Ferritin

Overview
NameFerritin
Smed IDSMED30027587
Length (bp)887
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ferritin (SMED30027587) t-SNE clustered cells

Violin plots show distribution of expression levels for Ferritin (SMED30027587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ferritin (SMED30027587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ferritin (SMED30027587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027587SMESG000068681.1 Contig3219GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027587SMESG000025375.1 Contig3219GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynx pouchSMED30027587SMESG000025375.1 tr5_10125mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30027587SMESG000025375.1 tr5_10125mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail stripeSMED30027587SMESG000025375.1 tr5_10125mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30027587SMESG000025375.1 dd_Smed_v4_6677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027587SMESG000025375.1 Contig47180newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027587SMESG000025375.1 Contig47180uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 85.1149 bits (209), Expect = 2.361e-19
Identity = 54/183 (29.51%), Postives = 100/183 (54.64%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQN+++  E  +  Q+NL+  + Y Y +M+ YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+     IF       Q +K+ +      +W SG   A++ A+ LE+ +N   + L   +    DP   + +++ ++NE+V++IK L   ++ L+     E  + E++ DK
Sbjct:    7 SQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR-----IFL------QDIKKPDCD----DWESGLN-AMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDK 173          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 85.1149 bits (209), Expect = 2.361e-19
Identity = 54/183 (29.51%), Postives = 100/183 (54.64%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQN+++  E  +  Q+NL+  + Y Y +M+ YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+     IF       Q +K+ +      +W SG   A++ A+ LE+ +N   + L   +    DP   + +++ ++NE+V++IK L   ++ L+     E  + E++ DK
Sbjct:    7 SQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR-----IFL------QDIKKPDCD----DWESGLN-AMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDK 173          
BLAST of Ferritin vs. Ensembl Human
Match: FTHL17 (ferritin heavy chain like 17 [Source:HGNC Symbol;Acc:HGNC:3987])

HSP 1 Score: 80.8777 bits (198), Expect = 8.418e-18
Identity = 53/183 (28.96%), Postives = 93/183 (50.82%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            S +RQ ++   +  +   + L+  + Y Y +MA YFNR +V L  +++YFL  S++K+ HA+ ++   N RGG      I    P+ Q              W SG   A++SA  LE+ +N   ++L   ++   DP     L+S +++E+V++IK L   +S L+   S    + E++ DK
Sbjct:    7 SQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIRK--PECQ-------------GWESGLV-AMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDK 173          
BLAST of Ferritin vs. Ensembl Human
Match: FTMT (ferritin mitochondrial [Source:HGNC Symbol;Acc:HGNC:17345])

HSP 1 Score: 81.2629 bits (199), Expect = 2.092e-17
Identity = 52/166 (31.33%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  158 TKSKENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNL 652
            T      S +RQNF+   E  +  Q+NL+  + Y Y +MA YF+R +V L  + +YFL +S E+  HA  ++   N+RGG+              Q +K+      Q +W SG   A++ A+ LE+ +N   + L   +    DP   + L++ ++NE+V+SIK L
Sbjct:   59 TGPAAGPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRI-----------RLQDIKKPE----QDDWESGL-HAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKEL 208          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 65.855 bits (159), Expect = 4.873e-13
Identity = 32/95 (33.68%), Postives = 56/95 (58.95%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTN 463
            S +RQN+++  E  +  Q+NL+  + Y Y +M+ YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+   + I P      Q  K+++
Sbjct:    7 SQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKPTGTPGHQGQKKSH 101          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 65.0846 bits (157), Expect = 1.292e-12
Identity = 48/182 (26.37%), Postives = 93/182 (51.10%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMTEFMTDKE 721
            S  RQN++  +E  + +Q+N++  + Y Y +M+ YF+R +V L    K+F E+S+E+  HA  ++   N RGG+ +          +Q   K  N       W +  K A ++A+ LE++ N   + L + +    D    + ++  +++E+V+SI     +++ LK      + E++ DKE
Sbjct:    2 SLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVV----------LQDIQKPEN-----DEWGTALK-AFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGP-GVGEYVFDKE 166          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 65.0846 bits (157), Expect = 1.292e-12
Identity = 48/182 (26.37%), Postives = 93/182 (51.10%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMTEFMTDKE 721
            S  RQN++  +E  + +Q+N++  + Y Y +M+ YF+R +V L    K+F E+S+E+  HA  ++   N RGG+ +          +Q   K  N       W +  K A ++A+ LE++ N   + L + +    D    + ++  +++E+V+SI     +++ LK      + E++ DKE
Sbjct:    2 SLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVV----------LQDIQKPEN-----DEWGTALK-AFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGP-GVGEYVFDKE 166          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 61.2326 bits (147), Expect = 2.602e-11
Identity = 47/182 (25.82%), Postives = 91/182 (50.00%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPA-TKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKE 721
            S  RQN+++ +E  + +Q+N++  + Y Y +M+A+F+R ++ L    K+F E+S+E+  HA  ++     RGG+   +        IQ+  K          W +   EA ++A+ LE+  N   + L   + +  D   T  + + ++ E+V SI      I+ +K +    + E++ DKE
Sbjct:    2 SLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQ-------NIQKPEKDE--------WGT-VLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGP-GLGEYLFDKE 166          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 61.2326 bits (147), Expect = 2.602e-11
Identity = 47/182 (25.82%), Postives = 91/182 (50.00%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPA-TKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKE 721
            S  RQN+++ +E  + +Q+N++  + Y Y +M+A+F+R ++ L    K+F E+S+E+  HA  ++     RGG+   +        IQ+  K          W +   EA ++A+ LE+  N   + L   + +  D   T  + + ++ E+V SI      I+ +K +    + E++ DKE
Sbjct:    2 SLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQ-------NIQKPEKDE--------WGT-VLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGP-GLGEYLFDKE 166          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer3HCH (gene:FBgn0030449 transcript:FBtr0073745)

HSP 1 Score: 80.1073 bits (196), Expect = 6.669e-18
Identity = 53/179 (29.61%), Postives = 100/179 (55.87%), Query Frame = 2
Query:  185 IRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMTEFMTDK 718
            +RQNF ++ E+ L +Q+N++  + + Y  MA +F+R ++   G +++FL+ S E+  HA  I++Y+NKRGG     II    P+         L  F     + T +AL  A+++E  +N   ++L   + +  DP   + +++ F+ E+V+  K L   IS+L+ ++  ++ EF+ DK
Sbjct:   16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGG----LIILSSVPQ--------PLPCF-----ASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVDGQKILADYISQLEKAQ-NQVGEFLFDK 176          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl27 (ferritin, heavy polypeptide-like 27 [Source:ZFIN;Acc:ZDB-GENE-040718-72])

HSP 1 Score: 91.6633 bits (226), Expect = 3.545e-22
Identity = 57/184 (30.98%), Postives = 99/184 (53.80%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            +S +RQN++   E L+ + +NL+  + Y Y +MA YF+R +V L G+ K+F + S E+  HA   + + NKRGG+ +            Q +K+         W++G   A+  A+QLE+ +N   ++L   + +  DP   + L+S ++NE+VE+IK L   I+ L    +    M E++ DK
Sbjct:    2 DSQVRQNYDRDCEALINKMINLELYAGYTYTSMAFYFDRDDVALPGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVL-----------QDIKKPERDE----WDNGLT-AMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLESHYLNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDK 169          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl29 (ferritin, heavy polypeptide-like 29 [Source:ZFIN;Acc:ZDB-GENE-080722-16])

HSP 1 Score: 90.1225 bits (222), Expect = 1.329e-21
Identity = 57/182 (31.32%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  185 IRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDKE 721
            IRQN++   E L+ + +NL+  + Y Y +MA YF R +V L G+ K+F   S E+  HA   + + NKRGG+ +            Q +K+         W++G   A+  A+QLE+ +N   ++L   + +  DP   ++L+S ++NE+VE+IK L   I+ L    +    M E++ DK 
Sbjct:    6 IRQNYDSDCEALINKMINLELYAGYTYTSMAHYFKRDDVALPGFAKFFKNNSEEEREHAEKFMEFQNKRGGRIVL-----------QDIKKPGRDV----WDNGLT-AMQCALQLEKSVNQALLDLHKVASQKGDPHLCDLLESHYLNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKH 171          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 88.5817 bits (218), Expect = 6.934e-21
Identity = 54/184 (29.35%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQNF E  E  +  Q+N++  + Y Y +M+ YF+R +  L  + K+F  +S+E+  HA  ++ + N+RGG+ F+  +  P                 +  W SG  EAL+ A+QLE+ +N   + L   + +  DP   + +++ +++E+V+SIK L   ++ L+     +  M E+M DK
Sbjct:    3 SQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPE----------------KDEWGSGV-EALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDK 169          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 88.5817 bits (218), Expect = 6.934e-21
Identity = 54/184 (29.35%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQNF E  E  +  Q+N++  + Y Y +M+ YF+R +  L  + K+F  +S+E+  HA  ++ + N+RGG+ F+  +  P                 +  W SG  EAL+ A+QLE+ +N   + L   + +  DP   + +++ +++E+V+SIK L   ++ L+     +  M E+M DK
Sbjct:    3 SQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPE----------------KDEWGSGV-EALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDK 169          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl30 (ferritin, heavy polypeptide-like 30 [Source:ZFIN;Acc:ZDB-GENE-071004-57])

HSP 1 Score: 87.4261 bits (215), Expect = 1.543e-20
Identity = 56/182 (30.77%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  185 IRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDKE 721
            IRQN++   E  + + +NL+  + Y Y +MA YF R +V L G  K+F + S E+  HA   + + NKRGG+ +            Q +K+ +       W +G   A+  A+QLE+ +N   ++L   +  + DP   + L+S ++NE+VE+IK L   I+ L    +    M E++ DK+
Sbjct:    6 IRQNYDRDCEAAINKMINLELYAAYTYTSMAHYFKRDDVALSGLAKFFKKNSEEEREHAEKFMEFQNKRGGRIVL-----------QDIKKPDRDV----WGNGLI-AMQCALQLEKNVNQALLDLHKLATEMGDPHLCDHLESHYLNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKQ 171          
BLAST of Ferritin vs. Ensembl Xenopus
Match: nop53 (NOP53 ribosome biogenesis factor [Source:Xenbase;Acc:XB-GENE-853827])

HSP 1 Score: 89.7373 bits (221), Expect = 3.775e-21
Identity = 59/183 (32.24%), Postives = 101/183 (55.19%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            S +RQN+++  E  +  QVN++  + Y Y +MA YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+     IF       Q +K+ +       W +G  EAL+ ++QLE+ +N   + L   S    DP   + L+S +++E+V+S+K L   I+ L+   +    M E++ DK
Sbjct:    3 SQVRQNYHQECEAAINRQVNMELYASYVYLSMAYYFDRDDVALKNFSKYFLHQSHEEREHAEKLMKMQNQRGGR-----IFL------QDVKKPDRDE----WANGL-EALECSLQLEKSVNQSLLELHKLSTDHNDPHLCDFLESHYLDEQVKSMKELGDHITNLRRMGAPSNGMAEYLFDK 169          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC75752 (uncharacterized protein MGC75752 [Source:NCBI gene;Acc:394820])

HSP 1 Score: 86.6557 bits (213), Expect = 4.204e-20
Identity = 58/184 (31.52%), Postives = 97/184 (52.72%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVL-KSFINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            +S IRQN++E  E  +    NL+  + Y Y ++  YF+R +V L  + KY+ E S +K  HA +++ + NKRGG+ +            Q +K+ +       W +GTK A++ A+ LE+ +N   ++L   +    DP   + L + F+ EEV+ IK L   ++ LK  K  E  M E++ DK
Sbjct:    4 QSQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNKRGGRVVL-----------QDIKKPDADE----WGNGTK-AMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDK 171          
BLAST of Ferritin vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:NCBI gene;Acc:394604])

HSP 1 Score: 86.2705 bits (212), Expect = 5.301e-20
Identity = 57/184 (30.98%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            +S +RQNFN   E  +   VN++  + Y Y +M+ YF+R +V L    K+F E+S+E+  HA   + Y NKRGG+            + Q +K+         W + T EA+ +A+QLE+ +N   ++L   +    DP   + L+S ++ E+V+++K L   I+ LK   + +  M E++ DK
Sbjct:    2 QSQVRQNFNSDCEAAINRMVNMELYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGR-----------AVLQDIKKPERDE----WGN-TLEAMQAALQLEKTVNQALLDLHKLASDKTDPHLCDFLESEYLEEQVKAMKELGDYITNLKRLGVPQNGMGEYLFDK 169          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 79.7221 bits (195), Expect = 1.371e-17
Identity = 53/183 (28.96%), Postives = 95/183 (51.91%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQN++   E  +   VNL+  + Y Y +M+ YF+R +V L    ++F E+S E+   A  ++   NKRGG+ +            Q +K+         W S T +A+ +A+ LE+++N   ++L N +   KDP   + L+S  ++E+V+ +K     I+ LK   + +  M E++ DK
Sbjct:    3 SQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVL-----------QDIKKPERDE----WGS-TLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDK 169          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 79.7221 bits (195), Expect = 1.637e-17
Identity = 53/183 (28.96%), Postives = 95/183 (51.91%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQN++   E  +   VNL+  + Y Y +M+ YF+R +V L    ++F E+S E+   A  ++   NKRGG+ +            Q +K+         W S T +A+ +A+ LE+++N   ++L N +   KDP   + L+S  ++E+V+ +K     I+ LK   + +  M E++ DK
Sbjct:    3 SQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVL-----------QDIKKPERDE----WGS-TLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDK 169          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 87.4261 bits (215), Expect = 2.065e-20
Identity = 55/183 (30.05%), Postives = 101/183 (55.19%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQN+++  E  +  Q+NL+  + Y Y +M+ YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+     IF       Q +K+ +    + +W SG   A++ A+ LE+ +N   + L   +    DP   + +++ +++E+V+SIK L   ++ L+     E  M E++ DK
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR-----IFL------QDIKKPD----RDDWESGLN-AMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDK 173          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 87.4261 bits (215), Expect = 2.065e-20
Identity = 55/183 (30.05%), Postives = 101/183 (55.19%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S +RQN+++  E  +  Q+NL+  + Y Y +M+ YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+     IF       Q +K+ +    + +W SG   A++ A+ LE+ +N   + L   +    DP   + +++ +++E+V+SIK L   ++ L+     E  M E++ DK
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR-----IFL------QDIKKPD----RDDWESGLN-AMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDK 173          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftmt (ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:1914884])

HSP 1 Score: 82.4185 bits (202), Expect = 4.775e-18
Identity = 53/184 (28.80%), Postives = 96/184 (52.17%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRL--KSSKIYEMTEFMTDKE 721
            S +RQNF+   E  +  Q+NL+  + Y Y +MA YF+R +V L  + KYFL +S E+  HA  ++   N+RGG+              Q +K+ +    + +W  G + A++ A+ LE+ +N   ++L   +    DP   + L++ +++E+V+SIK L   +  L    +    + E++ DK 
Sbjct:   62 SRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYFLRQSLEEREHAEKLMKLQNQRGGRI-----------CLQDIKKPD----KDDWECGLR-AMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAGLAEYLFDKH 229          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 74.7146 bits (182), Expect = 3.499e-16
Identity = 43/138 (31.16%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDP 592
            S +RQN+++  E  +  Q+NL+  + Y Y +M+ YF+R +V L  + KYFL +S+E+  HA  ++   N+RGG+     IF       Q +K+ +    + +W SG   A++ A+ LE+ +N   + L   +    DP
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR-----IFL------QDIKKPD----RDDWESGLN-AMECALHLEKSVNQSLLELHKLATDKNDP 128          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1 (ferritin light polypeptide 1 [Source:MGI Symbol;Acc:MGI:95589])

HSP 1 Score: 65.855 bits (159), Expect = 1.540e-12
Identity = 44/167 (26.35%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S IRQN++  +E  +   VNL   + Y Y ++  +F+R +V L G   +F E + EK   A  ++ + N RGG+ +       +  +Q+          Q  W   T+EA+++A+ +E+ +N   ++L        DP   + L+S ++++EV+ IK +   ++ L+
Sbjct:    3 SQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRAL-------FQDVQK--------PSQDEWGK-TQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLR 153          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P07797|FRI3_LITCT (Ferritin, lower subunit OS=Lithobates catesbeianus OX=8400 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.424e-24
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            ES +RQNF++  E  L   VNLK+ S Y Y +MA+YFNR +V L  + K+F E+S E+  HA  +I Y N+RGG+ F+  +  P                 + +W +G  EAL +A++L++ +N   ++L   +    DP   + L+S +++E VE+IK L   I+ LK
Sbjct:    2 ESQVRQNFHQDCEAGLNRTVNLKFHSSYVYLSMASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRGGRVFLQSVEKPE----------------RDDWANGL-EALQTALKLQKSVNQALLDLHAVAADKSDPHMTDFLESPYLSESVETIKKLGDHITSLK 153          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|Q26061|FRI_PACLE (Ferritin OS=Pacifastacus leniusculus OX=6720 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 7.307e-24
Identity = 57/183 (31.15%), Postives = 101/183 (55.19%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEF 724
            S IR N++E  E +  +Q+NL++ + Y Y +M  YF+R ++ L G  K+F + S+E+  H + ++ Y NKRG + + + I    P +Q+             W +   +AL +A+ LE  +N   ++L   + ++ DP    +L+  F+ E+VESI+ +  LI+RLK +    + EF+ DKE 
Sbjct:    3 SQIRHNYHEDCEPI-NKQINLEFYASYVYMSMGHYFDRDDISLPGASKFFKDSSDEEREHGQKLMKYQNKRGARIVLQAIAA--PSLQE-------------WGN-LHDALQAALDLENEVNQSLLDLDATASKINDPHLTNMLEGEFLEEQVESIEKIGNLITRLKRAGTSGLGEFLFDKEL 168          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85838|FRIH_PSEBE (Ferritin, heavy subunit OS=Pseudotrematomus bernacchii OX=40690 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.802e-22
Identity = 58/184 (31.52%), Postives = 103/184 (55.98%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            ES +RQNF++  E  +  Q+NL+  + Y+Y +MA YF+R +V L G+  +F ++S E+  HA  ++ + N+RGG+     IF       Q +K+ +       W SG  +AL+ A+QLE+ +N   ++L        DP   + L++ +++E+V+SIK L   ++ L+   +    M E++ DK
Sbjct:    2 ESQVRQNFHKDCEAAINRQINLELYASYSYLSMAYYFDRDDVALPGFAHFFKQQSEEEREHAEKLLKFQNQRGGR-----IFL------QDVKKPDRDE----WGSGL-DALECALQLEKNVNQSLLDLHKVCSEHNDPHMCDFLETHYLDEQVKSIKELGDWVTNLRRLGAPQNGMAEYLFDK 169          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P42577|FRIS_LYMST (Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 6.112e-22
Identity = 59/182 (32.42%), Postives = 99/182 (54.40%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMTEFMTDKE 721
            S  RQN++   E  +  Q+N++  + Y+YQ+MA YF+R +V L G++K+F  +S E+  HA  ++ Y NKRGG+ +            Q +K+ +    +  W +G  EA+  A+QLE+ +N   ++L        D    + L+S F+ E+V+SIK L   I+ LK      + E++ DKE
Sbjct:    4 SQARQNYHAESEAGINRQINMELYASYSYQSMAYYFDRDDVALPGFHKFFKHQSEEEREHAEKLMKYQNKRGGRIVL-----------QDIKKPD----RDEWGTGL-EAMQVALQLEKSVNQSLLDLHKLCTSHDDAQMADFLESEFLEEQVKSIKELSDYITNLKRVGP-GLGEYIFDKE 168          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85837|FRIH_TRENE (Ferritin, heavy subunit OS=Trematomus newnesi OX=35730 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.469e-21
Identity = 58/184 (31.52%), Postives = 101/184 (54.89%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            ES +RQNF++  E  +  Q+NL+  + Y+Y +MA YF+R +V L G+  +F  +S E+  HA  ++   N+RGG+     IF       Q +K+ +       W SG  +AL+ A+QLE+ +N   ++L        DP   + L++ +++E+V+SIK L   ++ L+   +    M E++ DK
Sbjct:    2 ESQVRQNFHKDCEAAINRQINLELYASYSYLSMAYYFDRDDVALPGFAHFFKHQSEEEREHAEKLMKQQNQRGGR-----IFL------QDVKKPDRDE----WGSGL-DALECALQLEKNVNQSLLDLHKVCSEHNDPHMCDFLETHYLDEQVKSIKELGDWVTNLRRLGAPQNGMAEYLFDK 169          
BLAST of Ferritin vs. TrEMBL
Match: A0A3M7RDN2 (Ferritin OS=Brachionus plicatilis OX=10195 GN=BpHYR1_048407 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.423e-31
Identity = 71/183 (38.80%), Postives = 112/183 (61.20%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVL-KSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEF 724
            S IRQNF+   EQ L EQVNL+ T+ Y YQ+M+ YFNR +V L G++K++ E S+E+  HA   + Y+NKRGG+ I K +        +S ++T        W +G  E+L++A++LE+ +N   + L + + +  DP   + L + F++E+VESIK L  LI++LK +    + EF+ DKE 
Sbjct:    5 SRIRQNFHAECEQALNEQVNLELTASYIYQSMSFYFNRDDVALPGFHKFYKENSDEEREHAEKFMKYVNKRGGRIILKDV--------KSPEKT-------EWKNGL-ESLEAALELEKRVNDSLLKLHSLASQHTDPHLSDFLEEEFLDEQVESIKKLGDLITKLKRAGPEGLGEFLFDKEL 171          
BLAST of Ferritin vs. TrEMBL
Match: D3PG35 (Ferritin OS=Lepeophtheirus salmonis OX=72036 GN=FRIH1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.173e-25
Identity = 59/167 (35.33%), Postives = 104/167 (62.28%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S IRQN++   E L+ +Q+N++  + Y Y +M AYF+R +V L G+ K+F E S+E+ +HARN+I+Y   RGG    +++F       Q + R N+ +    W S   EA+++A+QLE+ +N   +N+   + + +DP   + L+S ++ E+V+ IK + IL++R+K
Sbjct:    3 SQIRQNYDSECEALINKQINMELFASYTYLSMGAYFSRDDVALEGFAKFFYESSSEENTHARNLINYQTLRGG----RVVF-------QDISRPNVET----WASPV-EAMEAALQLEKDVNASLLNVHGSASKKEDPQLCDFLESDYLQEQVDGIKKIGILLTRMK 153          
BLAST of Ferritin vs. TrEMBL
Match: D3PHQ8 (Ferritin OS=Lepeophtheirus salmonis OX=72036 GN=FRIH1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.632e-25
Identity = 59/167 (35.33%), Postives = 104/167 (62.28%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S IRQN++   E L+ +Q+N++  + Y Y +M AYF+R +V L G+ K+F E S+E+ +HARN+I+Y   RGG    +++F       Q + R N+ +    W S   EA+++A+QLE+ +N   +N+   + + +DP   + L+S ++ E+V+ IK + IL++R+K
Sbjct:    3 SQIRQNYDSECEALINKQINMELFASYTYLSMGAYFSRDDVALEGFAKFFYESSSEENTHARNLINYQTLRGG----RVVF-------QDISRPNVET----WASPV-EAMEAALQLEKDVNASLLNVHGSASKKEDPQLCDFLESDYLQEQVDGIKKIGILLTRMK 153          
BLAST of Ferritin vs. TrEMBL
Match: Q0P0L7 (Ferritin OS=Penaeus chinensis OX=139456 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.824e-24
Identity = 61/183 (33.33%), Postives = 103/183 (56.28%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEF 724
            S +RQN++E  E  + +Q+N++  + Y Y +MA YF R +V L G+ K+F E S+E+  HA+  + Y NKRGG+ + + I    P +Q+             W +G  EAL +A+ LE+ +N   + L   +    DP   ++L+  ++ E+V+SIK +  +I+RLK +    + E+M DKE 
Sbjct:    3 SQVRQNYHEDCEASINKQINMELYASYVYLSMAHYFERDDVALPGFAKFFKESSDEERDHAQIFMKYQNKRGGRIVLQQIAA--PSMQE-------------WGTGL-EALQAALDLEKQVNQSLLELHGTASGNNDPHLTKLLEDEYLEEQVDSIKKIGDMITRLKRAGPAGLGEYMFDKEL 169          
BLAST of Ferritin vs. TrEMBL
Match: C1BSZ4 (Ferritin OS=Lepeophtheirus salmonis OX=72036 GN=FRIH1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.768e-24
Identity = 58/167 (34.73%), Postives = 103/167 (61.68%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S IRQN++   E L+ +Q+N++  + Y Y +M AYF+R +V L G+ K+F E S+E+ +HARN+I+Y   RGG    +++F       Q + R N+ +    W S   EA+++A+QLE+ +N   +N+   + + +DP   + L+S ++ E+V+ IK +  L++R+K
Sbjct:    3 SQIRQNYDSECEALINKQINMELFASYTYLSMGAYFSRDDVALEGFAKFFYESSSEENTHARNLINYQTLRGG----RVVF-------QDISRPNVET----WASPV-EAMEAALQLEKDVNASLLNVHGSASKKEDPQLCDFLESDYLKEQVDGIKKIGTLLTRMK 153          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000055495.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:15691409:15695719:1 gene:ENSAMXG00000010828.2 transcript:ENSAMXT00000055495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.527e-22
Identity = 62/195 (31.79%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  170 ENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSF--------QINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDKE 721
            E  S I QN++   E  +   VN+++ + Y Y +MA YF+R +V L G+  +F + S+E+  HA   + + NKRGG  +  II     ++ Q        SF        +  W +G  EA+  A+QLE+ +N   ++L N +    DP   + L+S ++NE+VE+IKNL   I+ L    +   +M E++ DK 
Sbjct:    1 EKPSQIHQNYHSDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALQGFAHFFKQNSHEEREHAEKFLEFQNKRGGAVV--IIQLMNEQVSQYFCLYGDGSFPFTHQKPERDEWGTGL-EAMQCALQLEKKVNQALLDLHNIASERGDPHLCDFLESNYLNEQVEAIKNLGDHITNLTKMDAGNNKMAEYLFDKH 192          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000039506.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:15692711:15695719:1 gene:ENSAMXG00000010828.2 transcript:ENSAMXT00000039506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.563e-22
Identity = 62/195 (31.79%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  170 ENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSF--------QINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDKE 721
            E  S I QN++   E  +   VN+++ + Y Y +MA YF+R +V L G+  +F + S+E+  HA   + + NKRGG  +  II     ++ Q        SF        +  W +G  EA+  A+QLE+ +N   ++L N +    DP   + L+S ++NE+VE+IKNL   I+ L    +   +M E++ DK 
Sbjct:    2 EEPSQIHQNYHSDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALQGFAHFFKQNSHEEREHAEKFLEFQNKRGGAVV--IIQLMNEQVSQYFCLYGDGSFPFTHQKPERDEWGTGL-EAMQCALQLEKKVNQALLDLHNIASERGDPHLCDFLESNYLNEQVEAIKNLGDHITNLTKMDAGNNKMAEYLFDKH 193          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033391.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 92.4337 bits (228), Expect = 2.198e-22
Identity = 62/192 (32.29%), Postives = 101/192 (52.60%), Query Frame = 2
Query:  158 TKSKENESS-IRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            T   E E+S +RQN++   E  +   VN+++ + Y Y +MA YF+R +V L G+  +F E S+E+  HA   + + NKRGG+ F+  I  P   +                W +G  EA+  A+QLE+ +N   ++L N +    DP   + L+S ++NE+VE IK L   I+ L    +   +M E++ DK
Sbjct:    2 TSHSEMENSLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDE----------------WGTGL-EAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNKMAEYLFDK 176          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000052792.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 92.0485 bits (227), Expect = 2.974e-22
Identity = 59/184 (32.07%), Postives = 97/184 (52.72%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            S +RQN++   E  +   VN+++ + Y Y +MA YF+R +V L G+  +F E S+E+  HA   + + NKRGG+ F+  I  P   +                W +G  EA+  A+QLE+ +N   ++L N +    DP   + L+S ++NE+VE IK L   I+ L    +   +M E++ DK
Sbjct:    4 SLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDE----------------WGTGL-EAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNKMAEYLFDK 170          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000042393.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 90.5077 bits (223), Expect = 9.405e-22
Identity = 58/184 (31.52%), Postives = 97/184 (52.72%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            S +RQN++   E  +   VN++  + Y Y +MA YF+R +V L G+  +F E S+E+  HA  ++S+ NKRGG+ F+  I  P   +                W +G  EA+  A+QLE+ +N   ++L   +    DP   + L++ ++NE+VE+IK L   I+ L    +    M E++ DK
Sbjct:    4 SQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDE----------------WGTGL-EAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDK 170          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006468.1 (pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1 gene:ENSPMAG00000005828.1 transcript:ENSPMAT00000006468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 3.910e-26
Identity = 63/183 (34.43%), Postives = 102/183 (55.74%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYEMT--EFMTDK 718
            S IRQNF++ +E  +  QVN +  + Y Y +MA+YF+R +V L  ++K+F + S+E+  HA  ++ Y NKRGG+ + + I    P+  +             W SG  EA+  A+QLE+ +N   ++L   +   KDP   + L+S F+ E+VESIK L   ++ LK   +   T  E++ DK
Sbjct:    7 SQIRQNFSQEVEAAINRQVNQELYASYVYLSMASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKEQKPERDE-------------WGSGL-EAMQLALQLEKTVNQALLDLHALASEKKDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPHSTTGEYLFDK 175          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009440.1 (pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 gene:ENSPMAG00000008472.1 transcript:ENSPMAT00000009440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 1.119e-24
Identity = 58/183 (31.69%), Postives = 103/183 (56.28%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK--SSKIYEMTEFMTDK 718
            S +RQN+ + +E  +  Q+N++ ++ Y Y +MA YF+R +V L  ++K+F E+S+E+  HA  +++Y NKRGG+ + K +    P+  +             W SG  EA+  A+QLE+ +N   ++L     +  DP   + L+S ++ E+VE+IK L   ++ LK   +    M E++ DK
Sbjct:    3 SQVRQNYAQDVEAAINRQINMELSASYVYLSMAYYFDRDDVALNNFFKFFKEQSHEEREHAEKLMAYQNKRGGRVVLKDVKK--PERDE-------------WGSGL-EAVQLALQLEKNVNQSLLDLHALGSKENDPQLCDFLESHYLEEQVEAIKKLGDFVTNLKRLGASQSGMGEYLFDK 169          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006438.1 (pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-1 gene:ENSPMAG00000005680.1 transcript:ENSPMAT00000006438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 2.319e-24
Identity = 61/183 (33.33%), Postives = 102/183 (55.74%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S IRQNF++ +E  +  QVN +  + Y Y ++A+YF+R +V L  ++K+F + S+E+  HA  ++ Y NKRGG+            + Q +K+      +  W SG  EA+  A+QLE+ +N   ++L   +    DP   + L+S F+ E+VESIK L   ++ LK   + +  M E++ DK
Sbjct:    3 SQIRQNFSQEVEAAINRQVNQELYASYVYLSLASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGR-----------AVLQDIKKPE----RDEWGSGL-EAMQLALQLEKTVNQALLDLHALASEKTDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPQSGMGEYLFDK 169          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008696.1 (pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 gene:ENSPMAG00000007869.1 transcript:ENSPMAT00000008696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.017e-23
Identity = 54/166 (32.53%), Postives = 94/166 (56.63%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLK 676
            S +RQN++  +E  +  QVN+   + Y + ++A+YF+R +V L  + K+F E S+++  HA  +++Y NKRGG+ + + I        ++ +R        +W     EA+ +A+QL++ IN   ++L  ++    DP   E LK F+ E+VESIK L   I+ LK
Sbjct:    7 SQVRQNYSPDVEAAINRQVNMTLHASYVFLSLASYFDRDDVALKNFRKFFKELSDKEREHADKLLAYQNKRGGRVVLRDI--------KTPERD-------DWGH-ILEAMQTALQLQKSINQSLLDLHGQAREKNDPQLCEFLKDFLEEQVESIKKLGDHITNLK 156          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009047.1 (pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 gene:ENSPMAG00000008168.1 transcript:ENSPMAT00000009047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 8.767e-22
Identity = 61/190 (32.11%), Postives = 98/190 (51.58%), Query Frame = 2
Query:  161 KSKENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            +++   S +RQNF+E  E  +  Q+N +  + Y Y +MA YF+R +V L    K+F E+S E+  HA  ++ Y N+RGG+ F+  +  P   +                W +   EAL  A+QLE+ +N   + L   +    DP   + L S ++ E+VESIKN+   I+ LK   + +  M EF+ DK
Sbjct:    1 RTRSAMSLVRQNFSEECEAAINRQINQELYASYVYLSMAFYFDRDDVALKHLSKFFREQSLEERGHAEKLMGYQNRRGGRIFLQDVQKPERDE----------------WGNAL-EALTLALQLEKNVNQALLELHALATEHNDPQLCDFLDSHYLEEQVESIKNIADHITSLKKMGVPQSGMGEFLFDK 173          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO35374 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6])

HSP 1 Score: 89.7373 bits (221), Expect = 5.591e-22
Identity = 52/167 (31.14%), Postives = 94/167 (56.29%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S  RQN++E  E  + +Q+NL+  + Y Y +MA YF+R +V L G++K+F ++++E+  HA  ++ + N+RGG+ +            Q++K+         W SG  EA+ +A+ LE+++N   I L   + +  D    + ++  F+ E+VESI+ L   I+ LK
Sbjct:    2 SLCRQNYHEECEAGINKQINLELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEKLMKFQNQRGGRIVL-----------QNVKKPERDE----WGSGL-EAMQTALDLEKHVNQALIELEKTAEKNGDAQMSDFIEDHFLTEQVESIRELSGYIAVLK 152          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI8])

HSP 1 Score: 89.7373 bits (221), Expect = 6.224e-22
Identity = 51/167 (30.54%), Postives = 95/167 (56.89%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S  RQN++E  E  + +Q+NL+  + Y Y +MA +F+R +V L G++KYF+E S+E+  HA  +  +  +RGG+ +            Q +KR        +W  G ++A+ +A+ LE+++N   ++L   + +  D   ++ L+S ++ E+VE+IK L   ++ LK
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKFQLQRGGRIVL-----------QDIKRPERD----DWGCG-QDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLK 154          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI7])

HSP 1 Score: 87.8113 bits (216), Expect = 3.065e-21
Identity = 50/167 (29.94%), Postives = 96/167 (57.49%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S  RQN++E  E  + +Q+NL+  + Y Y +MA +F+R +V L G++KYF++ S+E+  HA  +  +  +RGG+ +            Q +KR      + +W  G ++A+ +A+ LE+++N   ++L   + +  D   ++ L+S ++ E+VE+IK L   ++ LK
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKFQLQRGGRIVL-----------QDIKRPE----RDDWGCG-QDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHLTNLK 154          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO39948 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6])

HSP 1 Score: 87.0409 bits (214), Expect = 6.701e-21
Identity = 50/167 (29.94%), Postives = 94/167 (56.29%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S  RQN++E  E  + +Q+NL+  + YAY +MA +F+R +V L G++KYFL+ S+E+  HA  ++ + N+RGG+ +            Q +K+      +  W  G  +++  A+ LE+++N   ++L   + +  D    + ++  F+ E+VE+IK L   ++ LK
Sbjct:    2 SLCRQNYHEECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKFQNERGGRIVL-----------QDIKKPE----KDEWGCGM-DSIQVALDLEKHVNQALLDLHKIAEKHGDAQMTDFIEGNFLTEQVEAIKELAGHLTNLK 152          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO32257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL1])

HSP 1 Score: 85.5001 bits (210), Expect = 2.048e-20
Identity = 50/167 (29.94%), Postives = 94/167 (56.29%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLK 676
            S  RQN++E  E  + +Q+NL+  + Y Y +MA +F+R +V L G++KYF++ S+E+  HA  +  +  +RGG+ +            Q +KR        +W  G ++A+ +A+ LE+++N    +L   + +  D   ++ L+S ++ E+VE+IK L   ++ LK
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKFQLQRGGRIVL-----------QDIKRPERD----DWGCG-QDAIQAALDLEKHVNQALHDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLK 154          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020975.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 98.2117 bits (243), Expect = 1.251e-24
Identity = 62/185 (33.51%), Postives = 103/185 (55.68%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIY--EMTEFMTDKE 721
            ES +RQN++   E  +   VN++  + Y Y +MA YF+R +V L G+  +F E S+E+  HA  ++S+ NKRGG+     IF       Q +K+ + +     W SG  EA+  A+QLE+ +N   ++L   +   KDP   + L++ ++NE+VESIK +   I+ L     +  +M E++ DK 
Sbjct:    2 ESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGR-----IFL------QDVKKPDRNE----WGSGL-EAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKH 170          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020972.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 98.2117 bits (243), Expect = 1.251e-24
Identity = 62/185 (33.51%), Postives = 103/185 (55.68%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIY--EMTEFMTDKE 721
            ES +RQN++   E  +   VN++  + Y Y +MA YF+R +V L G+  +F E S+E+  HA  ++S+ NKRGG+     IF       Q +K+ + +     W SG  EA+  A+QLE+ +N   ++L   +   KDP   + L++ ++NE+VESIK +   I+ L     +  +M E++ DK 
Sbjct:    2 ESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGR-----IFL------QDVKKPDRNE----WGSGL-EAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKH 170          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020974.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 98.2117 bits (243), Expect = 1.672e-24
Identity = 62/185 (33.51%), Postives = 103/185 (55.68%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIY--EMTEFMTDKE 721
            ES +RQN++   E  +   VN++  + Y Y +MA YF+R +V L G+  +F E S+E+  HA  ++S+ NKRGG+     IF       Q +K+ + +     W SG  EA+  A+QLE+ +N   ++L   +   KDP   + L++ ++NE+VESIK +   I+ L     +  +M E++ DK 
Sbjct:    9 ESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGR-----IFL------QDVKKPDRNE----WGSGL-EAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKH 177          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020971.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 97.8265 bits (242), Expect = 1.767e-24
Identity = 60/186 (32.26%), Postives = 100/186 (53.76%), Query Frame = 2
Query:  176 ESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGK-FIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIY--EMTEFMTDKE 721
            ES +RQN++   E  +   VN++  + Y Y +MA YF+R +V L G+  +F E S+E+  HA  ++S+ NKRGG+ F+  +  P   +                W SG  EA+  A+QLE+ +N   ++L   +   KDP   + L++ ++NE+VESIK +   I+ L     +  +M E++ DK 
Sbjct:    2 ESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPERDE----------------WGSGL-EAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKH 170          
BLAST of Ferritin vs. Ensembl Medaka
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:101155346])

HSP 1 Score: 89.3521 bits (220), Expect = 2.982e-21
Identity = 62/183 (33.88%), Postives = 98/183 (53.55%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKS-FINEEVESIKNLQILISRLKSSKIYE--MTEFMTDK 718
            S IRQNFN+  E  +  Q+NL+  + Y Y +MA YF R +  L  + K+F  +S E+  HA  ++S  NKRGG+     IF       Q +K+ +       W S   EAL+ A+QLE+ +N   ++L   +    DP   + +++ F++E+V+SIK L   IS L+     +  M E++ DK
Sbjct:    3 SQIRQNFNQDCEAAINRQINLELYASYVYLSMAYYFERDDKHLPNFAKFFNSQSKEEREHAEKLMSLQNKRGGR-----IFL------QDIKKPDRDE----WGSSL-EALECALQLEKSVNQSLLDLQKLATDHGDPHMCDFIETHFLDEQVKSIKQLADWISNLRRMGAPQNGMAEYLFDK 169          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000025375.1 (SMESG000025375.1)

HSP 1 Score: 436.802 bits (1122), Expect = 7.209e-157
Identity = 217/220 (98.64%), Postives = 217/220 (98.64%), Query Frame = 2
Query:   74 TLMITKKLSAIFVILLFCAQSSFCPEIKTKSKENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEFARE 733
            TLMITK LSAIFVILLFCAQSSFCPEIKTKSKENES IRQNFNE IEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEFARE
Sbjct:    3 TLMITKNLSAIFVILLFCAQSSFCPEIKTKSKENESPIRQNFNENIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEFARE 222          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000025375.1 (SMESG000025375.1)

HSP 1 Score: 432.565 bits (1111), Expect = 3.158e-155
Identity = 215/218 (98.62%), Postives = 215/218 (98.62%), Query Frame = 2
Query:   80 MITKKLSAIFVILLFCAQSSFCPEIKTKSKENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEFARE 733
            MITK LSAIFVILLFCAQSSFCPEIKTKSKENES IRQNFNE IEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEFARE
Sbjct:    1 MITKNLSAIFVILLFCAQSSFCPEIKTKSKENESPIRQNFNENIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEFARE 218          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000030981.1 (SMESG000030981.1)

HSP 1 Score: 133.265 bits (334), Expect = 4.638e-38
Identity = 77/207 (37.20%), Postives = 116/207 (56.04%), Query Frame = 2
Query:  104 IFVILLFCAQSSFCPEIKTKSKENESSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKEF 724
            + + LLF A  +   E+           RQNFN  IE+ L  Q+N++  +FY Y++M A+F RP+VGL G+ K F + ++E+L HAR +I Y+NKRGG ++P  I              +LSS   +W  G   A++ A+Q E+ +N K I L   +    DP T+  L  F+ E++ SI +LQ+LISR    K YE+ EF+ D+E 
Sbjct:    3 LLIFLLFSATVTAYGEV-----------RQNFNSVIEKGLNSQINMELKAFYIYESMVAFFQRPDVGLQGFEKMFRKSADEELKHAREMIEYMNKRGGIYVPDAI--------------SLSS-NDSW-KGAYYAVNDALQKEKDVNSKIIELHVLAGNYGDPNTQNFLDDFLMEQIHSIASLQVLISRFDRMKNYELAEFLIDEEL 182          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000003695.1 (SMESG000003695.1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.994e-21
Identity = 56/182 (30.77%), Postives = 98/182 (53.85%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVL-KSFINEEVESIKNLQILISRLKSSKIYEMTEFMTDKE 721
            S IRQNF+   E  +  Q+NL+  + Y Y +MA YF+R +V L G+  +F + SNE+  HA+ +++Y NKRGG  I +        +++  K         +W  G  +++++A++LE+ +    + L   +    DP   + L + ++ E+VE+IK L   ++ LK      + EF+ DKE
Sbjct:    2 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQ-------DVEKPAK--------TDWGDGL-QSMEAALELEKQVQNSLLELHKVASNHSDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP-GLGEFIFDKE 166          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000039456.1 (SMESG000039456.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.469e-20
Identity = 52/166 (31.33%), Postives = 87/166 (52.41%), Query Frame = 2
Query:  179 SSIRQNFNETIEQLLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARNIISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDSAIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILISRLK 676
            S +RQNF+   E  + +Q+N +  + Y YQ M+ YFNR +V L G+  +F ++S E+  HA  ++ Y N RGG+ + K I    P I             + W   T  A +SA+ LE+ +N   +NL   +    DP   + L+ F+ E+V+S+K +   I+ ++
Sbjct:    3 SQVRQNFHSESEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAK--PSI-------------VEWTPET--AFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLEDFLEEQVDSMKEIADHITNIR 151          
The following BLAST results are available for this feature:
BLAST of Ferritin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FTH12.361e-1929.51ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTH12.361e-1929.51ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTHL178.418e-1828.96ferritin heavy chain like 17 [Source:HGNC Symbol;A... [more]
FTMT2.092e-1731.33ferritin mitochondrial [Source:HGNC Symbol;Acc:HGN... [more]
FTH14.873e-1333.68ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Ferritin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftn-21.292e-1226.37Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-21.292e-1226.37Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-12.602e-1125.82Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
ftn-12.602e-1125.82Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
back to top
BLAST of Ferritin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fer3HCH6.669e-1829.61gene:FBgn0030449 transcript:FBtr0073745[more]
back to top
BLAST of Ferritin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fthl273.545e-2230.98ferritin, heavy polypeptide-like 27 [Source:ZFIN;A... [more]
fthl291.329e-2131.32ferritin, heavy polypeptide-like 29 [Source:ZFIN;A... [more]
fth1a6.934e-2129.35ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1a6.934e-2129.35ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fthl301.543e-2030.77ferritin, heavy polypeptide-like 30 [Source:ZFIN;A... [more]
back to top
BLAST of Ferritin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop533.775e-2132.24NOP53 ribosome biogenesis factor [Source:Xenbase;A... [more]
MGC757524.204e-2031.52uncharacterized protein MGC75752 [Source:NCBI gene... [more]
fth1.15.301e-2030.98ferritin, heavy polypeptide 1, gene 1 [Source:NCBI... [more]
MGC797251.371e-1728.96MGC79725 protein [Source:NCBI gene;Acc:448524][more]
MGC797251.637e-1728.96MGC79725 protein [Source:NCBI gene;Acc:448524][more]
back to top
BLAST of Ferritin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fth12.065e-2030.05ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Fth12.065e-2030.05ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftmt4.775e-1828.80ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:... [more]
Fth13.499e-1631.16ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftl11.540e-1226.35ferritin light polypeptide 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Ferritin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P07797|FRI3_LITCT6.424e-2435.50Ferritin, lower subunit OS=Lithobates catesbeianus... [more]
sp|Q26061|FRI_PACLE7.307e-2431.15Ferritin OS=Pacifastacus leniusculus OX=6720 PE=1 ... [more]
sp|P85838|FRIH_PSEBE5.802e-2231.52Ferritin, heavy subunit OS=Pseudotrematomus bernac... [more]
sp|P42577|FRIS_LYMST6.112e-2232.42Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV... [more]
sp|P85837|FRIH_TRENE3.469e-2131.52Ferritin, heavy subunit OS=Trematomus newnesi OX=3... [more]
back to top
BLAST of Ferritin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7RDN26.423e-3138.80Ferritin OS=Brachionus plicatilis OX=10195 GN=BpHY... [more]
D3PG355.173e-2535.33Ferritin OS=Lepeophtheirus salmonis OX=72036 GN=FR... [more]
D3PHQ85.632e-2535.33Ferritin OS=Lepeophtheirus salmonis OX=72036 GN=FR... [more]
Q0P0L71.824e-2433.33Ferritin OS=Penaeus chinensis OX=139456 PE=2 SV=1[more]
C1BSZ42.768e-2434.73Ferritin OS=Lepeophtheirus salmonis OX=72036 GN=FR... [more]
back to top
BLAST of Ferritin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055495.11.527e-2231.79pep primary_assembly:Astyanax_mexicanus-2.0:2:1569... [more]
ENSAMXT00000039506.11.563e-2231.79pep primary_assembly:Astyanax_mexicanus-2.0:2:1569... [more]
ENSAMXT00000033391.12.198e-2232.29ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000052792.12.974e-2232.07ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000042393.19.405e-2231.52ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Ferritin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006468.13.910e-2634.43pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1... [more]
ENSPMAT00000009440.11.119e-2431.69pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 ... [more]
ENSPMAT00000006438.12.319e-2433.33pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-... [more]
ENSPMAT00000008696.11.017e-2332.53pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 g... [more]
ENSPMAT00000009047.18.767e-2232.11pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 ... [more]
back to top
BLAST of Ferritin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferritin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353745.591e-2231.14Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6][more]
EDO315796.224e-2230.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315783.065e-2129.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399486.701e-2129.94Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6][more]
EDO322572.048e-2029.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ferritin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020975.21.251e-2433.51ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020972.21.251e-2433.51ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020974.21.672e-2433.51ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020971.21.767e-2432.26ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
fth1b2.982e-2133.88ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ferritin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025375.17.209e-15798.64SMESG000025375.1[more]
SMESG000025375.13.158e-15598.62SMESG000025375.1[more]
SMESG000030981.14.638e-3837.20SMESG000030981.1[more]
SMESG000003695.15.994e-2130.77SMESG000003695.1[more]
SMESG000039456.11.469e-2031.33SMESG000039456.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027587 ID=SMED30027587|Name=Ferritin|organism=Schmidtea mediterranea sexual|type=transcript|length=887bp
CCTTATCACCTCGTAACAAGAGAATAGATATTGACGATTCTGTTGAATTC
ATTTCATTTTTATCTTTATGTTCACCCTGATGATAACAAAAAAATTGTCG
GCAATTTTTGTAATATTATTATTTTGTGCACAGTCTTCATTTTGTCCGGA
AATTAAGACGAAATCAAAAGAAAATGAAAGCTCCATTCGACAAAACTTTA
ATGAGACCATAGAGCAACTACTTGTTGAACAAGTCAATTTGAAATACACA
TCTTTCTACGCCTATCAAACAATGGCAGCATATTTTAATAGACCAAATGT
TGGATTGCTCGGTTATTATAAATATTTCCTCGAGAAATCAAACGAGAAAC
TCAGTCATGCGAGAAATATTATTTCATATATTAATAAAAGAGGCGGAAAG
TTCATCCCAAAAATAATATTTCCATATTGGCCTAAAATTCAGCAAAGCTT
GAAGCGAACTAATCTCTCTTCTTTCCAAATCAACTGGAATTCTGGAACAA
AAGAGGCGCTTGATTCGGCAATCCAATTGGAACAATATATCAATGTTAAA
TTTATCAATCTGTCCAATGAGTCCATTCGACTGAAGGATCCGGCTACAAA
AGAAGTTTTGAAATCTTTCATCAATGAAGAAGTTGAATCGATTAAAAACT
TACAGATTCTTATAAGTCGATTAAAGAGCTCAAAGATCTATGAAATGACA
GAATTCATGACGGACAAAGAGTTCGCCAGAGAATAATATACAACAATTGC
GAATTCTCTTGAAATAAATTATTTAAAAGTCAAAGGAGTATTTTATTGTC
TTGTTTACTCTTCTGGAGTGACATGATGATTGCTGTTCGCTCCTCAATTT
ACCAATGCTTGATTTGATCGCCTTGATACTTCCAAAC
back to top

protein sequence of SMED30027587-orf-1

>SMED30027587-orf-1 ID=SMED30027587-orf-1|Name=SMED30027587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MFTLMITKKLSAIFVILLFCAQSSFCPEIKTKSKENESSIRQNFNETIEQ
LLVEQVNLKYTSFYAYQTMAAYFNRPNVGLLGYYKYFLEKSNEKLSHARN
IISYINKRGGKFIPKIIFPYWPKIQQSLKRTNLSSFQINWNSGTKEALDS
AIQLEQYINVKFINLSNESIRLKDPATKEVLKSFINEEVESIKNLQILIS
RLKSSKIYEMTEFMTDKEFARE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000081pharynx pouch
PLANA:0000142posterior region of the whole animal
PLANA:0000422tail stripe
Vocabulary: INTERPRO
TermDefinition
IPR001519Ferritin
IPR012347Ferritin-like
IPR008331Ferritin_DPS_dom
IPR009040Ferritin-like_diiron
IPR009078Ferritin-like_SF
Vocabulary: molecular function
TermDefinition
GO:0008199ferric iron binding
GO:0004322ferroxidase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006879cellular iron ion homeostasis
GO:0006826iron ion transport
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008331Ferritin/DPS protein domainPFAMPF00210Ferritincoord: 50..203
e-value: 2.8E-21
score: 75.9
IPR012347Ferritin-likeGENE3DG3DSA:1.20.1260.10coord: 22..222
e-value: 2.4E-38
score: 133.7
NoneNo IPR availablePANTHERPTHR11431:SF75FERRITINcoord: 34..220
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.733
IPR001519FerritinPANTHERPTHR11431FERRITINcoord: 34..220
IPR009040Ferritin-like diiron domainPROSITEPS50905FERRITIN_LIKEcoord: 42..206
score: 29.068
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 39..219