMQQSHGHKHFNI-----IPATFLL--PAEYQDFCSAHSKDRGPWIVKPVASSRGRGVYLV--------------NSPNQVTMDENILVSRYLGNPLLIDDFKFDVRLYVLVTSYEPLVIYLYEEGLTRFATVKYDRNSKFIKNQFMHLTNYSVNKKSRDYVSCDDPEVEDFGNKWSMSAMLRCLKQDGHDTTALMAR-IEDLIVKTILSVEQTIASSVRMFVPHRGNCFGMMGLGVLL 356          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010203.1 (pep scaffold:Pmarinus_7.0:GL479661:66:3454:1 gene:ENSPMAG00000009234.1 transcript:ENSPMAT00000010203.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.248e-7
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 1001 VKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPL-ENLGLFQFVYSDD 1324
            V N   + M  I+     +V   ++     FE +G+D +ID   K WLIEVN +P+L +  +  +     LI +T ++V+   +    + N +P  E LG +  +Y ++
Sbjct:   28 VTNKLFDDMHWIVLHSLRAVAGVMANDKHCFECYGYDIIIDDKLKPWLIEVNASPSLSSTTANDRIMKYNLINDTLNIVMPGADMPDPRWNKVPAREALGNYDLLYDEE 136          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Yeast
Match: PBY1 (Putative tubulin tyrosine ligase associated with P-bodies; may have a role in mRNA metabolism; yeast knockout collection strain identified as a pby1 null mutant is actually wild-type for PBY1 and deleted for mms4 [Source:SGD;Acc:S000000298])

HSP 1 Score: 59.6918 bits (143), Expect = 6.985e-10
Identity = 78/301 (25.91%), Postives = 121/301 (40.20%), Query Frame = 2
Query:  464 SISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSK-------------------------DLTSPNISRRPTGRIIQRYIMNPLLVNS---KKFDIRAYMLIAN---------------TTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSV----KHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENT 1225
            +I +D   FL +   ++ + EL+   EN  +   WI KP+  ++G GI + +  E L  I                            D    NIS+     IIQ Y+ NPLL+ S   +KF IR Y++                    PF+ L    Y    L+D       L  HLTN  +Q K       K D   S+ +F+     ++E  P   K+ +K     ++ SI   VFL+     +         FE +G DF+IDS+++  L+E+N  P        LK  +  L ++T
Sbjct:  444 TIDLDYAEFLDDA--LDENWELRQELENESQDKWWIVKPSMSDKGQGIRVFKTIEDLQAIFDSFDDEDSEAEESGNDDDADDVNGEFMDNNKVNISQL-RHFIIQEYLTNPLLLASMDNRKFHIRCYVVCRGDLQVFVYDRMLALFAAKPFVPLDPYAYSVTDLKD-------LECHLTNTCLQSK-------KKDKDSSVLEFD-----SIEEIPNERKSNIKE----QIHSITNDVFLAAVNVNRLNFQPLPNAFETYGVDFLIDSNYEVKLLEINAFPDFKQTGKDLKNLIDELFDDT 718          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Nematostella
Match: EDO42060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K6])

HSP 1 Score: 126.331 bits (316), Expect = 2.436e-32
Identity = 96/306 (31.37%), Postives = 157/306 (51.31%), Query Frame = 2
Query:  359 QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKC-----NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDY-ANDSDKLLIHLTNQYVQKKDPNY----ESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRV-GLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSV-LKQKLPVLIENTFDVV 1237
            Q +NH P +  IT K  L ++LR   R+  +  N      + +F P ++  N  N+ + F     K      NIWI KP DL++G GI L       +N+L  DLT  + +      ++QRYI +PLL+   KFD+R Y+L+ +  P  + +YH G +R S E +  +    L  HLTN  + K+ P+Y    E +     W++ Q   Y + +         N    +  +R+ +I+    L+   ++S+     FEL+GFD +ID + K WL+EVN +P+L ++C V L  K P L+ +TF+++
Sbjct:   60 QRLNHFPKTSAITRKDCLARNLR---RMRGVYGNY-----LFNFAPLSF--NLPNDYRKFVAEYSKKKDATKNIWICKPADLSRGRGIFL------FENLL--DLTYDSAA------VVQRYISSPLLICGYKFDLRLYVLVTSFHPLCIYVYHEGMVRFSTEKFDLSTLSNLFSHLTNSSINKQGPSYSLDKERIGTGCKWTLSQLRAYFHQH---------NIGDGMLWHRINTIIILTLLTQAPEVSKSCTNCFELYGFDILIDENLKPWLLEVNFSPSLGSDCLVDLTIKKP-LLNDTFELL 331          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Nematostella
Match: EDO40528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S719])

HSP 1 Score: 112.079 bits (279), Expect = 4.567e-27
Identity = 100/333 (30.03%), Postives = 154/333 (46.25%), Query Frame = 2
Query:  236 ISSVLMKMDFTKIANPSDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLR----QFERLTKLISNTSISIDMDSF-LPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIR------DKESLDNILSKDLTSPNI--SRRPTGR-IIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPAL 1171
            I  VL    +T++    D D+Y  W DV       D  +  E  +I +H  N   +T K  ++++++    Q ER       T       +F LP  Y+I        F E  ++     WI KP   +QG GI L R      D +  D   ++ L    I   + P    I+QRYI NP LV  +KFD+R Y+L+ + +P  V LY  G+ R S   ++ DS D   +HLTN  +QK  P+Y+  K + V  M   ++ +  +L++                    +++V ++ KH        FEL+G+D M DS+ K WLIEVN +P+L
Sbjct:   39 IFDVLRSKGWTEVREEGDWDFY--WCDVGWMREFFDHTYMDEHVKI-SHFRNHYELTRKNLMIKNMKRLKKQLEREYGKHEGTKCEFYPTTFELPMEYHI--------FVEEFKRNPGTTWIMKPVSKSQGKGIFLFRKLKDIMDWKKEDPYRTQQLAEERIKDDKEPIETYIVQRYIENPFLVGGRKFDLRIYVLVTSYSPLCVWLYREGFARFSNTRFSLDSIDDTYVHLTNVAIQKTAPDYDPEKVEQV--MRNIDQMIIKSLQA--------------------VQKVMINDKH-------CFELYGYDIMFDSNLKPWLIEVNASPSL 331          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Nematostella
Match: EDO44351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW52])

HSP 1 Score: 114.005 bits (284), Expect = 7.588e-27
Identity = 69/234 (29.49%), Postives = 122/234 (52.14%), Query Frame = 2
Query:  560 NIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGR-IIQRYIMNPLLVNSKKFDIRAYMLIANTTPF-LVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYES----VKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIE 1243
            N+WI KP   ++G GI  +   + L++I+     + NI  +  GR ++Q+YI  PLL+   KFDIR + L+ +  P  L  Y   YLR   ++++ +   + IHL N  +QK   N  +    + D+ +WS ++F  YL         +   W   ++    + +M  V  S +  +  R   FEL+G DF+I  D+K WLIE+N +P +  + +V ++    ++E+T  V+++
Sbjct:  306 NVWIVKPGAKSRGRGIVCM---DKLEDIMK---LTGNIVGQKEGRWVVQKYIERPLLIYGVKFDIRQWFLVTDWNPLTLWFYEDCYLRFCSQNFSLEDFHVSIHLANNSIQKNYDNNSTRDKRLPDENMWSSDEFKAYLKKR-----DLGHMWDSVIYPGMKQGVM-NVLQSCQEVVECRKNSFELYGADFIIGVDYKPWLIEINCSPTMGASTAVTRKLCAQVLEDTMKVILD 527          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Nematostella
Match: EDO45410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT71])

HSP 1 Score: 108.227 bits (269), Expect = 4.474e-25
Identity = 92/333 (27.63%), Postives = 151/333 (45.35%), Query Frame = 2
Query:  239 SSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFK--QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFY----ENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYA----NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLES--------YPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTN 1180
            + V   M  T+  +PS    +  W+D  S +  E F E K  Q INH P    I  K +L +++ + +R            D  SF P+T+ +         Y    +  ++   +I KP +   GNGISLIR+    D I S +             +IQ YI  P L++  KFD+R Y+L+ +  P  + +Y+ G +RL  E Y     ++ D+L +HLTN  + K + N+E  ++D + S     ++LN  L+S        +  I++  VK +   +   +                  FEL GFD ++D   K WL+E+N +P+  T+
Sbjct:   21 ACVHAGMVVTRDDDPS---CFFIWSD--SSVGAERFIELKPYQRINHFPGMGEICRKDSLARNIAKMKR---------AHPDEYSFAPQTWVLPAEYAAFQMYCRELKKKKRAKTFIMKPANGAMGNGISLIRNG---DRIPSHEQL-----------VIQEYIDRPFLLDGYKFDLRVYVLVTSCDPLRIFVYNDGLVRLGTECYEPPTEDNMDELFMHLTNYSINKHNENFERDENDDMGSKRSI-KWLNEWLQSMDYDVNFLWRGITEVIVKTLIVAQPHVLHSYRMCRPGAATGSDSVCFELLGFDILLDRKLKPWLLEINRSPSFGTD 324          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Nematostella
Match: EDO43035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR3])

HSP 1 Score: 95.1301 bits (235), Expect = 3.813e-22
Identity = 69/210 (32.86%), Postives = 110/210 (52.38%), Query Frame = 2
Query:  560 NIWIYKPTDLNQGNGISLIRD-KESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLV-NSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPN-YESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRV---GLFELFGFDFMIDSDFKTWLIEVNVNPA 1168
             IWI K +   +G  I L    KE LD I            +    ++Q+YI NPLL+   +KFDIR ++L+++     V ++ G LR S E Y   S  KL  HLTN  +Q+ + + +   +       ++F+RYL    E      K++ K +   +M +I+++  LSV+ +++        F+LFGFDFM+D+ FK WL+E+N  PA
Sbjct:   19 EIWIAKSSAGAKGEDICLSSSPKEILDFI----------DEQNQAFVVQKYIENPLLLEGGRKFDIRCWVLLSHKYSIHV-FNQGVLRTSSEVYDVTSLGKLTSHLTNHCIQEANSDDFGKYEKGNEMFFDEFSRYLEDKFE------KDFEKTIL-QQMHAIVKECLLSVEEEINTEALSYHSFQLFGFDFMVDATFKVWLLEINGAPA 210          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 124.02 bits (310), Expect = 1.890e-30
Identity = 103/329 (31.31%), Postives = 163/329 (49.54%), Query Frame = 2
Query:  284 SDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISRRPT---GRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            SD ++   W DV       D  +  E  +I NH  N   +T K  ++++L++F++ L K +  T  S     F P TY + +   L     N    + WI KP   +QG GI L R    L +I+   KD +     +        ++QRYI NP L+N +KFD+R Y+L+ +  P  V LY  G+ R S   ++  + D   +HLTN  VQK  P+Y+  K    W M+Q  RYL A      +  +  V+ +F + M +I+ +   SV+  +      FEL+G+D ++D + K WLIEVN +P+   +     +    L+E+T +VV
Sbjct:   26 SDGEWDFNWCDVGWLRENFDHAYMEEHVRI-NHFRNHYELTRKNLMVKNLKRFQKNLEKDMGRTEAS--KCDFFPSTYAMPSEYHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFR---KLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDDKYMHLTNVSVQKTAPDYDPEK-GCKWQMQQLRRYLTA------KYGREVVETLFGD-MDNIIIRSLQSVQKVIINDKHCFELYGYDILLDHNLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVV 340          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 123.25 bits (308), Expect = 3.131e-30
Identity = 103/329 (31.31%), Postives = 163/329 (49.54%), Query Frame = 2
Query:  284 SDIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISRRPT---GRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            SD ++   W DV       D  +  E  +I NH  N   +T K  ++++L++F++ L K +  T  S     F P TY + +   L     N    + WI KP   +QG GI L R    L +I+   KD +     +        ++QRYI NP L+N +KFD+R Y+L+ +  P  V LY  G+ R S   ++  + D   +HLTN  VQK  P+Y+  K    W M+Q  RYL A      +  +  V+ +F + M +I+ +   SV+  +      FEL+G+D ++D + K WLIEVN +P+   +     +    L+E+T +VV
Sbjct:   23 SDGEWDFNWCDVGWLRENFDHAYMEEHVRI-NHFRNHYELTRKNLMVKNLKRFQKNLEKDMGRTEAS--KCDFFPSTYAMPSEYHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFR---KLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDDKYMHLTNVSVQKTAPDYDPEK-GCKWQMQQLRRYLTA------KYGREVVETLFGD-MDNIIIRSLQSVQKVIINDKHCFELYGYDILLDHNLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVV 337          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 122.479 bits (306), Expect = 5.151e-30
Identity = 101/333 (30.33%), Postives = 161/333 (48.35%), Query Frame = 2
Query:  308 WTDVHSQIDWEF---------------FTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISRRPT---GRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            W +V    +W+F               + E    INH  N   +T K  ++++L++F++ L K +  T  S     F P TY + +   L     N    + WI KP   +QG GI L R    L +I+   KD +     +        ++QRYI NP L+N +KFD+R Y+L+ +  P  V LY  G+ R S   ++  + D   +HLTN  VQK  P+Y+  K    W M+Q  RYL A      +  +  V+ +F + M +I+ +   SV+  +      FEL+G+D ++D + K WLIEVN +P+   +     +    L+E+T +VV
Sbjct:    7 WIEVKDDGEWDFNWCDVGWLRENFDHAYMEEHVRINHFRNHYELTRKNLMVKNLKRFQKNLEKDMGRTEAS--KCDFFPSTYAMPSEYHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFR---KLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDDKYMHLTNVSVQKTAPDYDPEK-GCKWQMQQLRRYLTA------KYGREVVETLFGD-MDNIIIRSLQSVQKVIINDKHCFELYGYDILLDHNLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVV 326          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 123.25 bits (308), Expect = 5.650e-30
Identity = 102/328 (31.10%), Postives = 162/328 (49.39%), Query Frame = 2
Query:  287 DIDYYLKWTDV---HSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILS--KDLTSPNISRRPT---GRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLV-LYHPGYLRLSLEDYANDS-DKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVV 1237
            D ++   W DV       D  +  E  +I NH  N   +T K  ++++L++F++ L K +  T  S     F P TY + +   L     N    + WI KP   +QG GI L R    L +I+   KD +     +        ++QRYI NP L+N +KFD+R Y+L+ +  P  V LY  G+ R S   ++  + D   +HLTN  VQK  P+Y+  K    W M+Q  RYL A      +  +  V+ +F + M +I+ +   SV+  +      FEL+G+D ++D + K WLIEVN +P+   +     +    L+E+T +VV
Sbjct:   58 DGEWDFNWCDVGWLRENFDHAYMEEHVRI-NHFRNHYELTRKNLMVKNLKRFQKNLEKDMGRTEAS--KCDFFPSTYAMPSEYHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFR---KLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDDKYMHLTNVSVQKTAPDYDPEK-GCKWQMQQLRRYLTA------KYGREVVETLFGD-MDNIIIRSLQSVQKVIINDKHCFELYGYDILLDHNLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVV 371          
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Medaka
Match: ttll1 (tubulin tyrosine ligase like 1 [Source:NCBI gene;Acc:101159875])

HSP 1 Score: 112.849 bits (281), Expect = 1.622e-26
Identity = 100/377 (26.53%), Postives = 170/377 (45.09%), Query Frame = 2
Query:  305 KWTDVHSQIDWEFF--------------TEFK----QIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDS------FLPETYYINNSNELKTFYENIEK--CNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGR---IIQRYIMNPLLVNSKKFDIRAYMLIANTTPF-LVLYHPGYLRLSLEDYA---NDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCS---VLKQKLPVLIENTFDVVIECFEKCKMKTNLL-PLENLGLFQFVYSDD 1324
            +W  V    DW F+              T ++    Q++NH PN   +T K  ++++++++ +  +  S+     D +       F+P T+ +     L  F E   K   + WI KP    QG GI LI +K S     S+D  +       +G+   +I  YI NPLL+  KKFD+R Y+L+    P    +Y  G+ R     Y    ++ D + +HLTN  +QK   +Y  V     W++     YL +            V N   +++  I+ Q   +V   ++     FE +G+D +ID   K WLIEVN +P+L ++ +   +LK     LI +T ++V    +    + N   P E +G +Q +Y ++
Sbjct:   24 EWVQVTENEDWNFYWMSIQTIRNVFSVDTGYRLSDDQMVNHFPNHYELTRKDLMIKNIKRYRKELEKESSPLAEKDENGKYIYLDFVPVTFMLPADYNL--FVEEFRKNPSSTWIMKPCGKAQGKGIFLI-NKLSQIKKWSRDSRTSTFVAASSGKEAYVISLYIDNPLLIGGKKFDLRLYVLVTTYRPLKCYMYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHGDDYNHVHGGK-WTVSNLRLYLESTRGKE-------VTNRLFDQIHWIVVQSLKAVAPVMNNDKHCFECYGYDIIIDDKLKPWLIEVNASPSLTSSTANDRILKYN---LINDTLNIVTPNGDIPDCRWNRSPPREAMGNYQVLYDEE 386          
BLAST of Protein polyglycylase TTLL10 vs. Planmine SMEST
Match: SMESG000042729.1 (SMESG000042729.1)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 451/454 (99.34%), Postives = 451/454 (99.34%), Query Frame = 2
Query:  251 MKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 1612
            MKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLN NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENT DVVIECFEKCKMKTNLLPLENLG FQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA
Sbjct:    1 MKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNVNLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTIDVVIECFEKCKMKTNLLPLENLGSFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 454          
BLAST of Protein polyglycylase TTLL10 vs. Planmine SMEST
Match: SMESG000042729.1 (SMESG000042729.1)

HSP 1 Score: 922.154 bits (2382), Expect = 0.000e+0
Identity = 451/457 (98.69%), Postives = 451/457 (98.69%), Query Frame = 2
Query:  251 MKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIE---KCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 1612
            MKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIE   KCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLN NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENT DVVIECFEKCKMKTNLLPLENLG FQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA
Sbjct:    1 MKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIESLKKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNVNLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTIDVVIECFEKCKMKTNLLPLENLGSFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 457          
BLAST of Protein polyglycylase TTLL10 vs. Planmine SMEST
Match: SMESG000042729.1 (SMESG000042729.1)

HSP 1 Score: 922.154 bits (2382), Expect = 0.000e+0
Identity = 449/452 (99.34%), Postives = 449/452 (99.34%), Query Frame = 2
Query:  257 MDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 1612
            MDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLN NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENT DVVIECFEKCKMKTNLLPLENLG FQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA
Sbjct:    1 MDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNVNLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTIDVVIECFEKCKMKTNLLPLENLGSFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 452          
BLAST of Protein polyglycylase TTLL10 vs. Planmine SMEST
Match: SMESG000042729.1 (SMESG000042729.1)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 449/455 (98.68%), Postives = 449/455 (98.68%), Query Frame = 2
Query:  257 MDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIE---KCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 1612
            MDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIE   KCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLN NLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENT DVVIECFEKCKMKTNLLPLENLG FQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA
Sbjct:    1 MDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIESLKKCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNVNLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTIDVVIECFEKCKMKTNLLPLENLGSFQFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKWIKA 455          
BLAST of Protein polyglycylase TTLL10 vs. Planmine SMEST
Match: SMESG000061553.1 (SMESG000061553.1)

HSP 1 Score: 382.874 bits (982), Expect = 8.408e-126
Identity = 212/490 (43.27%), Postives = 304/490 (62.04%), Query Frame = 2
Query:  185 KKTKNGFILVGTNGSKMISSVLMKMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNKGNLLQSLRQFER-LTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIEKCNIWIYKPTDLNQGNGISLIRDKESLDNIL-SKDLTSPNISRRPTGRIIQRYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDKLLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWVKNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEVNVNPALDTNCSVLKQKLPVLIENTFDVVIECFEK-CKMKTNLLPLENLGLFQFVYSDD-----GK---------WNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKRKPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNP-SSDMK 1600
            K TKN F +VG NG+ ++  VL+ + ++K+   +  D+ LKWT++ S I++  F E +Q++NHIPN  +ITNK  LL SLR +E+ LT    N   +I+M  F PETY I++  E + F+E+ ++ +IWI KPT LNQG GI+LIR+ +     L S+D  S +       RI+QRYI NPLL+  +KFDIR+YMLIA+T+P+LV+Y PGY+RLS+  Y+N+   L+ HLTNQY+QKK PNY  VKDDT+WSME+FN Y+N   ++      +W + +   +++ IM  VF SVK+K S RVG FE++GFDFM+DSD KTWLIEVNVNPAL  NCS+LKQ LP +IE    + +ECF+K  K K +L+PLEN   F  +Y++      G+         W   RY   + +      + KSP  +S T+ S ++    K     S  T  K I+  +S     + +   PI  + ++ S   NP SS++K
Sbjct:   24 KSTKNSFSIVGHNGASLVEPVLLSLGWSKLNEKNTDDFKLKWTELVSHINYNRFKEGEQLVNHIPNCGLITNKLGLLTSLRSYEKSLTD--PNKIKTIEMSHFTPETYIIDDIKEREKFFESFKEGDIWINKPTGLNQGKGITLIRNIDEFKKELNSRDSVSRSTMSGVKARIVQRYIKNPLLLEGRKFDIRSYMLIASTSPYLVMYCPGYIRLSMNPYSNEDTDLITHLTNQYIQKKSPNYGDVKDDTIWSMEKFNTYINDTYQNLESFKPDWAQTILEKQIQQIMLYVFNSVKYKFSTRVGFFEIYGFDFMVDSDLKTWLIEVNVNPALHVNCSILKQILPPMIEEVILIALECFDKIVKSKKSLIPLENQHNFSVIYAEGMSACRGRISSFSSLKSWIPPRYRSTSLSPNCSRSDEKSPGDSSATMTSFSKSNYIKNSGQNSAITSSKEIKFENS---LRSERTQNPIVVQTHERSRSLNPISSEIK 508          
The following BLAST results are available for this feature:
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL101.493e-8735.76tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
TTLL101.493e-8735.76tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
TTLL105.111e-5534.54tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
TTLL91.022e-3129.79tubulin tyrosine ligase like 9 [Source:HGNC Symbol... [more]
TTLL91.503e-3129.79tubulin tyrosine ligase like 9 [Source:HGNC Symbol... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll-94.840e-2730.60Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-51.135e-1625.32Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-51.188e-1625.24Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-41.461e-1525.53Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-41.461e-1525.53Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL3A6.183e-3135.14gene:FBgn0031854 transcript:FBtr0079305[more]
TTLL1A1.179e-2928.22gene:FBgn0030823 transcript:FBtr0074403[more]
TTLL1B2.096e-2627.13gene:FBgn0052238 transcript:FBtr0073344[more]
TTLL4A8.472e-2427.16gene:FBgn0026147 transcript:FBtr0300402[more]
TTLL4A8.472e-2427.16gene:FBgn0026147 transcript:FBtr0300401[more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll106.025e-8738.74tubulin tyrosine ligase-like family, member 10 [So... [more]
ttll99.755e-3030.21tubulin tyrosine ligase-like family, member 9 [Sou... [more]
ttll91.077e-2930.21tubulin tyrosine ligase-like family, member 9 [Sou... [more]
ttll57.249e-2928.10tubulin tyrosine ligase-like family, member 5 [Sou... [more]
ttll19.501e-2927.68tubulin tyrosine ligase-like family, member 1 [Sou... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL101.584e-9537.84tubulin tyrosine ligase like 10 [Source:NCBI gene;... [more]
mboat78.870e-3028.33membrane bound O-acyltransferase domain containing... [more]
mboat76.840e-2927.79membrane bound O-acyltransferase domain containing... [more]
ablim22.040e-2630.63actin binding LIM protein family member 2 [Source:... [more]
mboat74.153e-2530.19membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttll109.260e-9338.52tubulin tyrosine ligase-like family, member 10 [So... [more]
Ttll102.077e-9138.52tubulin tyrosine ligase-like family, member 10 [So... [more]
Ttll103.160e-9138.52tubulin tyrosine ligase-like family, member 10 [So... [more]
Ttll93.949e-3027.79tubulin tyrosine ligase-like family, member 9 [Sou... [more]
Ttll95.604e-3027.27tubulin tyrosine ligase-like family, member 9 [Sou... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XI57|TTL10_RAT2.043e-9435.71Protein polyglycylase TTLL10 OS=Rattus norvegicus ... [more]
sp|A4Q9F3|TTL10_MOUSE2.846e-9038.52Protein polyglycylase TTLL10 OS=Mus musculus OX=10... [more]
sp|Q4R7H0|TTL10_MACFA1.726e-8935.65Protein polyglycylase TTLL10 OS=Macaca fasciculari... [more]
sp|Q6ZVT0|TTL10_HUMAN7.170e-8735.76Inactive polyglycylase TTLL10 OS=Homo sapiens OX=9... [more]
sp|Q23SI8|TTLL1_TETTS4.890e-3030.10Probable alpha-tubulin polyglutamylase Ttll1 OS=Te... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UBF85.040e-11843.53Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8J2I42.053e-11645.88Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IYK11.846e-11545.88Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8ILK52.333e-11544.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EL851.150e-11443.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll106.268e-9239.79tubulin tyrosine ligase like 10 [Source:NCBI gene;... [more]
ttll94.673e-2929.18tubulin tyrosine ligase-like family, member 9 [Sou... [more]
ttll51.642e-2828.06tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll52.041e-2828.06tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll52.884e-2828.06tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL106.727e-10239.27tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
ttll32.524e-2226.01tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll33.031e-2226.01tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ENSPMAT00000008895.12.136e-1825.16pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 g... [more]
ENSPMAT00000010203.11.248e-727.52pep scaffold:Pmarinus_7.0:GL479661:66:3454:1 gene:... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PBY16.985e-1025.91Putative tubulin tyrosine ligase associated with P... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420602.436e-3231.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405284.567e-2730.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443517.588e-2729.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454104.474e-2527.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430353.813e-2232.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll91.890e-3031.31tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll93.131e-3031.31tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll95.151e-3030.33tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll95.650e-3031.10tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll11.622e-2626.53tubulin tyrosine ligase like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Protein polyglycylase TTLL10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042729.10.000e+099.34SMESG000042729.1[more]
SMESG000042729.10.000e+098.69SMESG000042729.1[more]
SMESG000042729.10.000e+099.34SMESG000042729.1[more]
SMESG000042729.10.000e+098.68SMESG000042729.1[more]
SMESG000061553.18.408e-12643.27SMESG000061553.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027593 ID=SMED30027593|Name=Protein polyglycylase TTLL10|organism=Schmidtea mediterranea sexual|type=transcript|length=1656bp
GAAACCATATGTATCAGAATGAGCGCCAACATTGTCATTGCAATACAATG
TCATTTAAATTGACCATTTTTAAATAGCTTAATTGCGAAATTCATTATAA
TAAATGGCAAAAGAAAATACTTTAAAGGTCTTGAAATTACCCGTCAAATT
TAAAAAATCTTATAAAGAACAGTTACAATTGGAGAAAAAAACTAAAAATG
GATTTATATTAGTGGGAACTAACGGATCAAAAATGATATCCAGCGTCTTG
ATGAAAATGGATTTTACAAAGATTGCAAATCCATCCGACATTGATTACTA
TTTGAAATGGACTGATGTGCACTCACAAATAGATTGGGAATTCTTTACAG
AATTCAAACAAATCATAAATCACATCCCGAATTCTGATATGATAACTAAC
AAAGGGAACCTCCTACAAAGTCTTCGACAGTTTGAAAGGCTTACAAAGTT
AATATCGAATACCTCCATTTCCATTGATATGGATTCATTCCTTCCCGAAA
CGTATTATATAAATAACTCCAATGAATTGAAAACTTTTTATGAGAATATT
GAAAAATGCAACATTTGGATTTACAAGCCAACTGATCTCAACCAAGGAAA
TGGTATATCACTGATTCGGGACAAGGAATCATTAGATAATATTCTATCTA
AAGATCTAACTAGTCCAAATATTTCAAGAAGACCCACTGGAAGAATTATA
CAAAGATATATAATGAACCCCTTATTAGTAAACAGCAAGAAATTTGATAT
AAGAGCTTATATGCTCATCGCAAACACTACCCCTTTCCTTGTGCTCTACC
ATCCGGGATACCTCCGCTTATCATTAGAAGATTATGCCAATGACAGTGAT
AAATTATTAATACATTTGACAAATCAGTACGTCCAAAAGAAAGATCCAAA
TTACGAAAGTGTTAAGGATGACACGGTGTGGAGCATGGAGCAATTTAATA
GGTATTTAAATGCAAATCTTGAATCATATCCTCAAATTAGTAAAAATTGG
GTAAAAAATGTGTTTACGAATCGAATGAAATCTATAATGCGCCAAGTATT
TTTATCTGTGAAACATAAATTATCCCAGCGAGTTGGTCTTTTTGAATTGT
TTGGTTTTGATTTCATGATCGACAGTGACTTCAAGACATGGCTGATAGAA
GTGAATGTGAATCCTGCATTGGACACAAACTGCTCTGTATTAAAGCAAAA
ATTACCAGTTCTAATTGAAAATACATTTGACGTGGTGATTGAATGTTTCG
AGAAATGCAAAATGAAGACAAATCTTTTGCCTTTAGAGAATTTGGGTTTG
TTTCAATTTGTCTATTCGGATGATGGAAAATGGAACTGGTCAAGATATTT
TGGAAGAACTAAAGCAACACCGATGATGATAAGAAATACTAAATCTCCAA
GTCGAAATTCTCCAACATTGAACTCAAATAATAGAGAAACGGATAGAAAA
CGGAAACCAAATAAATCAACGACGACTTTTATAAAAAGAATTCAAAGACC
TTCATCATGTAGCCCTTTCGATGCTAGAAAATTCCCTTTACCAATTACTG
AAAAACTATACAAAGAATCAAATTTCCCTAATCCAAGTTCCGATATGAAA
TGGATTAAAGCATAACTAAATTGTAGCTGTTTCTATTGCAAATCCTATTA
TTAGTG
back to top

protein sequence of SMED30027593-orf-1

>SMED30027593-orf-1 ID=SMED30027593-orf-1|Name=SMED30027593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MAKENTLKVLKLPVKFKKSYKEQLQLEKKTKNGFILVGTNGSKMISSVLM
KMDFTKIANPSDIDYYLKWTDVHSQIDWEFFTEFKQIINHIPNSDMITNK
GNLLQSLRQFERLTKLISNTSISIDMDSFLPETYYINNSNELKTFYENIE
KCNIWIYKPTDLNQGNGISLIRDKESLDNILSKDLTSPNISRRPTGRIIQ
RYIMNPLLVNSKKFDIRAYMLIANTTPFLVLYHPGYLRLSLEDYANDSDK
LLIHLTNQYVQKKDPNYESVKDDTVWSMEQFNRYLNANLESYPQISKNWV
KNVFTNRMKSIMRQVFLSVKHKLSQRVGLFELFGFDFMIDSDFKTWLIEV
NVNPALDTNCSVLKQKLPVLIENTFDVVIECFEKCKMKTNLLPLENLGLF
QFVYSDDGKWNWSRYFGRTKATPMMIRNTKSPSRNSPTLNSNNRETDRKR
KPNKSTTTFIKRIQRPSSCSPFDARKFPLPITEKLYKESNFPNPSSDMKW
IKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR027752TTLL10
IPR004344TTL/TTLL_fam
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePFAMPF03133TTLcoord: 86..380
e-value: 1.3E-48
score: 165.6
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePROSITEPS51221TTLcoord: 30..390
score: 29.823
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 177..396
e-value: 5.7E-50
score: 171.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..459
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..442
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 130..377
IPR027752Protein polyglycylase TTLL10PANTHERPTHR46810FAMILY NOT NAMEDcoord: 20..453