Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30027581
Length (bp)2310
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30027581) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30027581) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30027581) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30027581) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027581

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30027581h1SMcG0014003 dd_Smed_v6_11367_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP16 (ubiquitin specific peptidase 16 [Source:HGNC Symbol;Acc:HGNC:12614])

HSP 1 Score: 74.7146 bits (182), Expect = 4.668e-13
Identity = 60/204 (29.41%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAK------------TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE C++   N              T+  K   I   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y       SH  + VL      +I  DF    +++S  +                      WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  651 LLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGT-MRSGHYTAYAKARTANSHLSNLVL----HGDIPQDF----EMESKGQ----------------------WFHISDTHVQAVPTTKVLNSQAYLLFYERI 821          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP16 (ubiquitin specific peptidase 16 [Source:HGNC Symbol;Acc:HGNC:12614])

HSP 1 Score: 74.7146 bits (182), Expect = 4.835e-13
Identity = 60/204 (29.41%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAK------------TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE C++   N              T+  K   I   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y       SH  + VL      +I  DF    +++S  +                      WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  652 LLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGT-MRSGHYTAYAKARTANSHLSNLVL----HGDIPQDF----EMESKGQ----------------------WFHISDTHVQAVPTTKVLNSQAYLLFYERI 822          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP16 (ubiquitin specific peptidase 16 [Source:HGNC Symbol;Acc:HGNC:12614])

HSP 1 Score: 74.7146 bits (182), Expect = 4.835e-13
Identity = 60/204 (29.41%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAK------------TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE C++   N              T+  K   I   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y       SH  + VL      +I  DF    +++S  +                      WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  652 LLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGT-MRSGHYTAYAKARTANSHLSNLVL----HGDIPQDF----EMESKGQ----------------------WFHISDTHVQAVPTTKVLNSQAYLLFYERI 822          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP45 (ubiquitin specific peptidase 45 [Source:HGNC Symbol;Acc:HGNC:20080])

HSP 1 Score: 62.7734 bits (151), Expect = 2.004e-9
Identity = 67/267 (25.09%), Postives = 109/267 (40.82%), Query Frame = 2
Query: 1382 LESKKMQSVFNAAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSKTNP--------------NAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS---KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKI----SNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            LE K ++S       S Q+   TLS   +T   E  +   L ++     L     + CE C+K                    T+  K   I  +P +L +++ RF Q     R V N  +  +P +L+L+P CS   K ++VG++   V+Y L+G++EH G  +  GHY +Y+ +   PS                            SEH+   +     N+  LK     S   W  +SD  ++ V +   +  QA +LFY R+
Sbjct:  542 LEGKHLRSY------SPQNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAEKKVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKV-NRHV-DFPLMLDLAPFCSATCKNASVGDK---VLYGLYGIVEHSGS-MREGHYTAYV-KVRTPSR-------------------------KLSEHNTKKK-----NVPGLKAADNESAGQWVHVSDTYLQVVPESRALSAQAYLLFYERV 765          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP45 (ubiquitin specific peptidase 45 [Source:HGNC Symbol;Acc:HGNC:20080])

HSP 1 Score: 62.7734 bits (151), Expect = 2.207e-9
Identity = 67/267 (25.09%), Postives = 109/267 (40.82%), Query Frame = 2
Query: 1382 LESKKMQSVFNAAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSKTNP--------------NAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS---KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKI----SNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            LE K ++S       S Q+   TLS   +T   E  +   L ++     L     + CE C+K                    T+  K   I  +P +L +++ RF Q     R V N  +  +P +L+L+P CS   K ++VG++   V+Y L+G++EH G  +  GHY +Y+ +   PS                            SEH+   +     N+  LK     S   W  +SD  ++ V +   +  QA +LFY R+
Sbjct:  590 LEGKHLRSY------SPQNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAEKKVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKV-NRHV-DFPLMLDLAPFCSATCKNASVGDK---VLYGLYGIVEHSGS-MREGHYTAYV-KVRTPSR-------------------------KLSEHNTKKK-----NVPGLKAADNESAGQWVHVSDTYLQVVPESRALSAQAYLLFYERV 813          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp16-45 (gene:FBgn0029763 transcript:FBtr0340462)

HSP 1 Score: 68.1662 bits (165), Expect = 2.535e-11
Identity = 69/291 (23.71%), Postives = 122/291 (41.92%), Query Frame = 2
Query: 1424 QSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSK----TNPNAK---TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQC-SKYSNVGN---EMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQP-LEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNL----------------------------------------------ENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            QS+ D   T++      + E  +   LN +     +     V C+ C++    ++P AK   T+ TK   +   P +L +++ RF Q+  +    K T+  SYP LL+++  C SK  N+ N   +   ++Y L+G++EH G  +  GHY +Y+  +P + P   +   LP    + +  D  ++  L+     +   E  HL  L                                               N++     W+ +SD+ V+ VS++T +K QA +LFY RI
Sbjct:  838 QSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRF-QLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGG-MYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKARE-QHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERI 1125          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp16-45 (gene:FBgn0029763 transcript:FBtr0340461)

HSP 1 Score: 68.1662 bits (165), Expect = 2.535e-11
Identity = 69/291 (23.71%), Postives = 122/291 (41.92%), Query Frame = 2
Query: 1424 QSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSK----TNPNAK---TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQC-SKYSNVGN---EMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQP-LEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNL----------------------------------------------ENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            QS+ D   T++      + E  +   LN +     +     V C+ C++    ++P AK   T+ TK   +   P +L +++ RF Q+  +    K T+  SYP LL+++  C SK  N+ N   +   ++Y L+G++EH G  +  GHY +Y+  +P + P   +   LP    + +  D  ++  L+     +   E  HL  L                                               N++     W+ +SD+ V+ VS++T +K QA +LFY RI
Sbjct:  838 QSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRF-QLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGG-MYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKARE-QHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERI 1125          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp16-45 (gene:FBgn0029763 transcript:FBtr0070775)

HSP 1 Score: 68.1662 bits (165), Expect = 2.535e-11
Identity = 69/291 (23.71%), Postives = 122/291 (41.92%), Query Frame = 2
Query: 1424 QSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSK----TNPNAK---TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQC-SKYSNVGN---EMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQP-LEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNL----------------------------------------------ENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            QS+ D   T++      + E  +   LN +     +     V C+ C++    ++P AK   T+ TK   +   P +L +++ RF Q+  +    K T+  SYP LL+++  C SK  N+ N   +   ++Y L+G++EH G  +  GHY +Y+  +P + P   +   LP    + +  D  ++  L+     +   E  HL  L                                               N++     W+ +SD+ V+ VS++T +K QA +LFY RI
Sbjct:  838 QSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRF-QLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGG-MYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKARE-QHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERI 1125          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp16-45 (gene:FBgn0029763 transcript:FBtr0070772)

HSP 1 Score: 68.1662 bits (165), Expect = 2.535e-11
Identity = 69/291 (23.71%), Postives = 122/291 (41.92%), Query Frame = 2
Query: 1424 QSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSK----TNPNAK---TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQC-SKYSNVGN---EMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQP-LEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNL----------------------------------------------ENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            QS+ D   T++      + E  +   LN +     +     V C+ C++    ++P AK   T+ TK   +   P +L +++ RF Q+  +    K T+  SYP LL+++  C SK  N+ N   +   ++Y L+G++EH G  +  GHY +Y+  +P + P   +   LP    + +  D  ++  L+     +   E  HL  L                                               N++     W+ +SD+ V+ VS++T +K QA +LFY RI
Sbjct:  838 QSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRF-QLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGG-MYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKARE-QHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERI 1125          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp16-45 (gene:FBgn0029763 transcript:FBtr0070773)

HSP 1 Score: 68.1662 bits (165), Expect = 2.535e-11
Identity = 69/291 (23.71%), Postives = 122/291 (41.92%), Query Frame = 2
Query: 1424 QSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLEN---VACEFCSK----TNPNAK---TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQC-SKYSNVGN---EMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQP-LEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNL----------------------------------------------ENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            QS+ D   T++      + E  +   LN +     +     V C+ C++    ++P AK   T+ TK   +   P +L +++ RF Q+  +    K T+  SYP LL+++  C SK  N+ N   +   ++Y L+G++EH G  +  GHY +Y+  +P + P   +   LP    + +  D  ++  L+     +   E  HL  L                                               N++     W+ +SD+ V+ VS++T +K QA +LFY RI
Sbjct:  838 QSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRF-QLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGG-MYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKARE-QHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERI 1125          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp16 (si:dkey-75b17.1 [Source:NCBI gene;Acc:100534986])

HSP 1 Score: 77.7962 bits (190), Expect = 2.764e-14
Identity = 58/203 (28.57%), Postives = 88/203 (43.35%), Query Frame = 2
Query: 1544 CEFCSKTNPNAK--------TDHTKMDFICHLPFILPIYISRFKQM----CAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            C  C+K  P  K         D  K   I   P +L +++ RF+Q+    C  NR V+      +P +L+L+P CS   + V    + V+Y L+G++EH G  + SGHY +Y+  +P                                S H+C  +        + + S  SWF ISD+SV PV +  V   QA +LFY +I
Sbjct:  652 CVTCTKQQPGYKDGCKKAVYRDALKQMLISDPPVVLTLHLKRFQQVAYSVCKVNRHVQ------FPQILDLAPFCSLNCTGVKEGETQVLYSLYGIVEHSG-TMRSGHYTAYVKSRP--------------------------------STHNC-VQNGTAAASGDAEASKGSWFHISDSSVHPVPEAKVQSSQAYLLFYEKI 814          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp16 (ubiquitin specific peptidase 16 [Source:NCBI gene;Acc:569700])

HSP 1 Score: 77.7962 bits (190), Expect = 2.764e-14
Identity = 58/203 (28.57%), Postives = 88/203 (43.35%), Query Frame = 2
Query: 1544 CEFCSKTNPNAK--------TDHTKMDFICHLPFILPIYISRFKQM----CAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            C  C+K  P  K         D  K   I   P +L +++ RF+Q+    C  NR V+      +P +L+L+P CS   + V    + V+Y L+G++EH G  + SGHY +Y+  +P                                S H+C  +        + + S  SWF ISD+SV PV +  V   QA +LFY +I
Sbjct:  652 CVTCTKQQPGYKDGCKKAVYRDALKQMLISDPPVVLTLHLKRFQQVAYSVCKVNRHVQ------FPQILDLAPFCSLNCTGVKEGETQVLYSLYGIVEHSG-TMRSGHYTAYVKSRP--------------------------------STHNC-VQNGTAAASGDAEASKGSWFHISDSSVHPVPEAKVQSSQAYLLFYEKI 814          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp45 (ubiquitin specific peptidase 45 [Source:ZFIN;Acc:ZDB-GENE-100211-2])

HSP 1 Score: 59.3066 bits (142), Expect = 1.383e-8
Identity = 46/174 (26.44%), Postives = 68/174 (39.08%), Query Frame = 2
Query: 1580 TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFY 2101
            T   K   I  LP ++ +++ RF Q     R V N  +  +P LL+L+P CS           V+Y L+G++EH G  +  GHY +Y+              PQ       N         S S   C                   W  +SD +V+ V +  V+  QA +LFY
Sbjct:  660 TSARKQMLISALPPVVTLHLKRFHQAGMNLRKV-NRHV-DFPLLLDLAPFCSATCKNLGSGERVLYSLYGIVEHSGS-MRGGHYAAYV----------KVRTPQRKPEQRRN--------QSGSREACSAPQGQ-------------WVYVSDTTVQTVPESRVLNSQAYLLFY 799          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp49 (ubiquitin specific peptidase 49 [Source:ZFIN;Acc:ZDB-GENE-050208-484])

HSP 1 Score: 50.447 bits (119), Expect = 7.329e-6
Identity = 34/126 (26.98%), Postives = 56/126 (44.44%), Query Frame = 2
Query: 1487 DLDRALNKYIDPIFLENV--ACEFCSKTN------PNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSY 1840
             L   L K+ +   LE    AC FC++        P + ++  K   IC LP +L +++ RF+     +R      + ++  +LN+ P CS       E     Y L  ++ H G+   SGHY +Y
Sbjct:  487 SLSEMLAKFTETEALEGCIYACNFCNRKRRKSSHKPLSLSEACKQLLICRLPQVLRLHLKRFRWSGRNHREKIGVHV-AFDQVLNIQPYCSCSDAAARE--AYTYDLSAVVMHHGKGFGSGHYTAY 609          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp49 (ubiquitin specific peptidase 49 [Source:ZFIN;Acc:ZDB-GENE-050208-484])

HSP 1 Score: 50.447 bits (119), Expect = 7.329e-6
Identity = 34/126 (26.98%), Postives = 56/126 (44.44%), Query Frame = 2
Query: 1487 DLDRALNKYIDPIFLENV--ACEFCSKTN------PNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSY 1840
             L   L K+ +   LE    AC FC++        P + ++  K   IC LP +L +++ RF+     +R      + ++  +LN+ P CS       E     Y L  ++ H G+   SGHY +Y
Sbjct:  487 SLSEMLAKFTETEALEGCIYACNFCNRKRRKSSHKPLSLSEACKQLLICRLPQVLRLHLKRFRWSGRNHREKIGVHV-AFDQVLNIQPYCSCSDAAARE--AYTYDLSAVVMHHGKGFGSGHYTAY 609          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000031190.1 (ubiquitin carboxyl-terminal hydrolase 42-like [Source:NCBI gene;Acc:101735032])

HSP 1 Score: 50.0618 bits (118), Expect = 9.082e-6
Identity = 51/205 (24.88%), Postives = 80/205 (39.02%), Query Frame = 2
Query: 1499 ALNKYIDPIFLENVA--CEFCSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTR 2107
            AL +Y+ P   EN+   C  CSK N       TK   I   P +L + ++RF    ++N+  K   + +YP  +++ P  S+ S        + YRL+ ++ H G   NSGHY  Y+  P                                                     N  W++++D+ V PV   TV+K +A +LFY R
Sbjct:  191 ALKEYVRP---ENLGESCYKCSKCNEMVTA--TKTFSIHQPPNVLTLCLNRFDVF-SENKISK---MVTYPEFIDIHPYTSEKSE-----GTINYRLYAVLVHAGNTCNSGHYYCYVQAP-----------------------------------------------------NSKWYKMNDDCVTPVDINTVLKLEAYLLFYIR 328          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp16 (ubiquitin specific peptidase 16 [Source:MGI Symbol;Acc:MGI:1921362])

HSP 1 Score: 77.0258 bits (188), Expect = 5.074e-14
Identity = 60/204 (29.41%), Postives = 89/204 (43.63%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAKTDHTKMD------------FICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE CS+   N    + K D             +   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y  +     H  + VL                        D P +    C +E+ K     WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  653 LLCEVCSRRQCNGPKANIKGDRRHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGT-MRSGHYTAYAKERTASCHLSNLVL----------------------HGDIPQD----CEMESTK---GQWFHISDTHVQAVPITKVLNSQAYLLFYERI 824          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|A8HAL1|UBP16_DANRE (Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio OX=7955 GN=usp16 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.086e-13
Identity = 58/203 (28.57%), Postives = 88/203 (43.35%), Query Frame = 2
Query: 1544 CEFCSKTNPNAK--------TDHTKMDFICHLPFILPIYISRFKQM----CAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYI-CQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            C  C+K  P  K         D  K   I   P +L +++ RF+Q+    C  NR V+      +P +L+L+P CS   + V    + V+Y L+G++EH G  + SGHY +Y+  +P                                S H+C  +        + + S  SWF ISD+SV PV +  V   QA +LFY +I
Sbjct:  652 CVTCTKQQPGYKDGCKKAVYRDALKQMLISDPPVVLTLHLKRFQQVAYSVCKVNRHVQ------FPQILDLAPFCSLNCTGVKEGETQVLYSLYGIVEHSG-TMRSGHYTAYVKSRP--------------------------------STHNC-VQNGTAAASGDAEASKGSWFHISDSSVHPVPEAKVQSSQAYLLFYEKI 814          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q99LG0|UBP16_MOUSE (Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus OX=10090 GN=Usp16 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.549e-13
Identity = 60/204 (29.41%), Postives = 89/204 (43.63%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAKTDHTKMD------------FICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE CS+   N    + K D             +   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y  +     H  + VL                        D P +    C +E+ K     WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  653 LLCEVCSRRQCNGPKANIKGDRRHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGT-MRSGHYTAYAKERTASCHLSNLVL----------------------HGDIPQD----CEMESTK---GQWFHISDTHVQAVPITKVLNSQAYLLFYERI 824          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q2KJ09|UBP16_RAT (Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus OX=10116 GN=Usp16 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.555e-12
Identity = 59/204 (28.92%), Postives = 89/204 (43.63%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAK------------TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE C++   N              T+  K   +   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y  +     H  + VL                        D P +    C +E+ K     WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  654 LLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGT-MRSGHYTAYAKERTASCHLSNLVL----------------------HGDIPQD----CEMESTK---GQWFHISDTHVQAVPITKVLNSQAYLLFYERI 825          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q08DA3|UBP16_BOVIN (Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus OX=9913 GN=USP16 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.783e-12
Identity = 59/202 (29.21%), Postives = 88/202 (43.56%), Query Frame = 2
Query: 1544 CEFCSK---TNPNAK---------TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            CE C++   + P A          T+  K   I   P +L ++  RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y       +H  + VL      +I  DF                          ++ +   WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  656 CEVCTRRQYSGPKANMKGERKHIYTNAKKQMLISLAPPVLTLHFKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEEHTRVLYSLYGVVEHSGT-MRSGHYTAYAKTRTASTHLSNLVL----HGDIPQDF-------------------------EMESTKGQWFHISDTHVQAVPTTKVLSSQAYLLFYERI 825          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q4R6X7|UBP16_MACFA (Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis OX=9541 GN=USP16 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.307e-12
Identity = 60/204 (29.41%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 1538 VACEFCSKTNPNAK------------TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            + CE C++   N              T+  K   I   P +L +++ RF+Q     R V N  I  +P +L+L+P C+ K  NV  E + V+Y L+G++EH G  + SGHY +Y       SH  + VL      +I  DF    +++S  +                      WF ISD  V+ V    V+  QA +LFY RI
Sbjct:  655 LLCEVCTRRQCNGPKANMKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKV-NKHI-KFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGT-MRSGHYTAYAKARTANSHLSNLVL----HGDIPQDF----EMESKGQ----------------------WFHISDTHVQAVPTTKVLNSQAYLLFYERI 825          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3Q3GTU1 (Ubiquitin carboxyl-terminal hydrolase OS=Labrus bergylta OX=56723 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.719e-15
Identity = 63/202 (31.19%), Postives = 95/202 (47.03%), Query Frame = 2
Query: 1535 NVACEFCSKTNPNAK----TDHTKMDFICHLPFILPIYISRFKQ----MCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYE-TNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            ++ C  C+K +  +K    TD  K   I   P +L +++ RF+Q    +C  NR V+      +PF+L+L+P C  K  NV    + ++Y L+G++EH G  + SGHY +Y+            V P+                       CP   +N L    + +    SWF ISD SV+PVS+  V  CQA +LFY RI
Sbjct:  657 SLLCVTCTKRHVGSKKNIYTDALKQMLISSPPPVLTLHLKRFQQNGYSICKVNRHVE------FPFILDLAPFCGVKSKNVTEGDAQILYSLYGIVEHSGT-MRSGHYTAYV-----------KVRPE-----------------------CPKTPSNGLTAQGDAEPPRGSWFHISDTSVQPVSESKVQSCQAYLLFYERI 817          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A4U5UZI8 (Ubiquitin carboxyl-terminal hydrolase 16 OS=Collichthys lucidus OX=240159 GN=USP16 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.166e-15
Identity = 75/276 (27.17%), Postives = 118/276 (42.75%), Query Frame = 2
Query: 1340 FDLDINDSTEIPLGLESKKMQSVFNAAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLE---NVACEFCSKTNPN----------AKTDHTKMDFICHLPFILPIYISRFKQ----MCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLEN-LKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
             D D+   T+    LE+K+    +    Q  +   +TL+      + E  +   L ++ +   L    ++ C  C+K  PN            TD  K   I  LP +L +++ RF+Q    +C  NR V+      +P +L+L+P C  K  NV    + ++Y L+G++EH G  + SGHY +Y+            V P+                       CP  +++    E        SWF ISD SV+PVS+  V  CQA +LFY RI
Sbjct:  617 LDADVGQDTKSEDELEAKE----YTVVSQDPELAFHTLATRTAPEKQECSVQSCLFQFTEVETLTQNNSLLCVTCTKRQPNKDKAAGSKKNVYTDALKQMLISSLPPVLTLHLKRFQQNGYSICKVNRHVQ------FPLILDLAPFCGVKCKNVTEGETQILYSLYGIVEHSGT-MRSGHYTAYV-----------KVRPE-----------------------CPKPSSNGHAAEGDAGQPRGSWFHISDTSVQPVSESKVQSCQAYLLFYERI 847          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: I3JE08 (Ubiquitin carboxyl-terminal hydrolase 16 OS=Oreochromis niloticus OX=8128 GN=usp16 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.707e-15
Identity = 63/192 (32.81%), Postives = 92/192 (47.92%), Query Frame = 2
Query: 1550 FCSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQ----MCAKNRTVKNTQIYSYPFLLNLSPQCS-KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
             C  +  N  TD  K   I   P +L +++ RF+Q    +C  NR V      ++PF+L+L+P C+ K  N+    + ++Y L+G++EH G  + SGHY +Y+   + P        PQ  SSN L D     D +S                        SWF ISD SV+PVS+  V  CQA +LFY R+
Sbjct:  664 LCLGSKKNIYTDALKQILISSPPSVLTLHLKRFQQNGYSICKVNRHV------TFPFILDLAPFCAVKCKNIPEGHNQILYGLYGIVEHSGT-MRSGHYTAYV--KVRPE------CPQP-SSNGLTD----GDAES---------------------PRGSWFHISDTSVQPVSESKVQSCQAYLLFYERL 814          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A5E4R171 (Ubiquitin carboxyl-terminal hydrolase OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS13619 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.872e-15
Identity = 66/203 (32.51%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1538 VACEFCSK--TNPNAKTDHT---KMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-----KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYIC--QPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            V CE C+K     N KT +T   K   +   P IL +++ RF Q+  +    K T+   +P +L+L+P C+     K  NV    S ++Y L+G++EH G  ++ GHYV+Y+   QP++P   +   LP+S  +NI        D DS S+          C           W+ +SD+ V  V++E V+K QA +LFY RI
Sbjct:  787 VGCETCTKRINGKNGKTIYTNASKRFLVSSPPAILILHLKRF-QLGPRCMFRKMTKHVDFPTILDLAPFCAMDKLKKLPNVARGQSQLLYSLYGIVEHSGG-MHGGHYVAYVKVRQPVKPGDPRWWFLPKS--ANIPASGSGDADADSESDLSGYESGEGPCPAPEAPPGK--WYYVSDSMVSEVTEEKVLKAQAYLLFYERI 983          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A5E4R160 (Ubiquitin carboxyl-terminal hydrolase OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS13619 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.813e-15
Identity = 66/203 (32.51%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1538 VACEFCSK--TNPNAKTDHT---KMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCS-----KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYIC--QPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            V CE C+K     N KT +T   K   +   P IL +++ RF Q+  +    K T+   +P +L+L+P C+     K  NV    S ++Y L+G++EH G  ++ GHYV+Y+   QP++P   +   LP+S  +NI        D DS S+          C           W+ +SD+ V  V++E V+K QA +LFY RI
Sbjct:  755 VGCETCTKRINGKNGKTIYTNASKRFLVSSPPAILILHLKRF-QLGPRCMFRKMTKHVDFPTILDLAPFCAMDKLKKLPNVARGQSQLLYSLYGIVEHSGG-MHGGHYVAYVKVRQPVKPGDPRWWFLPKS--ANIPASGSGDADADSESDLSGYESGEGPCPAPEAPPGK--WYYVSDSMVSEVTEEKVLKAQAYLLFYERI 951          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp16 (ubiquitin specific peptidase 16 [Source:NCBI gene;Acc:103045001])

HSP 1 Score: 73.1738 bits (178), Expect = 7.872e-13
Identity = 57/203 (28.08%), Postives = 89/203 (43.84%), Query Frame = 2
Query: 1544 CEFCSKTNPNAKT-------DHTKMDFICHLPFILPIYISRFKQM----CAKNRTVKNTQIYSYPFLLNLSPQCS---KYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            C  C+K    A         D  K   I   P +L +++ RF+Q+    C  NR V+      +P LL+L+P CS   K    G E   V+Y L+G++EH G  + SGHY +++              PQ++++++                      N       +     SWF ISD++V+PV++  V   QA +LFY RI
Sbjct:  686 CVTCTKKQSTAHGCKKNVYRDALKQMLISSPPPVLTLHLKRFQQVGYSVCKVNRHVQ------FPQLLDLAPFCSTSCKGVYEGEEQ--VLYSLYGIVEHSG-TMRSGHYTAFV-----------KTRPQNHTAHL----------------------NGAAEPGEVAPPKGSWFHISDSNVQPVTEAKVQNAQAYLLFYERI 846          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp45 (ubiquitin specific peptidase 45 [Source:NCBI gene;Acc:103036388])

HSP 1 Score: 61.6178 bits (148), Expect = 2.623e-9
Identity = 46/174 (26.44%), Postives = 69/174 (39.66%), Query Frame = 2
Query: 1580 TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFY 2101
            T   K   I  LP ++ +++ RF Q     R V N  +  +P +L+L+P CS           V+Y L+G++EH G  +  GHY +Y+              PQ  S                         N   + E +      W  +SD SV+ V +  VM  QA +LFY
Sbjct:  661 TSARKQMLISVLPPVVTLHLKRFHQAGMNLRKV-NRHV-DFPLILDLAPFCSASCKSLGSGEKVLYSLYGIVEHSGS-MRGGHYTAYV----------KVRTPQRKSEQ---------------------RRNQSGSREAVSAPPGQWVYVSDTSVQTVPESRVMNSQAYLLFY 800          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp45 (ubiquitin specific peptidase 45 [Source:NCBI gene;Acc:103036388])

HSP 1 Score: 52.7582 bits (125), Expect = 1.394e-6
Identity = 28/88 (31.82%), Postives = 45/88 (51.14%), Query Frame = 2
Query: 1580 TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYI 1843
            T   K   I  LP ++ +++ RF Q     R V N  +  +P +L+L+P CS           V+Y L+G++EH G  +  GHY +Y+
Sbjct:  661 TSARKQMLISVLPPVVTLHLKRFHQAGMNLRKV-NRHV-DFPLILDLAPFCSASCKSLGSGEKVLYSLYGIVEHSGS-MRGGHYTAYV 745          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp45 (ubiquitin specific peptidase 45 [Source:NCBI gene;Acc:103036388])

HSP 1 Score: 52.7582 bits (125), Expect = 1.441e-6
Identity = 28/88 (31.82%), Postives = 45/88 (51.14%), Query Frame = 2
Query: 1580 TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYI 1843
            T   K   I  LP ++ +++ RF Q     R V N  +  +P +L+L+P CS           V+Y L+G++EH G  +  GHY +Y+
Sbjct:  642 TSARKQMLISVLPPVVTLHLKRFHQAGMNLRKV-NRHV-DFPLILDLAPFCSASCKSLGSGEKVLYSLYGIVEHSGS-MRGGHYTAYV 726          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:ZFIN;Acc:ZDB-GENE-041008-187])

HSP 1 Score: 54.299 bits (129), Expect = 1.141e-7
Identity = 46/183 (25.14%), Postives = 83/183 (45.36%), Query Frame = 2
Query:   47 VATVIIMTMLLKLNNKEVKLILKSADVSCVEKELIK-LWEADCSSISPASLRSTLLKNEQFKLHFSGNSEQDSHDAFLAVLNIIKEAQIKRIR-KAILDYYDCKTSTDKLTDDQKLEIKTLGNIAEKFTLLHSHYGIVFGSALKCANCGDIRLRFDESLNIVLIFPHNTESFDEASSMQQNNK 589
            + T  +    LK  N++  L ++  +++C   +LIK +W    SS  P S ++ +    +F   FSG  +QDS +    +L+ + E  + RIR K  ++  D +   DK+   +  +     N +    + H     +F S L C +C  + + FD    + L  P  TE   E + + Q+ K
Sbjct:  297 LTTYFLEDAYLKELNRDNPLGMR-GEIACAYADLIKQMWSGSYSSTVPRSFKTQV---GRFAPQFSGYQQQDSQELLAFLLDGLHE-DLNRIRKKPYVELKDAEGRDDKVVAQEAWDNHRKRNDSIIVDIFHG----LFKSTLICPDCAKVSVTFDPFCYLTLPLPIKTERAVEVTLVWQDPK 470          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP10 (Ubiquitin-specific protease, deubiquitinates Ub-protein moieties; interacts with proteins that function in rRNA production and ribosome biogenesis via its intrinsically disordered regions; stabilizes Rpa190p by deubiquitination; controls PCNA deubiquitylation; may regulate silencing by acting on Sir4p; involved in posttranscriptionally regulating Gap1p, possibly other transporters; localized to the nucleolus; null mutant phenotypes are functionally complemented by human USP36 [Source:SGD;Acc:S000005130])

HSP 1 Score: 53.5286 bits (127), Expect = 1.057e-7
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 2
Query: 1532 ENVACEFCSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQP 1852
            +   CE C KT     T+  K   I   P  L +++ +F+     +  +K  Q  SYP  L+L+  C       ++  PV Y+L  ++ H G+ ++SGHY+++  QP
Sbjct:  606 KGYVCEKCHKT-----TNAVKHSSILRAPETLLVHLKKFRFNGTSSSKMK--QAVSYPMFLDLTEYCE------SKELPVKYQLLSVVVHEGRSLSSGHYIAHCKQP 699          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP11 (Ubiquitin-specific protease; cleaves ubiquitin from ubiquitinated proteins; UBP11 has a paralog, UBP7, that arose from the whole genome duplication [Source:SGD;Acc:S000001806])

HSP 1 Score: 48.521 bits (114), Expect = 3.398e-6
Identity = 36/105 (34.29%), Postives = 52/105 (49.52%), Query Frame = 2
Query: 1553 CSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSH 1867
              K N    T    +DFI  LP IL I++SRF      + T KN+ + +YP +LN+  +  K          + Y+L+G + H G  IN GHY S + +  E SH
Sbjct:  573 AKKRNSKKLTTIKSLDFIV-LPPILVIHLSRFYY----DLTKKNSTVITYPLILNIILKNGKV---------IRYKLYGTVNHSGNLIN-GHYTSVVNK--EKSH 660          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO33879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR10])

HSP 1 Score: 70.4774 bits (171), Expect = 1.244e-13
Identity = 51/203 (25.12%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 1541 ACEFCSKTN------------PNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSN-VGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRI 2110
            ACE C+K              P   T+ TK   + H P +L +++ RF+Q+    R V   +   +P +L+++P CS     + +    ++Y L G ++H G  +NSGHY +YI    +P            + ++  D     +L++Y      +   H     +  +    W+ +SD+    V +  V++ QA MLFY R+
Sbjct:   35 ACEECTKARNGCGTPVCEDQAPTVYTEATKQLLLSHPPLVLTLHLKRFQQVLFGLRKV--AKHVDFPLVLDMAPFCSSQGKALPDANGQILYSLIGAVDHSGG-LNSGHYTAYIKLKSKP------------TLDLNRDIRNSRELEAYIRET--WNEAHAQKCTSQGVPQGQWYYVSDSHSVLVPESRVLRSQAYMLFYERL 220          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp45 (ubiquitin specific peptidase 45 [Source:NCBI gene;Acc:101160438])

HSP 1 Score: 60.4622 bits (145), Expect = 6.579e-9
Identity = 45/174 (25.86%), Postives = 73/174 (41.95%), Query Frame = 2
Query: 1580 TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFY 2101
            T   K   I  LP ++ +++ RF Q     R V N  +  +P +L+L+P CS           V+Y L+G++EH G  +  GHY +Y+            V P    + +L+      +L    +  C               S   W  +SD +V+ V +  V+  QA +LFY
Sbjct:  647 TSARKQMLISLLPPVIMLHLKRFHQAGMNLRKV-NRHV-DFPLILDLAPFCSASCKNLAAGERVLYSLYGIVEHSGS-MRGGHYAAYV-----------KVRPPQRRTELLHK-----NLSGARDASCS--------------SQGQWVYVSDTTVQTVPESRVLNSQAYLLFY 787          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp16 (ubiquitin specific peptidase 16 [Source:NCBI gene;Acc:101173161])

HSP 1 Score: 58.151 bits (139), Expect = 3.429e-8
Identity = 48/176 (27.27%), Postives = 76/176 (43.18%), Query Frame = 2
Query: 1571 NAKTDHTKMDFICHLPFILPIYISRFKQ----MCAKNRTVKNTQIYSYPFLLNLSPQCSKYS----NVGN--EMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKET 2068
            N  TD  K   +   P +L +++ RF+Q    +C  NR V       +P  L+L+P C+       NV +  E + V+Y L+G++EH G  + SGHY +Y+   + P+H ++        SN                            L   + S  SWF ISD +V+P  + T
Sbjct:  690 NVYTDALKQMLVSSPPAVLTLHLKRFQQNGYTICKVNRYVH------FPLTLDLAPYCAAKCKTNINVSSYKEDTGVLYSLYGVVEHSGT-MRSGHYTAYV--KVRPNHHKTL-------SN---------------------------GLSTEEPSIGSWFHISDTNVQPEKQST 822          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp45 (ubiquitin specific peptidase 45 [Source:NCBI gene;Acc:101160438])

HSP 1 Score: 50.447 bits (119), Expect = 6.395e-6
Identity = 31/108 (28.70%), Postives = 54/108 (50.00%), Query Frame = 2
Query: 1580 TDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSS 1903
            T   K   I  LP ++ +++ RF Q     R V N  +  +P +L+L+P CS           V+Y L+G++EH G  +  GHY +Y+   + P   ++ +L ++ S 
Sbjct:  647 TSARKQMLISLLPPVIMLHLKRFHQAGMNLRKV-NRHV-DFPLILDLAPFCSASCKNLAAGERVLYSLYGIVEHSGS-MRGGHYAAYV--KVRPPQRRTELLHKNLSG 749          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036348.1 (SMESG000036348.1)

HSP 1 Score: 1320.84 bits (3417), Expect = 0.000e+0
Identity = 678/681 (99.56%), Postives = 681/681 (100.00%), Query Frame = 2
Query:   71 MLLKLNNKEVKLILKSADVSCVEKELIKLWEADCSSISPASLRSTLLKNEQFKLHFSGNSEQDSHDAFLAVLNIIKEAQIKRIRKAILDYYDCKTSTDKLTDDQKLEIKTLGNIAEKFTLLHSHYGIVFGSALKCANCGDIRLRFDESLNIVLIFPHNTESFDEASSMQQNNKIDKKSTFTPENINDNAQNXXXXXXXXXXXXRIERKANRNKKSIQKNDDFSADDELMEANNENKNDVTDRELIENQSFSIEDNKQENINANHLLARFLGSSNENEIFQESVPNEISCSVVVDRHLSSPSNCXXXXXXXXXXXXXXXXXXXXQMDLEMIIDQEIVQKFTISVSIDNEIMENNEEYPFANDEMSKELDQENDFDEESPFAKDEMSKELDQENCIGKESPFAKDEMSKELDQENNIDVNDSSQKFDLDINDSTEIPLGLESKKMQSVFNAAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLENVACEFCSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRIQ 2113
            +++KLNNKEVKLILKSADVSCVEKELIKLWEADCSSISPASLRSTLLKNEQFKLHFSGNSEQDSHDAFLAVLNIIKEAQIKRIRKAILDYYDCKTSTDKLTDDQKLEIKTLGNIAEKFTLLHSHYGIVFGSALKCANCGDIRLRFDESLNIVLIFPHNTESFDEASSMQQNNKIDKKSTFTPENINDNAQNKKLSKHQLKKQKRIERKANRNKKSIQKNDDFSADDELMEANNENKNDVTDRELIENQSFSIEDNKQENINANHLLARFLGSSNENEIFQESVPNEISCSVVVDRHLSSPSNCSRAAIGSNSSRSSLSDESISQMDLEMIIDQEIVQKFTISVSIDNEIMENNEEYPFANDEMSKELDQENDFDEESPFAKDEMSKELDQENCIGKESPFAKDEMSKELDQENNIDVNDSSQKFDLDINDSTEIPLGLESKKMQSVFNAAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLENVACEFCSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRIQ
Sbjct:   80 LVVKLNNKEVKLILKSADVSCVEKELIKLWEADCSSISPASLRSTLLKNEQFKLHFSGNSEQDSHDAFLAVLNIIKEAQIKRIRKAILDYYDCKTSTDKLTDDQKLEIKTLGNIAEKFTLLHSHYGIVFGSALKCANCGDIRLRFDESLNIVLIFPHNTESFDEASSMQQNNKIDKKSTFTPENINDNAQNKKLSKHQLKKQKRIERKANRNKKSIQKNDDFSADDELMEANNENKNDVTDRELIENQSFSIEDNKQENINANHLLARFLGSSNENEIFQESVPNEISCSVVVDRHLSSPSNCSRAAIGSNSSRSSLSDESISQMDLEMIIDQEIVQKFTISVSIDNEIMENNEEYPFANDEMSKELDQENDFDEESPFAKDEMSKELDQENCIGKESPFAKDEMSKELDQENNIDVNDSSQKFDLDINDSTEIPLGLESKKMQSVFNAAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLENVACEFCSKTNPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLLNLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPSHSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISNFSWFRISDNSVEPVSKETVMKCQASMLFYTRIQ 760          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP164.668e-1329.41ubiquitin specific peptidase 16 [Source:HGNC Symbo... [more]
USP164.835e-1329.41ubiquitin specific peptidase 16 [Source:HGNC Symbo... [more]
USP164.835e-1329.41ubiquitin specific peptidase 16 [Source:HGNC Symbo... [more]
USP452.004e-925.09ubiquitin specific peptidase 45 [Source:HGNC Symbo... [more]
USP452.207e-925.09ubiquitin specific peptidase 45 [Source:HGNC Symbo... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp16-452.535e-1123.71gene:FBgn0029763 transcript:FBtr0340462[more]
Usp16-452.535e-1123.71gene:FBgn0029763 transcript:FBtr0340461[more]
Usp16-452.535e-1123.71gene:FBgn0029763 transcript:FBtr0070775[more]
Usp16-452.535e-1123.71gene:FBgn0029763 transcript:FBtr0070772[more]
Usp16-452.535e-1123.71gene:FBgn0029763 transcript:FBtr0070773[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp162.764e-1428.57si:dkey-75b17.1 [Source:NCBI gene;Acc:100534986][more]
usp162.764e-1428.57ubiquitin specific peptidase 16 [Source:NCBI gene;... [more]
usp451.383e-826.44ubiquitin specific peptidase 45 [Source:ZFIN;Acc:Z... [more]
usp497.329e-626.98ubiquitin specific peptidase 49 [Source:ZFIN;Acc:Z... [more]
usp497.329e-626.98ubiquitin specific peptidase 49 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000031190.19.082e-624.88ubiquitin carboxyl-terminal hydrolase 42-like [Sou... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Usp165.074e-1429.41ubiquitin specific peptidase 16 [Source:MGI Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8HAL1|UBP16_DANRE2.086e-1328.57Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio ... [more]
sp|Q99LG0|UBP16_MOUSE3.549e-1329.41Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus mu... [more]
sp|Q2KJ09|UBP16_RAT1.555e-1228.92Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus... [more]
sp|Q08DA3|UBP16_BOVIN1.783e-1229.21Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos ta... [more]
sp|Q4R6X7|UBP16_MACFA2.307e-1229.41Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3GTU12.719e-1531.19Ubiquitin carboxyl-terminal hydrolase OS=Labrus be... [more]
A0A4U5UZI84.166e-1527.17Ubiquitin carboxyl-terminal hydrolase 16 OS=Collic... [more]
I3JE084.707e-1532.81Ubiquitin carboxyl-terminal hydrolase 16 OS=Oreoch... [more]
A0A5E4R1714.872e-1532.51Ubiquitin carboxyl-terminal hydrolase OS=Leptidea ... [more]
A0A5E4R1605.813e-1532.51Ubiquitin carboxyl-terminal hydrolase OS=Leptidea ... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
usp167.872e-1328.08ubiquitin specific peptidase 16 [Source:NCBI gene;... [more]
usp452.623e-926.44ubiquitin specific peptidase 45 [Source:NCBI gene;... [more]
usp451.394e-631.82ubiquitin specific peptidase 45 [Source:NCBI gene;... [more]
usp451.441e-631.82ubiquitin specific peptidase 45 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp41.141e-725.14ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
UBP101.057e-728.97Ubiquitin-specific protease, deubiquitinates Ub-pr... [more]
UBP113.398e-634.29Ubiquitin-specific protease; cleaves ubiquitin fro... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO338791.244e-1325.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
usp456.579e-925.86ubiquitin specific peptidase 45 [Source:NCBI gene;... [more]
usp163.429e-827.27ubiquitin specific peptidase 16 [Source:NCBI gene;... [more]
usp456.395e-628.70ubiquitin specific peptidase 45 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000036348.10.000e+099.56SMESG000036348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027581 ID=SMED30027581|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=2310bp
TTTATGACCAGAAAAAAGTCAACTAGAAAACGAAACAGGGTTAATAGTGG
CAACAGTAATAATTATGACAATGTTACTAAAACTGAATAACAAAGAAGTG
AAATTGATATTGAAATCTGCCGATGTAAGCTGTGTTGAAAAAGAATTGAT
AAAATTATGGGAAGCGGACTGTTCCAGCATTTCACCGGCGTCACTAAGAT
CCACTTTGTTGAAAAATGAGCAATTCAAACTGCATTTCAGTGGAAACAGT
GAACAGGACAGCCATGACGCCTTTCTAGCAGTATTAAACATAATCAAGGA
AGCTCAAATAAAGCGGATTAGGAAAGCAATTCTCGATTATTATGATTGCA
AAACATCTACAGATAAACTAACCGATGACCAAAAACTGGAAATAAAGACA
CTGGGAAATATCGCTGAAAAATTCACATTGTTACATTCTCATTATGGAAT
CGTCTTCGGGTCGGCTTTAAAATGTGCTAATTGTGGCGATATTCGATTGA
GATTCGATGAGAGTTTGAATATCGTGTTAATATTTCCACACAACACTGAG
TCATTTGATGAAGCGAGTTCCATGCAACAGAATAATAAAATTGATAAAAA
ATCGACTTTTACACCTGAAAATATAAACGATAATGCCCAAAACAAGAAGC
TTAGCAAACATCAATTAAAGAAACAAAAACGGATTGAAAGAAAAGCGAAT
CGTAACAAAAAATCAATACAGAAAAACGACGATTTCTCGGCAGATGACGA
ATTAATGGAGGCGAATAATGAAAATAAAAATGATGTAACAGACAGAGAGC
TAATAGAAAATCAATCTTTTTCGATTGAAGATAATAAACAAGAAAATATC
AATGCAAATCATCTTCTGGCTCGATTTTTGGGATCCTCGAATGAAAACGA
GATTTTTCAAGAGTCAGTACCAAATGAAATCTCATGTTCAGTTGTTGTCG
ACAGACATTTGTCATCTCCTTCTAACTGTAGCAGAGCGGCCATTGGAAGC
AATTCTAGTAGATCATCTTTGAGTGATGAATCGATATCTCAGATGGATTT
GGAGATGATAATAGATCAGGAAATCGTTCAGAAATTTACAATAAGCGTTT
CTATTGACAATGAAATCATGGAAAACAATGAAGAATATCCATTTGCCAAC
GATGAGATGTCGAAGGAGCTTGATCAAGAGAATGACTTTGATGAGGAATC
TCCATTTGCCAAAGATGAGATGTCAAAAGAGCTCGATCAGGAGAATTGCA
TTGGTAAGGAATCTCCATTTGCCAAAGATGAGATGTCAAAGGAGCTCGAT
CAGGAGAATAACATTGATGTGAATGATAGTTCACAGAAATTCGACCTGGA
TATTAATGATTCAACTGAAATTCCGTTGGGCTTAGAAAGTAAAAAGATGC
AATCTGTTTTCAATGCTGCAATGCAATCACACCAAGATCACATGTACACA
TTGAGTATTGATCGCATGACATTCGAATCTGAAACCGATCTCGATCGAGC
TTTAAACAAATATATCGATCCAATATTTCTTGAAAACGTTGCTTGTGAAT
TCTGTTCCAAAACTAATCCAAATGCCAAAACTGATCACACAAAAATGGAT
TTCATTTGCCATTTGCCATTCATTCTGCCTATCTATATTTCCAGATTCAA
GCAGATGTGCGCTAAAAACAGGACTGTAAAGAATACCCAAATATATAGCT
ATCCATTTCTACTGAATTTATCGCCTCAGTGCTCAAAGTATTCCAATGTC
GGCAATGAAATGTCTCCAGTCGTATATCGATTGTTTGGAATGATTGAGCA
CATTGGGCAAAGAATAAATTCCGGTCACTATGTCAGCTACATTTGCCAGC
CTCTTGAGCCATCTCATTCTCAATCGACTGTATTACCGCAATCATATTCC
TCTAATATTCTCAATGATTTCTGTAAAATGCACGATTTAGATTCCTATTC
AGAACATGATTGTCCATATGAAACCAACCATTTGTGTAACTTAGAAAACC
TCAAAATATCAAATTTCAGCTGGTTTCGGATCAGTGACAATAGCGTTGAG
CCAGTCTCCAAGGAGACTGTGATGAAATGTCAAGCTTCCATGTTATTTTA
TACACGAATTCAATAATGTCTTTCTAAGCTTCGGTTTTAGATTTTATTAT
CAAATGAAAAGTTATATTGAAATAAATAACGATTGCAACGATATCTGTGA
TGTGTTGTGAGGCCGAGTTCTTGTAGTGTTTGGCAGCTTTAATATCGTTC
ATTAAGGTATTAGATAAAAAAAGTTAATTTAACATAAAAGAGTGTGTATG
TATTATTAGC
back to top

protein sequence of SMED30027581-orf-1

>SMED30027581-orf-1 ID=SMED30027581-orf-1|Name=SMED30027581-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=684bp
MTMLLKLNNKEVKLILKSADVSCVEKELIKLWEADCSSISPASLRSTLLK
NEQFKLHFSGNSEQDSHDAFLAVLNIIKEAQIKRIRKAILDYYDCKTSTD
KLTDDQKLEIKTLGNIAEKFTLLHSHYGIVFGSALKCANCGDIRLRFDES
LNIVLIFPHNTESFDEASSMQQNNKIDKKSTFTPENINDNAQNKKLSKHQ
LKKQKRIERKANRNKKSIQKNDDFSADDELMEANNENKNDVTDRELIENQ
SFSIEDNKQENINANHLLARFLGSSNENEIFQESVPNEISCSVVVDRHLS
SPSNCSRAAIGSNSSRSSLSDESISQMDLEMIIDQEIVQKFTISVSIDNE
IMENNEEYPFANDEMSKELDQENDFDEESPFAKDEMSKELDQENCIGKES
PFAKDEMSKELDQENNIDVNDSSQKFDLDINDSTEIPLGLESKKMQSVFN
AAMQSHQDHMYTLSIDRMTFESETDLDRALNKYIDPIFLENVACEFCSKT
NPNAKTDHTKMDFICHLPFILPIYISRFKQMCAKNRTVKNTQIYSYPFLL
NLSPQCSKYSNVGNEMSPVVYRLFGMIEHIGQRINSGHYVSYICQPLEPS
HSQSTVLPQSYSSNILNDFCKMHDLDSYSEHDCPYETNHLCNLENLKISN
FSWFRISDNSVEPVSKETVMKCQASMLFYTRIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0008270zinc ion binding
GO:0016787hydrolase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 201..221
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 4..221
e-value: 6.3E-11
score: 43.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 166..227
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 166..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 197..213
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 38..682
NoneNo IPR availablePANTHERPTHR21646:SF39coord: 38..682
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 458..679
e-value: 1.95263E-22
score: 95.2426
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 21..679
e-value: 3.0E-16
score: 59.7
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 571..589
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 1..682
score: 18.402
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 26..681