Protein kinase, putative

Overview
NameProtein kinase, putative
Smed IDSMED30027580
Length (bp)1096
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027580SMESG000015124.1 dd_Smed_v4_404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027580SMESG000015124.1 dd_Smed_v4_404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027580SMESG000015124.1 dd_Smed_v4_404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027580SMESG000015124.1 dd_Smed_v4_404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027580SMESG000015124.1 SMESG000015116.1 Contig41082newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027580SMESG000015124.1 SMESG000015116.1 Contig41082uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PIM2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8987])

HSP 1 Score: 65.0846 bits (157), Expect = 3.982e-11
Identity = 53/210 (25.24%), Postives = 93/210 (44.29%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFP---KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS---FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E+ +L  V    G P   +L++ FET     +V+E   +   DLFDY+ ++K  +    +     Q++  I       + + DIK +N+++       KLIDF         P+T +  + + Y  PE +    +    + V+S+G   Y ++ GD  F+  +E+L      P  V  D      I+  L      RP LE++L  P++ 
Sbjct:   83 EVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLER-PLPAQDLFDYI-TEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRV-YSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCA--LIRRCLAPKPSSRPSLEEILLDPWMQ 287          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PIM1 (Pim-1 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8986])

HSP 1 Score: 63.5438 bits (153), Expect = 1.052e-10
Identity = 47/202 (23.27%), Postives = 95/202 (47.03%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS---FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            K+  G  G  +L++ FE  + S++++        DLFD++ +++  +  + A     Q++  +       + + DIK +N+++  +   +KLIDF        + +T +  + + Y  PE +R   +    +AV+S+G   Y ++ GD  F+  EE++    F     R  +     I+  L     DRP  E++  HP++ 
Sbjct:   95 KVSSGFSGVIRLLDWFERPD-SFVLILERPEPVQDLFDFI-TERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRV-YSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFF--RQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQ 291          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: MARK4 (microtubule affinity regulating kinase 4 [Source:HGNC Symbol;Acc:HGNC:13538])

HSP 1 Score: 64.3142 bits (155), Expect = 1.377e-10
Identity = 55/181 (30.39%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFPKLINSFE---TSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            I  IDK     + +  +F E++++K   GL   P ++  FE   T    Y+VME  S   V  FDY+ S   R+  K A    +Q++  +    + NI + D+K +N++L  +  +IK+ DF    +   GS   T+  S   Y +PE  +GK +D     ++S+G   YTL+ G   FD 
Sbjct:   87 IKIIDKTQLNPSSLQKLFREVRIMK---GLN-HPNIVKLFEVIETEKTLYLVMEYASAGEV--FDYLVSH-GRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEA-NIKIADFGFSNEFTLGSKLDTFCGSPP-YAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDG 258          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: MARK2 (microtubule affinity regulating kinase 2 [Source:HGNC Symbol;Acc:HGNC:3332])

HSP 1 Score: 63.929 bits (154), Expect = 1.798e-10
Identity = 51/181 (28.18%), Postives = 92/181 (50.83%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFPKLINSFE---TSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            +  IDK    ++ +  +F E++++K++      P ++  FE   T    Y+VME  S    ++FDY+ +   R+  K A    +Q++  +    +  I + D+K +N++L  D+ +IK+ DF    +  FG+   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD 
Sbjct:   48 VKIIDKTQLNSSSLQKLFREVRIMKVLN----HPNIVKLFEVIETEKTLYLVMEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADM-NIKIADFGFSNEFTFGNKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG 219          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: MARK2 (microtubule affinity regulating kinase 2 [Source:HGNC Symbol;Acc:HGNC:3332])

HSP 1 Score: 63.929 bits (154), Expect = 1.924e-10
Identity = 51/181 (28.18%), Postives = 92/181 (50.83%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFPKLINSFE---TSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            +  IDK    ++ +  +F E++++K++      P ++  FE   T    Y+VME  S    ++FDY+ +   R+  K A    +Q++  +    +  I + D+K +N++L  D+ +IK+ DF    +  FG+   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD 
Sbjct:   48 VKIIDKTQLNSSSLQKLFREVRIMKVLN----HPNIVKLFEVIETEKTLYLVMEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADM-NIKIADFGFSNEFTFGNKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG 219          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 75.8702 bits (185), Expect = 1.132e-14
Identity = 65/215 (30.23%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKS-IKLIDFSDVHFGSPWTTYA--VSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAF--DSIEELLSFIPPV---------VRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            E++VL+ ++G     +L   +ET++   IV+E +S    +LFD+VC+ K  +D   A+  IKQ+++ +  L  L+I + DIK +NVML++   S IK+IDF       P       V T  + +PE V  +      + ++++G  TY L+ G   F  D+ +E  S I  V           T     DFI    ++ +  R  +E+ LQHP++
Sbjct:   79 EVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGG--ELFDHVCA-KECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQRGDSQIKIIDFGLSREIEPGAVVKDMVGTPEFVAPEVVNYEALS-PATDMWAVGVVTYILLSGGSPFLGDNRDETFSNITRVRYHFSDRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWI 289          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 65.855 bits (159), Expect = 1.976e-11
Identity = 54/177 (30.51%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  115 INFIDKILTTKIIL--MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            I  IDK       L  +F E+K++K +       KL    ET    Y+V+E  S    ++FDY+ +   R+  K A    +Q++  +  L   NI + D+K +N++L +D+ +IK+ DF   +    G+   T+  S   Y +PE   GK +D     V+S+G   YTL+ G   FD
Sbjct:  150 IKIIDKTALNPSSLQKLFREVKIMKQLDH-PNIVKLYQVMETEQTLYLVLEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDM-NIKIADFGFSNTFSLGNKLDTFCGSP-PYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFD 320          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 65.855 bits (159), Expect = 1.979e-11
Identity = 54/177 (30.51%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  115 INFIDKILTTKIIL--MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            I  IDK       L  +F E+K++K +       KL    ET    Y+V+E  S    ++FDY+ +   R+  K A    +Q++  +  L   NI + D+K +N++L +D+ +IK+ DF   +    G+   T+  S   Y +PE   GK +D     V+S+G   YTL+ G   FD
Sbjct:  109 IKIIDKTALNPSSLQKLFREVKIMKQLDH-PNIVKLYQVMETEQTLYLVLEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDM-NIKIADFGFSNTFSLGNKLDTFCGSP-PYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFD 279          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 65.855 bits (159), Expect = 1.979e-11
Identity = 54/177 (30.51%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  115 INFIDKILTTKIIL--MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            I  IDK       L  +F E+K++K +       KL    ET    Y+V+E  S    ++FDY+ +   R+  K A    +Q++  +  L   NI + D+K +N++L +D+ +IK+ DF   +    G+   T+  S   Y +PE   GK +D     V+S+G   YTL+ G   FD
Sbjct:  109 IKIIDKTALNPSSLQKLFREVKIMKQLDH-PNIVKLYQVMETEQTLYLVLEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDM-NIKIADFGFSNTFSLGNKLDTFCGSP-PYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFD 279          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 65.855 bits (159), Expect = 1.980e-11
Identity = 54/177 (30.51%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  115 INFIDKILTTKIIL--MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            I  IDK       L  +F E+K++K +       KL    ET    Y+V+E  S    ++FDY+ +   R+  K A    +Q++  +  L   NI + D+K +N++L +D+ +IK+ DF   +    G+   T+  S   Y +PE   GK +D     V+S+G   YTL+ G   FD
Sbjct:  112 IKIIDKTALNPSSLQKLFREVKIMKQLDH-PNIVKLYQVMETEQTLYLVLEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDM-NIKIADFGFSNTFSLGNKLDTFCGSP-PYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFD 282          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0301503)

HSP 1 Score: 62.3882 bits (150), Expect = 3.162e-10
Identity = 47/161 (29.19%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  157 MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            +F E++++K++       KL    ET    Y++ME  S    ++FDY+     R+  K A +  +Q++  +    +  I + D+K +N++L  +L +IK+ DF   ++   GS   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD
Sbjct:  525 LFREVRIMKMLDH-PNIVKLFQVIETEKTLYLIMEYASGG--EVFDYLVLH-GRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSEL-NIKIADFGFSNEFTPGSKLDTFCGSP-PYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFD 679          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0330245)

HSP 1 Score: 62.3882 bits (150), Expect = 3.180e-10
Identity = 47/161 (29.19%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  157 MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            +F E++++K++       KL    ET    Y++ME  S    ++FDY+     R+  K A +  +Q++  +    +  I + D+K +N++L  +L +IK+ DF   ++   GS   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD
Sbjct:  297 LFREVRIMKMLDH-PNIVKLFQVIETEKTLYLIMEYASGG--EVFDYLVLH-GRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSEL-NIKIADFGFSNEFTPGSKLDTFCGSP-PYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFD 451          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 60.077 bits (144), Expect = 1.535e-9
Identity = 56/192 (29.17%), Postives = 94/192 (48.96%), Query Frame = 1
Query:  226 FETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS-DVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNII--------NDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            F+ +N+ Y+V+E L+ N  +L  Y+           A+ I+KQ++  +L L   NI + DI L N++L +++  +K+ DF        P   +     T  Y SPE V      +  + V+S+GC  YTL+ G   F++ + + S +  VV ++ I+         D I   L K   +R  LE +L HPF+
Sbjct:   81 FQDANYVYLVLE-LAHN-GELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMH-VKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLP-ADVWSVGCMLYTLLVGRPPFET-DAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFM 267          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0301506)

HSP 1 Score: 59.3066 bits (142), Expect = 3.422e-9
Identity = 53/180 (29.44%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  115 INFIDKILTTKIIL--MFPELKVLKLVQGLQGFPKLINSF---ETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            I  IDK       L  +F E++++K++      P ++  F   ET    Y++ME  S   V  FDY+     R+  K A +  +Q++  +    +  I + D+K +N++L  +L +IK+ DF   ++   GS   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD
Sbjct:  509 IKIIDKTQLNPGSLQKLFREVRIMKMLD----HPNIVKLFQVIETEKTLYLIMEYASGGEV--FDYLVLH-GRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSEL-NIKIADFGFSNEFTPGSKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFD 679          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0301504)

HSP 1 Score: 59.3066 bits (142), Expect = 3.599e-9
Identity = 53/180 (29.44%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  115 INFIDKILTTKIIL--MFPELKVLKLVQGLQGFPKLINSF---ETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFD 630
            I  IDK       L  +F E++++K++      P ++  F   ET    Y++ME  S   V  FDY+     R+  K A +  +Q++  +    +  I + D+K +N++L  +L +IK+ DF   ++   GS   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD
Sbjct:  509 IKIIDKTQLNPGSLQKLFREVRIMKMLD----HPNIVKLFQVIETEKTLYLIMEYASGGEV--FDYLVLH-GRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSEL-NIKIADFGFSNEFTPGSKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFD 679          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-050809-111])

HSP 1 Score: 70.0922 bits (170), Expect = 5.744e-13
Identity = 53/199 (26.63%), Postives = 94/199 (47.24%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEEL-LSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K+    QG  KLI+ +E  +   I+ME   +   DLFDY+ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF        + +T +  + + Y  PE +R   +    + V+S+G   Y ++ GD  F+  EE+    +    R   +    IK  L     DRP LE + +H ++
Sbjct:   97 KVGSTFQGVIKLIDWYERPDGWLIIMERPEM-VKDLFDYI-TEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAILKDTVYTDFDGTRV-YSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEHDEEILRGRLFFRRRVSPVCQQLIKWCLCLRPSDRPTLEQIFEHQWM 292          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pim2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:58054])

HSP 1 Score: 68.5514 bits (166), Expect = 1.636e-12
Identity = 52/196 (26.53%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  187 VQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF-SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPV-VRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            V G +G  ++++ FE     Y+++     +  DLFD++ +++  +D   A   +KQ+I  +       I + DIK +N+++      IK+IDF S         T    T  Y  PE +    +      V+S+G   Y ++ GD  F+   +++   P    R  N     I   L  +  DRP LE +LQHP++
Sbjct:   96 VPGHRGIIRMLDWFEIPGQEYLIVFEKPQHCQDLFDFI-TERGALDESLARRFLKQVIEAVQFCHSKGIVHRDIKDENILVDTRTGDIKVIDFGSGATLKDSMYTDFEGTRVYSPPEWILYHKYHALPLTVWSLGVLLYDMVCGDIPFEQDTDIVKAKPSFNKRISNDCRSLICSCLSFNPGDRPSLEQILQHPWM 290          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pimr182 (Pim proto-oncogene, serine/threonine kinase, related 182 [Source:ZFIN;Acc:ZDB-GENE-141222-19])

HSP 1 Score: 64.6994 bits (156), Expect = 1.453e-11
Identity = 48/187 (25.67%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAVSTIG----YFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQH 759
            +L++ +ET +   +V+E  + + +DL  +    + ++      L++ Q++   +   ++N+++SDIK  NV++      IKLIDF     G   T+   ST G    Y  PE    K F    + V+SIG   Y L+        + E+++      R      D I   L ++   R  LE++L H
Sbjct:   28 QLLDWYETPSQYTLVLERPN-SCMDLQKFAWKHRKKMTESVVRLVMHQVVTAAIACCEMNVYHSDIKPQNVLINPHTFQIKLIDFG---VGRIMTSEGYSTFGGTQAYAPPEFSDCKKFHAKPATVYSIGIMLYRLLHRKSPHRELIEIVARTWERDRLSKECIDMICSCLQRNPRQRIPLEEILHH 210          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pask (PAS domain containing serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-030131-1394])

HSP 1 Score: 67.0106 bits (162), Expect = 1.574e-11
Identity = 55/191 (28.80%), Postives = 93/191 (48.69%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS--FIPPV-VRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K++  FE      +VME      +DLF+++  Q  R+D   AS I +QL+  +  L    + + DIK +N+++  +   I+LIDF       P   +     T+ Y SPE + G  ++     ++S+G   YTL+  +  F S+EE L     PP  + TD  +   +   L  ++  R  LE+LLQ  ++
Sbjct:  965 KVLEVFENQGFFQLVMEKHGEG-LDLFEFIDMQP-RLDEPLASYIFRQLVAAVSYLRSKKVLHRDIKDENIIINSNFH-IRLIDFGSAALLQPGKLFYTFCGTLEYCSPEVLMGNPYEGPELEMWSLGVLLYTLLFSENPFCSVEETLQARLNPPCEISTD--LYALLAGLLHPAVDQRMTLEELLQSQWI 1150          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pimr182 (Pim proto-oncogene, serine/threonine kinase, related 182 [Source:ZFIN;Acc:ZDB-GENE-141222-19])

HSP 1 Score: 64.6994 bits (156), Expect = 3.021e-11
Identity = 48/187 (25.67%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAVSTIG----YFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQH 759
            +L++ +ET +   +V+E  + + +DL  +    + ++      L++ Q++   +   ++N+++SDIK  NV++      IKLIDF     G   T+   ST G    Y  PE    K F    + V+SIG   Y L+        + E+++      R      D I   L ++   R  LE++L H
Sbjct:   89 QLLDWYETPSQYTLVLERPN-SCMDLQKFAWKHRKKMTESVVRLVMHQVVTAAIACCEMNVYHSDIKPQNVLINPHTFQIKLIDFG---VGRIMTSEGYSTFGGTQAYAPPEFSDCKKFHAKPATVYSIGIMLYRLLHRKSPHRELIEIVARTWERDRLSKECIDMICSCLQRNPRQRIPLEEILHH 271          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 75.0998 bits (183), Expect = 4.404e-14
Identity = 61/206 (29.61%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E+ +L  VQ      ++++ FE      +VME L  + +DLFD++ SQ + +D   AS I +QL+  +  L   +I + DIK +N+++  D  SIKL+DF   + +H G+ ++T+   T  Y +PE + G  +      ++S+G   YTLI G+  F  ++E+L + + P       +   I   L +    R  L++LL+ P+++
Sbjct:  943 EIAILSRVQH-PNIIRVVDVFENDTFFQLVME-LHGDGLDLFDFIDSQPS-LDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAPDF-SIKLVDFGSAAHLHQGTLFSTFC-GTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPWVT 1143          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:100497723])

HSP 1 Score: 73.1738 bits (178), Expect = 7.415e-14
Identity = 60/210 (28.57%), Postives = 102/210 (48.57%), Query Frame = 1
Query:  154 LMFP-ELKVLKLVQ-GLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF-IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            +M P E+ +LK V  G +G  KL++ +E ++   IVME       DLFDY+ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF        + +T +  + + Y  PE VR   +    + V+S+G   Y ++ GD  F+  EE++   +    R        IK  L     DRP LE +  HP++
Sbjct:   85 VMVPLEIVLLKKVGTGFRGVIKLLDWYERADGFLIVMERPE-PVKDLFDYI-TEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRNGELKLIDFGSGALLKDTVYTDFDGTRV-YSPPEWVRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEIVRVRLYFRRRISTECQQLIKWCLSLRPSDRPTLEQIFDHPWM 291          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 72.4034 bits (176), Expect = 1.293e-13
Identity = 51/200 (25.50%), Postives = 98/200 (49.00%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF-IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            K+  G +G  +L++ +E  +   I+ME       DLFD++ +++  +  + A+   +Q++  +      ++ + DIK +N+++      +KLIDF        + +T +  + + Y  PE +R   +    + V+S+G   Y ++ GD  F+  +E+L   I    R        I+  L K   DRP LE +L HP++S
Sbjct:  112 KVSNGCRGVIRLLDWYERPDGFIIIMERPE-PVQDLFDFI-TERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFDGTRV-YSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPWMS 308          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 72.4034 bits (176), Expect = 1.294e-13
Identity = 51/200 (25.50%), Postives = 98/200 (49.00%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF-IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            K+  G +G  +L++ +E  +   I+ME       DLFD++ +++  +  + A+   +Q++  +      ++ + DIK +N+++      +KLIDF        + +T +  + + Y  PE +R   +    + V+S+G   Y ++ GD  F+  +E+L   I    R        I+  L K   DRP LE +L HP++S
Sbjct:   93 KVSNGCRGVIRLLDWYERPDGFIIIMERPE-PVQDLFDFI-TERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFDGTRV-YSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPWMS 289          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 72.0182 bits (175), Expect = 3.222e-13
Identity = 57/191 (29.84%), Postives = 104/191 (54.45%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            ++++ FE      +VME L  + +DLFD++ SQ + +D   AS I +QL+  +  L   +I + DIK +N+++  D  SIKL+DF   + +H G+ ++T+   T  Y +PE + G  +      ++S+G   YTLI G+  F  ++E+L + + P       +   I   L +    R  L++LL+ P+++
Sbjct:  306 RVVDVFENDTFFQLVME-LHGDGLDLFDFIDSQPS-LDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAPDF-SIKLVDFGSAAHLHQGTLFSTFC-GTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPWVT 492          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Gm7168 (predicted gene 7168 [Source:MGI Symbol;Acc:MGI:3643198])

HSP 1 Score: 68.1662 bits (165), Expect = 4.623e-12
Identity = 58/203 (28.57%), Postives = 96/203 (47.29%), Query Frame = 1
Query:  214 LINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS-----------DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS--IEELLSFI-----PPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            L+  FET    Y++ME   V   +L++Y+ S    I+   A  I  Q++  +     L I + D+K DN+M+  D  SIK+IDF            D H G+    YA     + +PE    K +D T+S ++++G   Y ++ G   FDS  I EL   I     P      N + D + + +  +   RP + ++++HP+L
Sbjct:   87 LLQVFETKTRGYLIME--LVEGQELYEYIKS-SGHIEEDEARQIFLQILSAVSYCHGLGIVHRDLKPDNIMI-DDKGSIKIIDFGLSTQVKPGDLLDEHCGA----YA-----FGAPELFLWKSYDGTKSDLWALGVILYYMVVGKVPFDSYIIPELQRQILAGVYPAPCGVSNELKDLLSLLMTVNPKYRPTVTEVMKHPWL 276          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pim2 (proviral integration site 2 [Source:MGI Symbol;Acc:MGI:97587])

HSP 1 Score: 65.855 bits (159), Expect = 2.085e-11
Identity = 51/197 (25.89%), Postives = 90/197 (45.69%), Query Frame = 1
Query:  193 GLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS---FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            G  G  +L++ FET     +V+E   +   DLFDY+ ++K  +    +     Q++  +       + + DIK +N+++     SIKLIDF         P+T +  + + Y  PE +    +    + V+S+G   Y ++ GD  F+  +E+L      P  V  D      I+  L      RP LE++L  P++
Sbjct:  154 GHPGVIRLLDWFETPEGFMLVLER-PMPAQDLFDYI-TEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRV-YSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCA--LIRRCLAPKPCSRPSLEEILLDPWM 345          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pim2 (proviral integration site 2 [Source:MGI Symbol;Acc:MGI:97587])

HSP 1 Score: 65.855 bits (159), Expect = 2.157e-11
Identity = 51/197 (25.89%), Postives = 90/197 (45.69%), Query Frame = 1
Query:  193 GLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS---FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            G  G  +L++ FET     +V+E   +   DLFDY+ ++K  +    +     Q++  +       + + DIK +N+++     SIKLIDF         P+T +  + + Y  PE +    +    + V+S+G   Y ++ GD  F+  +E+L      P  V  D      I+  L      RP LE++L  P++
Sbjct:  160 GHPGVIRLLDWFETPEGFMLVLER-PMPAQDLFDYI-TEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRV-YSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCA--LIRRCLAPKPCSRPSLEEILLDPWM 351          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Mark1 (MAP/microtubule affinity regulating kinase 1 [Source:MGI Symbol;Acc:MGI:2664902])

HSP 1 Score: 60.8474 bits (146), Expect = 7.192e-11
Identity = 44/144 (30.56%), Postives = 72/144 (50.00%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            KL    ET    Y+VME  S    ++FDY+ +   R+  K A    +Q++  +    +  I + D+K +N++L  D+ +IK+ DF    +   G+   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD 
Sbjct:   11 KLFEVIETEKTLYLVMEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADM-NIKIADFGFSNEFTVGNKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG 149          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Snrk (SNF related kinase [Source:MGI Symbol;Acc:MGI:108104])

HSP 1 Score: 64.3142 bits (155), Expect = 7.718e-11
Identity = 55/219 (25.11%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  157 MFPELKVLKLVQGLQGFPKLINSFE---TSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWT--TYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSI--EELLSFI-------PPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            +F E++ +KLVQ     P ++  +E   T    Y+++E    +  D+FDY+   +  ++   A     Q++  I    KL++ + D+K +NV+  +    +KL DF   +   P    T +  ++ Y +PE + G  +D     ++S+G   + L+ G   F      E L+ I       PP  R      D I   L +    R  LE++  HP+L 
Sbjct:   60 LFQEVRCMKLVQ----HPNIVRLYEVIDTQTKLYLILE--LGDGGDMFDYIMKHEEGLNEDLAKKYFAQIVHAISYCHKLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPP--RVSAGCRDLITRMLQRDPKRRASLEEIESHPWLQ 270          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|O44997|DAPK_CAEEL (Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans OX=6239 GN=dapk-1 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.440e-13
Identity = 65/215 (30.23%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKS-IKLIDFSDVHFGSPWTTYA--VSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAF--DSIEELLSFIPPV---------VRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            E++VL+ ++G     +L   +ET++   IV+E +S    +LFD+VC+ K  +D   A+  IKQ+++ +  L  L+I + DIK +NVML++   S IK+IDF       P       V T  + +PE V  +      + ++++G  TY L+ G   F  D+ +E  S I  V           T     DFI    ++ +  R  +E+ LQHP++
Sbjct:   79 EVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGG--ELFDHVCA-KECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQRGDSQIKIIDFGLSREIEPGAVVKDMVGTPEFVAPEVVNYEALS-PATDMWAVGVVTYILLSGGSPFLGDNRDETFSNITRVRYHFSDRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWI 289          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q9UTH3|PPK6_SCHPO (Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk6 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.444e-12
Identity = 57/191 (29.84%), Postives = 101/191 (52.88%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF--SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF---IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K+I  FE + + Y++ E      +DLFDY+   K  I  K +  I  Q+ + +  L   +I + DIK +NV+L  +    +LIDF  S +    P+ T+   T+G+ +PE +RG+ +      ++++G   YT++  +  + +IEE+L     IP  +  DN+  D I   L +++ DR  +E+ LQH + 
Sbjct:  574 KMITFFEDNENYYLLTEPQKPG-IDLFDYI-ELKPSISEKESKAIFFQIALAVAHLHSFDIIHRDIKDENVILEGN-GCARLIDFGSSSLTKNGPFDTFR-GTVGFAAPELLRGEKYLGKEQDIWALGILLYTIVYRENPYYNIEEILDAKLRIPFELSKDNV--DLICRMLDRNVHDRITIEETLQHHWF 758          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q9YHZ5|PIM2_DANRE (Serine/threonine-protein kinase pim-2 OS=Danio rerio OX=7955 GN=pim2 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 7.334e-12
Identity = 52/196 (26.53%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  187 VQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF-SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPV-VRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            V G +G  ++++ FE     Y+++     +  DLFD++ +++  +D   A   +KQ+I  +       I + DIK +N+++      IK+IDF S         T    T  Y  PE +    +      V+S+G   Y ++ GD  F+   +++   P    R  N     I   L  +  DRP LE +LQHP++
Sbjct:   96 VPGHRGIIRMLDWFEIPGQEYLIVFEKPQHCQDLFDFI-TERGALDESLARRFLKQVIEAVQFCHSKGIVHRDIKDENILVDTRTGDIKVIDFGSGATLKDSMYTDFEGTRVYSPPEWILYHKYHALPLTVWSLGVLLYDMVCGDIPFEQDTDIVKAKPSFNKRISNDCRSLICSCLSYNPGDRPSLEQILQHPWM 290          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q91822|PIM3_XENLA (Serine/threonine-protein kinase pim-3 OS=Xenopus laevis OX=8355 GN=pim3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.671e-12
Identity = 55/202 (27.23%), Postives = 92/202 (45.54%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEEL----LSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K+    +G   L++ +E  +   IVME       DLFDY+ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF        + +T +  + + Y  PE VR   +    + V+S+G   Y ++ GD  F+  EE+    L F     R        IK  L     DRP LE +  HP++
Sbjct:   96 KVPTAFRGVINLLDWYERPDAFLIVMERPE-PVKDLFDYI-TEKGPLDEDTARGFFRQVLEAVRHCYNCGVVHRDIKDENLLVDTRNGELKLIDFGSGALLKDTVYTDFDGTRV-YSPPEWVRYHRYHGRSATVWSLGVLLYDMVYGDIPFEQDEEIVRVRLCF---RRRISTECQQLIKWCLSLRPSDRPTLEQIFDHPWM 291          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|B4LDJ6|PLK4_DROVI (Serine/threonine-protein kinase PLK4 OS=Drosophila virilis OX=7244 GN=SAK PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.086e-11
Identity = 58/193 (30.05%), Postives = 100/193 (51.81%), Query Frame = 1
Query:  226 FETSNHSYIVMENLSVNYVDLFDYVCSQKNR-IDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS-DVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNII--------NDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            F+ +N+ Y+++E L+ N  +L  Y+  Q  R    + A+ I++Q++  +L L   NI + DI + N++L KD+  +K+ DF        P   +     T  Y SPE V  +   +  + ++S+GC  YTL+ G   FD+ + + S +  VV++D  I         D I   L K+  +R  LE +L+HPF+
Sbjct:   81 FQDANYVYLILE-LADN-GELHRYMNQQMKRPFTEQEAASILRQVVDGLLYLHSHNIMHRDISMSNLLLSKDMH-VKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSHQSHGLP-ADLWSVGCMLYTLLVGRPPFDT-DAVQSTLNKVVQSDYTIPGHLSYEARDLIDKLLRKNPHERISLEQVLRHPFM 268          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A3S3QP30 (Serine/threonine-protein kinase pim-3-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_06536 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.382e-15
Identity = 63/221 (28.51%), Postives = 120/221 (54.30%), Query Frame = 1
Query:  127 DKILTTKIILMFP-ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKS--IKLIDF-SDVHF-GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF-IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            +KI+     L  P E+ +L+ V  + G  +L++ +E S+   I+ME       DLFD++ ++K  +D K + L + Q++  ++   +  + + DIK +N+++  DLK+  +KLIDF S  H   +P+T +  + + Y  PE +R   ++   + V+S+G   Y ++ GD  F+  +++L+  +    R      D IK  L     +RP L D+L+HP+++
Sbjct:   48 EKIIGWDSALRMPLEITLLRKVNHVSGVIRLVDWYERSDSFIIIMERPE-PVKDLFDFI-TEKGVLDEKLSRLFLTQVVTAVISCHEAGVIHRDIKDENILV--DLKTLNLKLIDFGSGAHLKDAPYTDFDGTRV-YSPPEWIRNNRYNGRSATVWSLGVLLYDMVCGDIPFERDDQILNAEVRFRRRLSPECQDLIKSCLSIRPSERPSLHDILKHPWMT 263          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A210PDX5 (Serine/threonine-protein kinase pim-3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11465 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.635e-15
Identity = 60/205 (29.27%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E+ +LK V    G  K+++ FE   +  IVME    +  DLFDY+ ++K  +D +T+    +Q++  ++++ K  + + DIK +N+++      +KLIDF    F    T Y     T  Y  PE ++   +    +AV+S+G   + L+ GD  F+  E+++ + +    R  + + D +K  L     DRP LE++L HP+L+
Sbjct:   76 EICLLKRVNNCAGVIKMLDWFEMKTNFVIVMERPE-HVQDLFDYI-TEKGALDEETSKNFFRQIVDTLINIHKNGVVHRDIKDENILVDLKTGELKLIDFGSGAFLKD-TVYLAFDGTRVYSPPEWIKFHRYHGRSAAVWSLGILLFDLVCGDIPFEQDEQIMKAEVSFRGRVSHEVKDLVKKCLAIRPSDRPTLEEILTHPWLA 277          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A168H2B8 (Protein kinase domain-containing protein OS=Mucor circinelloides f. lusitanicus CBS 277.49 OX=747725 GN=MUCCIDRAFT_157497 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.704e-15
Identity = 57/190 (30.00%), Postives = 96/190 (50.53%), Query Frame = 1
Query:  214 LINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYA--VSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS---FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            +++ FE  +H YIVM       +DLFDY+    + I       I KQ+ + +  L + NI + DIK +NV+L  D   ++LIDF    +  P   Y   V T+ Y +PE +RG  +      V+++G   +TL+  +  F  I+E++     IP V+   ++  D I   L + +  R  ++ +L HP+L
Sbjct:    1 MLDYFEDEDHYYIVMGLHGGGGMDLFDYIELNDHGIPEHEIRRIFKQIALGVRHLHEHNIVHRDIKDENVVLSDD-GGLRLIDFGSAAYLKPGRKYETFVGTLDYAAPEILRGHTYSGKPQDVWALGILLFTLVYRENPFYDIDEIMGRELRIPFVLSEGSV--DLISKMLERDVDKRIDIQQVLAHPWL 187          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A2P6K2E1 (Serine/threonine-protein kinase pim-3 OS=Nephila clavipes OX=2585209 GN=NCL1_54462 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.262e-15
Identity = 60/212 (28.30%), Postives = 116/212 (54.72%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIINDFIKVT---LIKSLL-----DRPKLEDLLQHPFLS 771
            E+ +LK V  ++G  KL++ +E ++H  I+ME    N  DL+DY+ ++K  +D K + +   Q++  +++  K  I + DIK +N+++     +++LIDF    F   + +T +  + + Y  PE +R + ++   + V+S+G   Y ++ GD  F+  E++L       R D     F+ +    LI+  L     DRP LE++L+HP+++
Sbjct:   83 EICLLKKVSHIKGVIKLLDYYERADHFIIIMERPE-NAKDLYDYI-TEKVFLDEKLSRVFFHQVVESVIECHKAGIIHRDIKDENILVDMKNLTLRLIDFGSGAFLKDTMYTDFDGTRV-YSPPEWIRCQCYNGHAATVWSLGILLYDMVCGDIPFEEDEKIL-------RADVRFKKFLTLECRDLIRKCLSIRPSDRPTLEEILRHPWMT 284          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A4Y2U6S0 (Serine/threonine-protein kinase pim-3 OS=Araneus ventricosus OX=182803 GN=PIM3_3 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.113e-15
Identity = 60/211 (28.44%), Postives = 112/211 (53.08%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-------SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E+ +LK V  ++G  KL++ FE   H  I+ME    +  DL+D++ ++K  +D K + +   Q++  +++  K  I + DIK +N+++     +++LIDF    F   + +T +  + + Y  PE +R + ++   + V+S+G   Y ++ GD  F+  E++L        F+ P  R      D I+  L     DRP LED+LQH +++
Sbjct:   75 EICLLKKVSHVKGVIKLLDYFERPEHFIIIMERPE-HTKDLYDFI-TEKVCLDEKLSRVFFHQVVESVIECHKAGIIHRDIKDENILVDMKNLTLRLIDFGSGAFLKDTLYTDFDGTRV-YSPPEWIRCQCYNGRAATVWSLGILLYDMVCGDIPFEEDEKILRADVRFKKFLSPECR------DLIQKCLSIRPADRPTLEDILQHSWMT 276          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: ENSAMXT00000030133.1 (serine/threonine-protein kinase pim-3-like [Source:NCBI gene;Acc:103028120])

HSP 1 Score: 73.9442 bits (180), Expect = 1.852e-14
Identity = 50/188 (26.60%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWT-TYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF-IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            +LI  F+      +VME L    +DL D++CS++     K A  I+ Q I  + +  K  + + DIKL+N ++  +   +KL+DF    F +     + + T  +  PE    + +    S V+S+G F YT++ G + F +  E+++  +       N + D I+  L      RP L+ +  HP+ 
Sbjct:  131 QLIQWFDEPERYIVVME-LFRPCMDLLDFMCSKRGFFTEKKARHIMVQAIKAVTECHKRGVLHRDIKLENFLINTNTFEVKLVDFGCGDFFTERELNHYIGTEEFCPPEFFLSRSYHAAPSTVWSLGVFLYTMVHGYHPFTTRHEIIAGDLRFGDHLSNEVCDLIRWCLQDDPTWRPSLQQIFGHPWF 317          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043334])

HSP 1 Score: 71.2478 bits (173), Expect = 1.361e-13
Identity = 57/210 (27.14%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  154 LMFP-ELKVLKLV-QGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            +M P E+ +LK V    +G  KL++ +E  +   IVME   +   DLFD++ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF    F   + +T +  + + Y  PE +R   +    + ++S+G   Y ++ GD  F+  EE++   +    R        IK  L     DRP LE + +HP++
Sbjct:   66 VMVPLEIVLLKKVGSSFRGVIKLLDWYERPDGWLIVMERPEL-VKDLFDFI-TEKGALDEATARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAFLKDTVYTDFDGTRV-YSPPEWIRFHRYHGRSATIWSLGVLLYDMVCGDIPFEQDEEIIRGRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFEHPWM 272          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043334])

HSP 1 Score: 71.2478 bits (173), Expect = 1.770e-13
Identity = 52/199 (26.13%), Postives = 96/199 (48.24%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K+    +G  KL++ +E  +   IVME   +   DLFD++ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF    F   + +T +  + + Y  PE +R   +    + ++S+G   Y ++ GD  F+  EE++   +    R        IK  L     DRP LE + +HP++
Sbjct:   97 KVGSSFRGVIKLLDWYERPDGWLIVMERPEL-VKDLFDFI-TEKGALDEATARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAFLKDTVYTDFDGTRV-YSPPEWIRFHRYHGRSATIWSLGVLLYDMVCGDIPFEQDEEIIRGRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFEHPWM 292          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: pim3 (serine/threonine-protein kinase pim-3-like [Source:NCBI gene;Acc:103024220])

HSP 1 Score: 70.8626 bits (172), Expect = 2.425e-13
Identity = 55/201 (27.36%), Postives = 96/201 (47.76%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSD--VHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS---FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K+    +G  KLI+ +E  +   IVME   +   DLFDY+ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF    V   + +T +  + + Y  PE +R   +    + V+S+G   Y ++ GD  F+  EE++    F    +  D      IK  L     DRP LE + +H ++
Sbjct:   97 KVGNSFRGVIKLIDWYERPDGWLIVMERPEM-VKDLFDYI-TEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAVLKDTVYTDFDGTRV-YSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEHDEEIMKGSLFFRRRISPD--CQQLIKWCLCLRPSDRPTLEQIFEHQWM 292          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: pim1 (serine/threonine-protein kinase pim-1-like [Source:NCBI gene;Acc:103031835])

HSP 1 Score: 69.707 bits (169), Expect = 6.223e-13
Identity = 54/202 (26.73%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKS--IKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            K+  G +G  K+++ +E  +   IVME    N  DLFD++ ++K  +  + A    +Q++  +       + + DIK +N+++  DL+S  +KLIDF        + +T +  + + Y  PE ++   +    + V+S+G   Y ++ GD  F+  EE++   +    R        IK  L     DRP  EDL+ HP++ 
Sbjct:   94 KVSTGFRGVIKMLDWYERPDSFIIVMERPE-NAKDLFDFI-TEKGALPEELARSFFRQVLEAVRHCHNSGVVHRDIKDENILI--DLRSGELKLIDFGSGALLKDTVYTDFDGTRV-YSPPEWIKYHRYHGRSATVWSLGILLYDMVCGDIPFEQDEEIVRGQVLFRRRISTECQQLIKWCLALRPADRPSFEDLVNHPWMQ 290          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 65.0846 bits (157), Expect = 6.546e-12
Identity = 64/236 (27.12%), Postives = 114/236 (48.31%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFPKLINSFET---SNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS--IEELLS-------FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            +  IDK    T+ +  +F E++++K++      P ++  FE        Y+VME  S   V  FDY+ +   R+  K A    +Q++  +    + +I + D+K +N++L  D+ +IK+ DF    +   GS   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD   ++EL          IP  + TD    + +K  L+   L R  LE +++  +++
Sbjct:   96 VKIIDKTQLNTSSLQKLFREVRIMKVLN----HPNIVKLFEVIEMEKTLYLVMEYSSGGEV--FDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADM-NIKIADFGFSNEFTLGSKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTD--CENLLKRFLVLHPLKRGSLEQIMKDRWMN 320          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 64.3142 bits (155), Expect = 1.585e-11
Identity = 51/181 (28.18%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFPKLINSFE---TSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            +  IDK     + +  +F E++++K++      P ++  FE   T    Y+VME  S    ++FDY+ +   R+  K A    +Q++  +    + +I + D+K +N++L  D+ +IK+ DF    +   GS   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD 
Sbjct:   82 VKIIDKTQLNPSSLQKLFREVRIMKILN----HPNIVKLFEVIETEKTLYLVMEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADM-NIKIADFGFSNEFTLGSKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG 253          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 6.387e-11
Identity = 55/189 (29.10%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFP---KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS-----------DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            I  IDK     T +  +F E++++K +      P   KL    ET    Y+VME  S    ++FDY+ +   R+  K A    +Q++  +    + NI + D+K +N++L  D+  IK+ DF            D   GSP          Y +PE  +GK +D     V+S+G   YTL+ G   FD 
Sbjct:   67 IKIIDKTQLNPTSLQKLFREVRIMKCLN----HPNIVKLYEVIETEKTLYLVMEYASGG--EVFDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMH-IKIADFGFSNEFTLVNKLDTFCGSP---------PYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG 238          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 62.003 bits (149), Expect = 8.018e-11
Identity = 53/215 (24.65%), Postives = 97/215 (45.12%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFE---TSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAVS--TIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSI--EELLSFI-------PPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            E++ +KLVQ     P ++  +E   T    Y+++E    +  DL+DY+   +  +  + A     Q++  I    +L++ + D+K +NV+  +    +KL DF   +   P T  A S  ++ Y +PE + G  +D     ++S+G   Y L+ G   F      E L+ I       P  +  +    D I   L +    R  L+++  HP+L
Sbjct:   64 EVRCMKLVQ----HPNVVRLYEVIDTQTKLYLILE--LADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGTKLATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMIMDCKYTVPAHISRE--CKDLIARMLQRDPRRRASLQEMEGHPWL 270          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004636.1 (pep scaffold:Pmarinus_7.0:GL478081:45741:54241:-1 gene:ENSPMAG00000004223.1 transcript:ENSPMAT00000004636.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.047e-9
Identity = 38/144 (26.39%), Postives = 71/144 (49.31%), Query Frame = 1
Query:  226 FETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLR--KDLKSIKLID--FSDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEEL 645
            FET    ++VME L  + +++   + S++ R+       +I Q++I +  L   NI + D+K +NV+L   + L  +KL D  F+ +     +    V T  Y +PE +R K        ++S+G   Y  + G + F+  E++
Sbjct:   91 FETPERVFVVMEKLHGDMLEMI--LSSERGRLPEHITKFLITQILIALRHLHFKNIVHCDLKPENVLLASPEPLPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKQGYNRSLDMWSVGVIVYVSLSGTFPFNEDEDI 232          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: PSK1 (PAS domain-containing serine/threonine protein kinase; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status; PSK1 has a paralog, PSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000015])

HSP 1 Score: 58.9214 bits (141), Expect = 6.653e-10
Identity = 53/178 (29.78%), Postives = 93/178 (52.25%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVME-NLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKS-IKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIINDFIKVTLIKSLLDR 732
            +L++ FE  ++ YI    +     +DLFD +  + N  + + A LI KQ++  I  L    I + DIK +NV++  D K  +K+IDF    +    P+  + V TI Y +PE + G  ++     +++IG   YT++  +  F +I+E+L         + +  D I+  LIKS+L+R
Sbjct: 1166 RLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFE-AKLIFKQVVAGIKHLHDQGIVHRDIKDENVIV--DSKGFVKIIDFGSAAYVKSGPFDVF-VGTIDYAAPEVLGGNPYEGQPQDIWAIGILLYTVVFKENPFYNIDEILEGDLKFNNAEEVSEDCIE--LIKSILNR 1337          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: PSK2 (PAS-domain containing serine/threonine protein kinase; regulates sugar flux and translation in response to an unknown metabolite by phosphorylating Ugp1p and Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p (translation); PSK2 has a paralog, PSK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005405])

HSP 1 Score: 57.7658 bits (138), Expect = 1.249e-9
Identity = 48/192 (25.00%), Postives = 99/192 (51.56%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVME-NLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIIND---FIKVTLIKSLLDRPKLEDLLQHPFL 768
            KL++ FE  ++ YI    +     +DLFD +  +K+ ++ + A L+ KQ++  I  L    I + DIK +NV++      +KLIDF    +    P+  + V T+ Y +PE + G  +      ++++G   YT+I  +  + +I+E+L       +++++  +    IK  L + +  RP ++++ +  +L
Sbjct:  911 KLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFKKDMVEHE-AKLVFKQVVASIKHLHDQGIVHRDIKDENVIVDSH-GFVKLIDFGSAAYIKSGPFDVF-VGTMDYAAPEVLGGSSYKGKPQDIWALGVLLYTIIYKENPYYNIDEILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEIYEDKWL 1099          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 52.7582 bits (125), Expect = 6.470e-8
Identity = 46/148 (31.08%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  226 FETSNHSYIVMENLSVNYVD---LFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAVS--TIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAF--DSIEELL 648
            +E  +  Y+V+E     YVD   LFDY+ S K ++  + A    KQ++  +      NI + D+K +N++L K  + IK+ DF       P      S  +  Y SPE V G+ +    S V+S G   + L+ G   F  D+I++LL
Sbjct:  183 WENKSELYLVLE-----YVDGGELFDYLVS-KGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLL 324          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: YPL150W_mRNA (Protein kinase of unknown cellular role; binds phosphatidylinositols and cardiolipin in a large-scale study [Source:SGD;Acc:S000006071])

HSP 1 Score: 50.447 bits (119), Expect = 2.894e-7
Identity = 41/140 (29.29%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  385 LNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS----------IEELLSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            ++  + D+KL+N++L K+  + KL DF         TT      T  Y +PE +  + +D  +  ++S+G   YTLI G   FD           + E   +   V+  D    D I   L K+  +RP L  +L+HPFL
Sbjct:  151 MHCVHRDLKLENILLDKN-GNAKLTDFGFTRECMTKTTLETVCGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIPDD--ARDLISRLLAKNPGERPSLSQVLRHPFL 287          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 50.0618 bits (118), Expect = 2.942e-7
Identity = 48/196 (24.49%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  247 YIVMENLSVNYVD-LFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF--SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIG------------CFTYTLIKGDYAFDSIEELLSFIPPV--VRTDNII-----NDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            YI ME +    +D ++  +  +  RI  K    I + ++  +  L +  + + DIK  N++L ++ + +KL DF  S     S  TT+  ++  Y +PE ++G+ + +T S V+S+G            C +  +      F+ +  +L+F P +      NII       FI   L K   +RP    ++ HP++
Sbjct:  296 YIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQ-VKLCDFGVSGEAVNSLATTFTGTSF-YMAPERIQGQPYSVT-SDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWI 488          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO46861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH5])

HSP 1 Score: 70.8626 bits (172), Expect = 5.615e-14
Identity = 54/193 (27.98%), Postives = 93/193 (48.19%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSD--VHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEEL----LSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            +L + FE  N +Y+++     +Y DLFDY+ ++K  +  + A  I KQ++  +       +F+ DIK +N++L      +KL DF    V   + +T Y   T  Y  PE  R   +      V+S+G   + ++ GD  F +  E+    L+F   V +        ++  L K    RP LE++L+HP+L 
Sbjct:   52 RLYDYFEY-NQAYVLVLERPTHYRDLFDYI-TEKKLLSEREAKDIFKQVVHAVAYCEGKGVFHRDIKDENLLLDTKTGQVKLFDFGSGTVLENTLYTDYE-GTRAYCPPEWFRFHRYHARPCTVWSLGILLFNMLSGDVPFANQIEIVRGELNFAENVSKE---AQSLVRWLLAKHPSYRPTLENILKHPWLG 238          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO36587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI81])

HSP 1 Score: 61.2326 bits (147), Expect = 1.542e-10
Identity = 49/216 (22.69%), Postives = 99/216 (45.83%), Query Frame = 1
Query:  157 MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLID--FSDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF---------IPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            +  E++ +KLVQ      +L    +T+   Y+++E    +  D++DY+ +    +  + A    +Q+++ I    KL++ + D+K +NV+  K+    KL D  FS+    +     A  ++ Y +PE + G  ++     V+S+G   Y L+ G   F    +  +          +P  V    +  + I   LI+   +R  L +++ HP+L 
Sbjct:   63 LLKEVRCMKLVQH-PNVVRLYQVIDTNTKLYLILE--LGDGGDMYDYIMNHDKGLPEEKARYFFRQIVLAIDYCHKLHVVHRDLKPENVIFFKNQDMAKLTDFGFSNNFIPNEKLDTACGSLAYSAPEVLLGDAYEAPAVDVWSLGVILYMLVCGQAPFSEANDSETLTKIMDCRYDVPDHVSP--LCKNLISRMLIREPHNRASLGEIMSHPWLQ 273          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 60.4622 bits (145), Expect = 4.516e-10
Identity = 51/178 (28.65%), Postives = 88/178 (49.44%), Query Frame = 1
Query:  115 INFIDKIL--TTKIILMFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDF---SDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS 633
            I  IDK     + +  +F E++++K +       KL    ET    Y+VME  S   V  FDY+ +   R+  K A    +Q++  +    + ++ + D+K +N++L  D+ +IK+ DF   ++   G+   T+  S   Y +PE  +GK +D     V+S+G   YTL+ G   FD 
Sbjct:   66 IKIIDKTQLNPSSLQKLFREVRIMKFLD-HPNIVKLYEVIETDKTLYLVMEYASGGEV--FDYLVAH-GRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADM-NIKIADFGFSNEFTPGNKLDTFCGSPP-YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG 237          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO37951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE61])

HSP 1 Score: 58.151 bits (139), Expect = 1.442e-9
Identity = 59/220 (26.82%), Postives = 100/220 (45.45%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAVS----------TIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPV---------VRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            E+KVLK ++       L+   ET+   YI+  +L+ N  DL +Y+ +    +  K +  + +Q+   +  +   +I + D+K +N++L KDL  I     SD  F     T A            +  Y +PE ++G  +D T + V+S+G   YT++ G   FD    L S +  V         V+  +     I   L  +L +R  +E LLQ P+L
Sbjct:  100 EIKVLKKIKNTY-VTTLLEVIETNTRMYIIT-DLAEN-GDLLEYIRTH-GALTEKASRRLFRQITAGVHYIHSQDIVHRDLKCENLLLDKDLNII----ISDFGFARDCLTTATGKKKLSHTYCGSYAYAAPEILKGIAYDATLADVWSMGVILYTMLCGRLPFDD-SNLRSLLQQVHKRVTFSSRVKLSDAAKAIIHKMLTWNLPERITVEQLLQEPWL 310          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO47961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKT6])

HSP 1 Score: 56.9954 bits (136), Expect = 2.399e-9
Identity = 47/194 (24.23%), Postives = 90/194 (46.39%), Query Frame = 1
Query:  211 KLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFS---DVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAF--DSIEELLSFIPPVVR----TDNIINDFIKVTLIKSLLDRPKLEDLLQHPF 765
            +L  + ET    Y+++E       DL +Y+ ++   +  + A +I  Q +  +    K  + + D+K +N++L  + + +K+ DF    + H  +   T+   +  Y SPE +RG L+D   S ++S+G   Y L+     F  D +  +++  P  +R    T     + I+  L      RP  E+LL  P+
Sbjct:   70 QLYEAIETETKVYLILELAEGG--DLLEYI-NKNALLPEERARVIFCQFVATMAYCHKERVVHRDLKCENLLLDANGR-LKITDFGFACNTHKTNILQTF-CGSYAYCSPEILRGDLYDGQASDIWSMGVVLYALVCARLPFGDDDLRAIMNREPRKLRFSKKTSKECRELIRKMLALDEKKRPTAEELLHEPW 258          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000041570.1 (pep primary_assembly:ASM223467v1:10:18938984:18940525:-1 gene:ENSORLG00000023590.1 transcript:ENSORLT00000041570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 5.136e-14
Identity = 55/209 (26.32%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLIN--SFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIIND----FIKVTLIKSLLDRPKLEDLLQHPFL 768
            E   L++V     FP +I    F  + ++++++     N  DL++Y+   K R+   TA   + Q+I  +L      + + D+K +N+++      +KLIDF    F  P   Y +   T  Y  PE +    +    S V+S+G   Y ++ GD  F +  ELL      +R +  +++     IK  L ++  +RP L+D+L HP++
Sbjct:   90 EAVALEMVSKDPPFPGIIRMLDFYKTPYNWVIVTEKPENTQDLYEYITISK-RLREDTAREFLGQVIQALLHCHSRGVVHMDVKDENLLVDLTTLELKLIDFGSAEFLEPDKVYDMFHGTAAYGPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFGNDRELLLG---ELRFEKDLSEDCVALIKWCLSRTPEERPMLKDILAHPWM 294          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000010626.2 (pep primary_assembly:ASM223467v1:12:12000679:12006348:1 gene:ENSORLG00000008461.2 transcript:ENSORLT00000010626.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 7.793e-14
Identity = 55/209 (26.32%), Postives = 99/209 (47.37%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLIN--SFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIIND---FIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E+  L++V     FP +I    F  +  +++++     N  DLF Y+ + K R+   TA   + Q+I  +L      + + D+K +N++L      + LIDF    F  P   Y     T  Y  PE +    +    S V+S+G   Y ++ GD  F + EE+L  +  +    ++  D    ++  L ++  +RP L+D+L HP++S
Sbjct:   97 EVVALEMVTKDPPFPGIIRMLDFYKTRGAWVIVTETPENTQDLFHYITTCK-RLCEDTARDFLGQVIQALLHCHSRGVVHMDVKDENLLLDPSTHKLLLIDFGSAVFLEPDKVYDTFHGTAVYAPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFQNDEEIL--LGELRFKKDLSEDCVALMQWCLSRAPEERPTLKDILAHPWMS 302          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000032540.1 (serine/threonine-protein kinase pim-2-like [Source:NCBI gene;Acc:101156739])

HSP 1 Score: 72.4034 bits (176), Expect = 8.236e-14
Identity = 55/209 (26.32%), Postives = 99/209 (47.37%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLIN--SFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYAV--STIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVRTDNIIND---FIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E+  L++V     FP +I    F  +  +++++     N  DLF Y+ + K R+   TA   + Q+I  +L      + + D+K +N++L      + LIDF    F  P   Y     T  Y  PE +    +    S V+S+G   Y ++ GD  F + EE+L  +  +    ++  D    ++  L ++  +RP L+D+L HP++S
Sbjct:   71 EVVALEMVTKDPPFPGIIRMLDFYKTRGAWVIVTETPENTQDLFHYITTCK-RLCEDTARDFLGQVIQALLHCHSRGVVHMDVKDENLLLDPSTHKLLLIDFGSAVFLEPDKVYDTFHGTAVYAPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFQNDEEIL--LGELRFKKDLSEDCVALMQWCLSRAPEERPTLKDILAHPWMS 276          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: pask (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:101157160])

HSP 1 Score: 70.0922 bits (170), Expect = 1.417e-12
Identity = 61/211 (28.91%), Postives = 104/211 (49.29%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSPWTTYA--VSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSF---IPPVVRTDNIINDFIKVTLIKSLLDRPK----LEDLLQHPFLS 771
            E+ +L  VQ      K++  FE  ++  +VME    + +DLF+++  Q  R+D   AS I +QL+  +  L   NI + DIK +N+++ K    I+LIDF       P   +     T+ Y SPE ++G  ++     ++S+G   +TL+  +  F  +EE+L     +P  V ++      + V L   L   PK    L+ LL  P++S
Sbjct:  943 EIAILTRVQH-HNIVKVVEVFENGSYFQMVMEKHG-DGLDLFEFIDMQP-RLDEPLASYIFRQLVAAVFYLRTKNIIHRDIKDENIIIDKCFH-IRLIDFGSAAILVPGKLFYNFCGTLEYCSPEVLQGHPYEGPELEMWSLGVLLFTLLFSENPFCDVEEILDAKLKLPFSVSSE------LHVVLRGLLHSNPKKRMTLDQLLLQPWIS 1143          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101171374])

HSP 1 Score: 67.781 bits (164), Expect = 2.358e-12
Identity = 52/199 (26.13%), Postives = 94/199 (47.24%), Query Frame = 1
Query:  181 KLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF--GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELL-SFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            K+    +G  KL++ +E  +   IVME   +   DLFD++ ++K  +D  TA    +Q++  +       + + DIK +N+++      +KLIDF        + +T +  + + Y  PE +R   +    + V+S+G   Y ++ GD  F+  EE+L   +    R        IK  L     DRP L+ +  HP++
Sbjct:   96 KVSSSFRGVIKLLDYYERPDGWLIVMERPDL-VKDLFDFI-TEKGALDEGTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGELKLIDFGSGAILKDTVYTDFDGTRV-YSPPEWIRFHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGKVYFRRRVSPECQQIIKWCLALRPSDRPTLDQICDHPWM 291          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000030308.1 (SMESG000030308.1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.877e-22
Identity = 62/188 (32.98%), Postives = 107/188 (56.91%), Query Frame = 1
Query:  151 ILMFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGS-PWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKG---DYAFDSIEELLSFIPPVVRTDNIINDFIK 702
            IL+  E + +K +Q     PKLI++F T  HS++VME+LS++ ++LF ++   +  ID +   +I+ Q++  +  +  ++I Y DIK +N+M+  +   +KLIDF  V +G   +    + T G+ SPE+ + K + I  S VFS+GC  Y  ++    D  ++S EE  SFI       ++IN  +K
Sbjct:   39 ILISKECQAIKDLQDQPFVPKLIDNFLTEYHSFVVMEDLSMDCIELFQFI---EIPIDEEDFKIIMLQIMKALKQMASMDIHYMDIKPENIMINTETLQVKLIDFESVVYGEMEYLQKRIGTKGFISPENFQKKTYRIKPSKVFSLGCLMYFCMENQETDLIWNS-EENRSFIFCSPLLQDLINQCLK 222          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000068606.1 (SMESG000068606.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.744e-21
Identity = 67/206 (32.52%), Postives = 108/206 (52.43%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGSP----WTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVR-TDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            EL  L+ +Q L+  PKLIN  +  N S +VME L  ++ DL +++   +   D      IIK +II +  L  +  ++ DIK DN+M+ ++   IKL+DF D  +       +T     TIGY SPES       +  S VF+IGCF Y  I+ ++A+++  E L   P  +R +  +  D I+    +  L+R +   +L+HP+ 
Sbjct:   64 ELHFLQHLQHLEFIPKLINFHDGVNTSTVVMEFLDNDWTDLSEFISDCR---DESVIKKIIKNVIISLHKLSNIGYYHQDIKPDNIMVNRNNLKIKLVDFEDTIYCKETFPLYTIQNSGTIGYKSPESFFQCPCYVKPSMVFNIGCFIYVCIEKEFAYNTKNETLKCDPLEIRHSSKLAADLIRRCTTRYPLNRWEFHTILRHPWF 266          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000007586.1 (SMESG000007586.1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.395e-20
Identity = 59/207 (28.50%), Postives = 108/207 (52.17%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHF----GSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLS-FIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            E   LKL+Q     P ++   ++  +SY++M+ LS N+   +D+V    +  D K    IIK + + ++D+ K  IFY DIKL+N+M+  +   IK+ID  D  +      P+    + T+GY SPE    + +++    +FS GC  YT ++    F S ++ ++  +P +   D+   + I+  L K++    + ED+L H + +
Sbjct:   73 EFFFLKLLQATGYCPVVVEYLQSFEYSYVIMKKLSDNWKLFYDFVDKVNHISDLKK---IIKNIALALIDINKHGIFYMDIKLENIMVNSETFDIKIIDLEDSIYSPNSNDPYHIGLIGTLGYCSPEVFSAERYNVKCCQIFSFGCLLYTCLELQLPFHSEKQTVNRCLPKMTIIDSKAVELIERCLQKNVTKYFRFEDILLHSWFN 276          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000068530.1 (SMESG000068530.1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.582e-19
Identity = 66/206 (32.04%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFG---SPWTTYAVS-TIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDSIEELLSFIPPVVR-TDNIINDFIKVTLIKSLLDRPKLEDLLQHPFL 768
            EL  L  +Q L+  PKLIN  +  N S +VME L  ++ DL +++   +   D      II  +II + +L  +  ++ DIK DN+M+ K+   +KLIDF D+ +    +P  T   S TIGY SPES     +DI  S VF+IGC  Y  ++  +++ +  E L      ++ +  + ++ I+  + +S  +R K  +LL+H + 
Sbjct:   64 ELYFLTQLQNLKFIPKLINFHDGVNTSTVVMEFLDNDWTDLSEFISDGR---DESVIKRIIINVIIILHELSNIGYYHQDIKPDNIMVNKNSLEMKLIDFEDMIYSIETNPTCTAPNSGTIGYKSPESFLPSPYDIKPSLVFNIGCLIYVCLERKFSYITKSETLKCAALKIKLSSKLASNLIRKCVTRSPNNRCKFNNLLRHQWF 266          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000061809.1 (SMESG000061809.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.275e-17
Identity = 58/206 (28.16%), Postives = 104/206 (50.49%), Query Frame = 1
Query:  166 ELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCSQKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKLIDFSDVHFGS---PWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTLIKGDYAFDS-IEELLSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQHPFLS 771
            EL  L+ +   +  PKLI   + +N S + ME +  +++DL  Y+   +     K    I++ LI  +  +  +  ++ DIK +N+M+ +    IKLID  D+ +     P     + T+G+ SPE+     +++ +S VF+IGC  Y  I+ +YAFD+ IE     +P +  +  +   FI   +     +R + +DLL H +L 
Sbjct:   67 ELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGE---KLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYGKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 269          
The following BLAST results are available for this feature:
BLAST of Protein kinase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIM23.982e-1125.24Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM11.052e-1023.27Pim-1 proto-oncogene, serine/threonine kinase [Sou... [more]
MARK41.377e-1030.39microtubule affinity regulating kinase 4 [Source:H... [more]
MARK21.798e-1028.18microtubule affinity regulating kinase 2 [Source:H... [more]
MARK21.924e-1028.18microtubule affinity regulating kinase 2 [Source:H... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dapk-11.132e-1430.23Death-associated protein kinase dapk-1 [Source:Un... [more]
par-11.976e-1130.51Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-11.979e-1130.51Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-11.979e-1130.51Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-11.980e-1130.51Serine/threonine-protein kinase par-1 [Source:Uni... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
par-13.162e-1029.19gene:FBgn0260934 transcript:FBtr0301503[more]
par-13.180e-1029.19gene:FBgn0260934 transcript:FBtr0330245[more]
SAK1.535e-929.17gene:FBgn0026371 transcript:FBtr0078387[more]
par-13.422e-929.44gene:FBgn0260934 transcript:FBtr0301506[more]
par-13.599e-929.44gene:FBgn0260934 transcript:FBtr0301504[more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim35.744e-1326.63Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pim21.636e-1226.53Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
pimr1821.453e-1125.67Pim proto-oncogene, serine/threonine kinase, relat... [more]
pask1.574e-1128.80PAS domain containing serine/threonine kinase [Sou... [more]
pimr1823.021e-1125.67Pim proto-oncogene, serine/threonine kinase, relat... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PASK4.404e-1429.61PAS domain containing serine/threonine kinase [Sou... [more]
PIM37.415e-1428.57Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
ncbp11.293e-1325.50nuclear cap binding protein subunit 1 [Source:Xenb... [more]
ncbp11.294e-1325.50nuclear cap binding protein subunit 1 [Source:Xenb... [more]
PASK3.222e-1329.84PAS domain containing serine/threonine kinase [Sou... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm71684.623e-1228.57predicted gene 7168 [Source:MGI Symbol;Acc:MGI:364... [more]
Pim22.085e-1125.89proviral integration site 2 [Source:MGI Symbol;Acc... [more]
Pim22.157e-1125.89proviral integration site 2 [Source:MGI Symbol;Acc... [more]
Mark17.192e-1130.56MAP/microtubule affinity regulating kinase 1 [Sour... [more]
Snrk7.718e-1125.11SNF related kinase [Source:MGI Symbol;Acc:MGI:1081... [more]
back to top
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O44997|DAPK_CAEEL1.440e-1330.23Death-associated protein kinase dapk-1 OS=Caenorha... [more]
sp|Q9UTH3|PPK6_SCHPO1.444e-1229.84Serine/threonine-protein kinase ppk6 OS=Schizosacc... [more]
sp|Q9YHZ5|PIM2_DANRE7.334e-1226.53Serine/threonine-protein kinase pim-2 OS=Danio rer... [more]
sp|Q91822|PIM3_XENLA9.671e-1227.23Serine/threonine-protein kinase pim-3 OS=Xenopus l... [more]
sp|B4LDJ6|PLK4_DROVI1.086e-1130.05Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
back to top
BLAST of Protein kinase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S3QP302.382e-1528.51Serine/threonine-protein kinase pim-3-like protein... [more]
A0A210PDX52.635e-1529.27Serine/threonine-protein kinase pim-3 OS=Mizuhopec... [more]
A0A168H2B82.704e-1530.00Protein kinase domain-containing protein OS=Mucor ... [more]
A0A2P6K2E13.262e-1528.30Serine/threonine-protein kinase pim-3 OS=Nephila c... [more]
A0A4Y2U6S06.113e-1528.44Serine/threonine-protein kinase pim-3 OS=Araneus v... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030133.11.852e-1426.60serine/threonine-protein kinase pim-3-like [Source... [more]
PIM31.361e-1327.14Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM31.770e-1326.13Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pim32.425e-1327.36serine/threonine-protein kinase pim-3-like [Source... [more]
pim16.223e-1326.73serine/threonine-protein kinase pim-1-like [Source... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARK36.546e-1227.12microtubule affinity regulating kinase 3 [Source:H... [more]
MARK31.585e-1128.18microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000006410.16.387e-1129.10pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
snrka8.018e-1124.65SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ENSPMAT00000004636.11.047e-926.39pep scaffold:Pmarinus_7.0:GL478081:45741:54241:-1 ... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PSK16.653e-1029.78PAS domain-containing serine/threonine protein kin... [more]
PSK21.249e-925.00PAS-domain containing serine/threonine protein kin... [more]
HSL16.470e-831.08Nim1p-related protein kinase; septin-binding kinas... [more]
YPL150W_mRNA2.894e-729.29Protein kinase of unknown cellular role; binds pho... [more]
MKK12.942e-724.49MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468615.615e-1427.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365871.542e-1022.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307684.516e-1028.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379511.442e-926.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479612.399e-924.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041570.15.136e-1426.32pep primary_assembly:ASM223467v1:10:18938984:18940... [more]
ENSORLT00000010626.27.793e-1426.32pep primary_assembly:ASM223467v1:12:12000679:12006... [more]
ENSORLT00000032540.18.236e-1426.32serine/threonine-protein kinase pim-2-like [Source... [more]
pask1.417e-1228.91PAS domain containing serine/threonine kinase [Sou... [more]
pim32.358e-1226.13Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of Protein kinase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030308.12.877e-2232.98SMESG000030308.1[more]
SMESG000068606.11.744e-2132.52SMESG000068606.1[more]
SMESG000007586.12.395e-2028.50SMESG000007586.1[more]
SMESG000068530.11.582e-1932.04SMESG000068530.1[more]
SMESG000061809.11.275e-1728.16SMESG000061809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027580 ID=SMED30027580|Name=Protein kinase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1096bp
ATTTTCAAAATTACAAAATTATTAAACTTTTGAATCAAAGAGAAAATATT
TCATTTGTTTATTTGTGCTCGGAACTGAACGAAAATAATGAAACCGTAAT
AATTAAGCAAATAAATAAATTTCATAGACAAAATTTTGACAACGAAAATA
ATTCTTATGTTTCCAGAGTTAAAAGTTTTAAAATTGGTCCAAGGCTTGCA
AGGATTTCCGAAACTAATAAATTCTTTTGAAACATCAAATCATTCTTACA
TAGTGATGGAAAATCTGAGTGTCAATTATGTTGACCTCTTTGACTACGTA
TGTTCTCAGAAGAACAGAATAGATAGAAAAACGGCCTCATTAATAATCAA
ACAATTAATTATATGCATTCTCGATTTAATTAAATTAAACATATTTTATT
CCGATATCAAGTTGGATAATGTAATGTTAAGGAAAGATTTAAAGTCAATT
AAATTAATTGACTTTTCAGATGTCCATTTTGGATCACCGTGGACAACATA
CGCTGTAAGTACAATTGGGTACTTCAGTCCTGAATCTGTTAGAGGTAAAC
TCTTTGATATAACAAGAAGCGCAGTATTCTCAATAGGCTGTTTCACATAT
ACTCTAATAAAAGGAGATTACGCTTTCGACTCGATTGAGGAATTGCTTAG
TTTTATACCTCCAGTTGTTAGAACGGACAATATTATTAACGACTTTATTA
AAGTTACGTTGATAAAAAGTCTCTTAGATCGACCTAAATTGGAAGACTTA
TTACAACATCCATTTTTGTCATGATAAATTGGTACAGCTAATAGATTTAC
AGTCATGAAGGTAACAGGTTTAGCAGCTAAGACATGCTATAATATCATGA
CCAAGAAGGATAGCTCAACTATCACTTATTTTCAAATGTGCATTGTTTTA
ATGCACTAGATTCAATTTTACTAATACGATAAATATATTTTTATTATTCA
TATTATTGTTATCACTTAAATGTTGAAAATGTTTTAAACTAGGAGAAACC
TCCCCAAGTCCATGAGAATCTCTGTAAATGTCACTAGCAATGCCATTTGC
AATTCTGCTGTGCAGCAATCTGAAGTTGCATATGGCACAAACAACC
back to top

protein sequence of SMED30027580-orf-1

>SMED30027580-orf-1 ID=SMED30027580-orf-1|Name=SMED30027580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
MFPELKVLKLVQGLQGFPKLINSFETSNHSYIVMENLSVNYVDLFDYVCS
QKNRIDRKTASLIIKQLIICILDLIKLNIFYSDIKLDNVMLRKDLKSIKL
IDFSDVHFGSPWTTYAVSTIGYFSPESVRGKLFDITRSAVFSIGCFTYTL
IKGDYAFDSIEELLSFIPPVVRTDNIINDFIKVTLIKSLLDRPKLEDLLQ
HPFLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation