SMED30027578

Overview
NameSMED30027578
Smed IDSMED30027578
Length (bp)2857
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027578 (SMED30027578) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027578 (SMED30027578) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027578 (SMED30027578) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027578 (SMED30027578) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027578

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027578SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027578SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027578SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027578SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027578SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027578SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027578SMESG000072474.1 Contig39080newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027578SMESG000072474.1 Contig39080uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027578SMESG000072474.1 SMESG000072473.1 Contig53154newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027578SMESG000072474.1 SMESG000072473.1 Contig53154uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027578 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017375:6865..11661 -13874
v31.007222:13650..18390 +13822
Homology
BLAST of SMED30027578 vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 82.4185 bits (202), Expect = 2.472e-15
Identity = 112/432 (25.93%), Postives = 174/432 (40.28%), Query Frame = 2
Query: 1559 RAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2752
            R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  339 RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 742          

HSP 2 Score: 66.2402 bits (160), Expect = 2.240e-10
Identity = 66/225 (29.33%), Postives = 100/225 (44.44%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHA 2209
            K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H 
Sbjct:  523 KPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHT 744          

HSP 3 Score: 55.0694 bits (131), Expect = 7.684e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  215 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 602          
BLAST of SMED30027578 vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 82.4185 bits (202), Expect = 2.472e-15
Identity = 112/432 (25.93%), Postives = 174/432 (40.28%), Query Frame = 2
Query: 1559 RAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2752
            R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  339 RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 742          

HSP 2 Score: 66.2402 bits (160), Expect = 2.240e-10
Identity = 66/225 (29.33%), Postives = 100/225 (44.44%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHA 2209
            K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H 
Sbjct:  523 KPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHT 744          

HSP 3 Score: 55.0694 bits (131), Expect = 7.684e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  215 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 602          
BLAST of SMED30027578 vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 82.4185 bits (202), Expect = 2.655e-15
Identity = 112/432 (25.93%), Postives = 174/432 (40.28%), Query Frame = 2
Query: 1559 RAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2752
            R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  313 RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 716          

HSP 2 Score: 66.2402 bits (160), Expect = 2.444e-10
Identity = 85/310 (27.42%), Postives = 125/310 (40.32%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKH 2440
            K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H         P +  E   A R       H  +H G   Y  C E     S N  + +        K Y C+ C   F    +L  H
Sbjct:  497 KPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHTGEK-----PYSCKECGNAFRLQAELTRHHIVHTGEKPYK-CKECGKAFSVNSELTRHHRIHTGEKPYQCKECGKAFIRSDQLTLH 797          

HSP 3 Score: 55.0694 bits (131), Expect = 6.630e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  189 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 576          
BLAST of SMED30027578 vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 82.4185 bits (202), Expect = 2.655e-15
Identity = 112/432 (25.93%), Postives = 174/432 (40.28%), Query Frame = 2
Query: 1559 RAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2752
            R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  313 RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 716          

HSP 2 Score: 66.2402 bits (160), Expect = 2.444e-10
Identity = 85/310 (27.42%), Postives = 125/310 (40.32%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKH 2440
            K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H         P +  E   A R       H  +H G   Y  C E     S N  + +        K Y C+ C   F    +L  H
Sbjct:  497 KPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHTGEK-----PYSCKECGNAFRLQAELTRHHIVHTGEKPYK-CKECGKAFSVNSELTRHHRIHTGEKPYQCKECGKAFIRSDQLTLH 797          

HSP 3 Score: 55.0694 bits (131), Expect = 6.630e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  189 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 576          
BLAST of SMED30027578 vs. Ensembl Human
Match: ZNF624 (zinc finger protein 624 [Source:HGNC Symbol;Acc:HGNC:29254])

HSP 1 Score: 79.7221 bits (195), Expect = 1.702e-14
Identity = 110/423 (26.00%), Postives = 171/423 (40.43%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHI-SAVHFSLHEGHTKYGFCDEIVTDV--SDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT------SLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            K + C  C KT  + +   +H   H G +  KC +CG   +  + +  H + H K   Y C VCG+  +      +H  +    K   C EC  +F    +LARH  + H   +P  Y+C  C K       +S H +TH EE P QC  C +   N + +  H R H        N      R  +    H+   +  + + C  C K FN  A FT+H + H         P    E   A   +    VH  +H G   Y  C E       S ++ I++      K Y C  C   F  K  L  H       KP K T      + ++ +K+++      K   C+ C +  R     I H ++H +  + Y+C +C+K F N + L +H++ H      +C+ C + FTS+     H
Sbjct:  302 KPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPYQCNVCGKSFSQCARLNQHQRIQTGEKPYKCSECGKAFSDKSKLARH-QETHNGEKP--YKCDDCGKAFRNKSYLSVHQKTHTEEKPYQCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKAYRSNSSLIVHIRTHTGEKPYECNECGKAFNRIANFTEHQRIHTGEK-----PYKCNECGKAFINYSCLTVHHRMHTGEKPYK-CTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTVHQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYKCYDCGKSFRTKSYLIVHQRTH-TGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTH 714          

HSP 2 Score: 62.003 bits (149), Expect = 5.022e-9
Identity = 85/369 (23.04%), Postives = 138/369 (37.40%), Query Frame = 2
Query: 1655 HALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKL--NFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ 2689
            H   H G +  KC +CG   +  + +  H + H +   Y+C  CG     K +   H  +H   K   C +C+ +F  +V L  H  K H  ++P  Y+C  C K     S+   H RTH  E P +C  C +  +N S    H R H                  +  + + C  C K F   + F  H + H     F C      N      +   H++  H  +H G                       K Y C++C   F     L  H       KP          I   +   HQ++    +   C  C +  R +     H++ H +  + Y+C +C K F + +SL +H+++H++ +Q
Sbjct:  546 HHRMHTGEKPYKCTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTVHQRIHTGEKPYKCTDCERAFTKMVNLKEH-QKIHTGVKP--YKCYDCGKSFRTKSYLIVHQRTHTGEKPYKCNECEKAFTNTSQLTVHQRRH------------------TGEKPYKCNECGKVFTSNSGFNTHQRTHTGEKPFKC------NDCGKAFSQMVHVTE-HQKIHSG----------------------EKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPYTCKECGKGCITLSQLTLHQRIHTGERPYKCEECGKAFRTNSDFTVHLRMH-TGEKPYKCNECGKAFRSSSSLTVHQRIHQRETQ 863          

HSP 3 Score: 51.6026 bits (122), Expect = 7.937e-6
Identity = 61/230 (26.52%), Postives = 99/230 (43.04%), Query Frame = 2
Query: 2123 SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTD--VSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKL--NFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            +K + + C  C+K F+Y+++  QH + H +    PY   N      +   ++S  H  +H G   Y  C+E       S ++ ++     K K Y C +C   F     LN+H   +   KP K      +     K  RHQ+     K   C  C +  R    KS+LS HQ        YQC +C K F N     +H+++H      RC+ C + + S+  L+ H++
Sbjct:  271 NKEKPYKCSTCEKAFHYRSLLIQHQRTHTKEK--PY-ECNECGKTFSQPSYLSQ-HKKIHTGEKPYK-CNECGKAFIASSSLMVHQRIHTKEKPYQCNVCGKSFSQCARLNQHQRIQTGEKPYKCSECGKAFSDKSKLARHQETHNGEKPYKCDDCGKAFR---NKSYLSVHQKTHTEEKPYQCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKAYRSNSSLIVHIR 492          
BLAST of SMED30027578 vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0335473)

HSP 1 Score: 70.4774 bits (171), Expect = 5.636e-12
Identity = 103/440 (23.41%), Postives = 168/440 (38.18%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDC-GLVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGR----DRTITPR-HLI------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTD---VSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2770
            K F C  C +     ++  RH   H+G     C  C  +  N   +  HMK H     + C +C +  A KE+ + H   H       C  C  +F     +  H+ K   Q     ++C  C K       +++H+R+H  E P +CE C +  S    +  HI +H    +  R     +T T + HL+      +      C  C KTF  K     H + H   +   C YC           +EH++  H   H G + +   +C +  T    +++++ ++   + + CE C+  F  K  LN H  +     P           +K  LI  M +       F   +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  247 KPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGQT---PHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYC-----TKTFTRKEHLTN-HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF---TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 674          
BLAST of SMED30027578 vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0335474)

HSP 1 Score: 65.855 bits (159), Expect = 1.815e-10
Identity = 100/429 (23.31%), Postives = 156/429 (36.36%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDC-GLVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTD---VSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2770
            K F C  C +     ++  RH   H+G     C  C  +  N   +  HMK H     + C +C +  A KE+ + H   H       C  C  +F     +  H+ K H    P  + C FC K      H   H+R H  E+P +C  C +  +       HIR H                  +    F C  C K F  K     H + H   +   C YC           +EH++  H   H G + +   +C +  T    +++++ ++   + + CE C+  F  K  LN H  +     P           +K  LI  M +       F   +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  247 KPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETP--HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH------------------TGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYC-----TKTFTRKEHLTN-HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF---TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 645          
BLAST of SMED30027578 vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0080263)

HSP 1 Score: 65.0846 bits (157), Expect = 2.655e-10
Identity = 92/388 (23.71%), Postives = 145/388 (37.37%), Query Frame = 2
Query: 1682 KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVT---DVSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2770
            +C  CG     K  + +HM+SH     + CE+CG+  + KE+   HI  H     + C  C  +F     L  H+ + H    P  + C +C K      H   H+R H  E P +C  C +  +       H+R H   S                     C  C KTF  K   T H + H   +   C YC     +     +EH++  H  LH G + +   +C +  T    +++++  + S   + C +C  PF  K  L  H +R H                        +  +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  184 QCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHV-RQHTGESP--HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESP------------------HKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYC-----KKTFTRKEHLTN-HVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCH---------------------TGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 523          
BLAST of SMED30027578 vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0080260)

HSP 1 Score: 63.1586 bits (152), Expect = 9.894e-10
Identity = 97/429 (22.61%), Postives = 157/429 (36.60%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDC-GLVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA----ISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTD---VSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2770
            K F C  C +     ++  RH   H+G     C  C  +  N   +  HMK H     + C +C +  A KE+ + H   H       C  C  +F     +  H+ K H    P  + C  CKK        ++H++    E P +C+ C++  +       H+R H   S                     C  C KTF  K     H + H   +   C YC           +EH++  H   H G + +   +C +  T    +++++ ++   + + CE C+  F  K  LN H  +     P           +K  LI  M +       F   +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  247 KPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETP--HRCDICKKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESP------------------HRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYC-----TKTFTRKEHLTN-HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF---TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 645          
BLAST of SMED30027578 vs. Ensembl Fly
Match: Meics (gene:FBgn0025874 transcript:FBtr0333030)

HSP 1 Score: 62.3882 bits (150), Expect = 1.340e-9
Identity = 84/342 (24.56%), Postives = 135/342 (39.47%), Query Frame = 2
Query: 1685 CKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALR-EHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISH-MKSHLSSHQI--YQCIKCQKKFFNPNSLVLHEQVH 2674
            C  CG     N ++ +H + H     + C +C +        + H+  H++ K + CP+CD +F     L  HI + H    P  Y+CP C +       +  H R H EE P +CE C +          H+R HN       DR             F C  C K+F  K+   +H + H+        P    E   A    H    H  +H G   Y  CD+     S N ++ K   ++ +    PF    +  K ++ +  L+  +KT       K  HQ        C  C  +  +   +  H++SH+I  + C +C + FF+  SL  H ++H
Sbjct:  262 CDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQR-HTGERP--YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHN------GDRQ------------FKCPDCDKSFFEKSNMMKHQRTHSGIK-----PFKCEECGQAFSHNHHLKSHLRIHTGEKPYK-CDQCGKGFSANQSLMKHTLWHVDNNDRPFKCS-QCPKAYDTQQSLRGHEKTHKNPDEPKTLHQ--------CPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKSLKKHLRLH 567          

HSP 2 Score: 58.5362 bits (140), Expect = 2.289e-8
Identity = 60/230 (26.09%), Postives = 96/230 (41.74%), Query Frame = 2
Query: 1610 CVTCNKTVRKR-NEKRHALTHLGNE--KCKDCGLVVNKN---KICSHM-KSHFKYICEVCGRIDAFKENHE--RHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ------FTCCPYCPI 2239
            C  C+KT   R N + H   H G    KC DC     KN   K+ S + K    + CE+CG+   F +N     H+ VH   ++  CP+CD SF     + +H  + H  I+P  ++C  C +   + +HHL++H      E P +C++C +  S   +   H  +                H+ +    F C  C K ++ +     H K H           CP+C +
Sbjct:  318 CPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGK--GFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKH-QRTHSGIKP--FKCEECGQAF-SHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLW----------------HVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDV 525          

HSP 3 Score: 52.373 bits (124), Expect = 1.858e-6
Identity = 49/189 (25.93%), Postives = 86/189 (45.50%), Query Frame = 2
Query: 1565 KYTITELNI--LIKTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNP--CPECDASFQYLVELARHITKAHRQIEPGK--YECPFCK---KIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNI 2074
            ++ IT L +    + F C  C+K+   K N  +H  TH G +  KC++CG   + N    H+KSH +       Y C+ CG+  +  ++  +H   H      P  C +C  ++     L  H  K H+  +  K  ++CP C     +   +  H+ +H+  P  C +C +   +  + K H+R HN+
Sbjct:  385 QHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHN---HHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGH-EKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKSLKKHLRLHNL 569          

HSP 4 Score: 50.447 bits (119), Expect = 8.190e-6
Identity = 80/323 (24.77%), Postives = 118/323 (36.53%), Query Frame = 2
Query: 1841 CPECDASFQYLVELARHITKAHRQIEPGK-YECPFCK---KIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKH---HNRRHKLK-PRKKTSLIIFMKKYRHQKL--NFKKVSCFACSRKIRIS-HMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2749
            C EC  S+     LARH+ K   Q +  K + C FC    +    ++ H R H  E P +C  C +  ++    K+H+  H+    KG                  C  C KTF  +     H + H       CP CP  +      L+     +H  LH+                      + + + CELC   F     L  H   HN   + K P    S        +HQ+     K   C  C +    + H+KSHL  H   + Y+C +C K F    SL+ H   H  ++ R   CS C + + +   L  H K
Sbjct:  230 CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHD--EEKGH----------------KCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCP-QTFAKNSGLK-----LHSRLHK----------------------EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEK 506          
BLAST of SMED30027578 vs. Ensembl Zebrafish
Match: drll.3 (draculin-like, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-060531-126])

HSP 1 Score: 93.2041 bits (230), Expect = 5.231e-19
Identity = 106/411 (25.79%), Postives = 167/411 (40.63%), Query Frame = 2
Query: 1610 CVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSD----NINI---YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2749
            C  C K+ R + E K+H   H G +  KC++CG     KN +  HMK H     Y C+ CG+   +K++ + H+ +H K     C EC  SF+  ++   H+T  H + +P  Y+C  C+K      H   H++ H  E P +CE C +        ++H+  H         R + P         ++C  C K F  K  + +H   H      PY      +  P   E    +H   H G   +  CD+     S     NI++      K Y C+ C + F +   L  H       KP       K  S  +F+K +       +  SC  C +    +  ++ H   H +   + C  C K +F    L  H  VH  S++R   CS+C++ F+    L  H K
Sbjct:  225 CDQCGKSFRSKGEVKQHMSIHTGLKPYKCEECGKFFAQKNNLQVHMKVHTGEKPYRCDQCGKCFPYKQSLKLHLEIHAKGNPYTCDECGKSFKTCLQFRSHMT-LHPEYKP--YKCDQCEKSYGREDHLQRHMKLHTGEKPHKCEHCGKSFPMRDLLRSHLMVH---------REVKP---------YTCDQCGKGFTLKKCYNEHMNIHTGER--PYTCDQCGKGFPY--EQSLNLHMRFHRGEKPF-TCDQCGQSFSQKGAYNIHMKIHTGEKPYTCDQCGMSFRHGSSLKLHMTHHTGEKPFHCDQCDKCYSTALFLKNHMKTHNKDQIYSCLTCGKTFNLLGCLRMHEKRHTLVKPFMCFDCGKCYFTDTELKQHLSVH--SNERPYMCSLCFKSFSRMDSLKKHEK 607          
BLAST of SMED30027578 vs. Ensembl Zebrafish
Match: znf1143 (zinc finger protein 1143 [Source:ZFIN;Acc:ZDB-GENE-131125-17])

HSP 1 Score: 86.6557 bits (213), Expect = 2.330e-17
Identity = 107/411 (26.03%), Postives = 163/411 (39.66%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKSKT----YYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            K F C  C K  R  ++ K+H   H G +   C  CG   +++ ++  HM  H     +IC  CG   + + + ++H+ +H   K   CP+C  SF++L   ++     H+ I  G+  Y C  C K     SH   H+RTH  E P  C +C    S  S+   H+  H                  +  + F+C  C K+F+  +  TQH K H       C +C      S   LR     VH +LH     Y    C++  T  S      KS T    Y C  C+  +    +L  H       KP K                      C  C ++   +  +KSH   H   ++Y+C +C K+F +  +L  HE++H       C  C Q FT   RL  H+ +
Sbjct:   64 KPFTCTQCGKNFRDSSQLKQHMRIHTGEKPFTCTQCGKSFSQSSQLNQHMMIHTGAKPFICSQCGASFSQQSSLKQHMRIHTGEKPFTCPQCGKSFRHLSNFSK-----HKMIHTGEKPYACSQCGKSFSHSSHRNRHMRTHTGEKPHTCTQCGTSFSEPSSLNQHMMIH------------------TGEKPFTCSQCGKSFSLSSRLTQHMKIHTGEKPHKCDHC------SKTFLRPSKLKVHLALHRSEKPYSCPVCEKSYTLESKLKRHQKSHTAVRQYMCFKCKKTYITATQLKLHERNHTGEKPFK----------------------CSHCDKRFSLLGSLKSHEKVHTGEKLYKCSQCSKRFSHLGTLKRHERIHTGEKPYTCDQCSQSFTYLERLKKHMNI 423          

HSP 2 Score: 55.4546 bits (132), Expect = 1.942e-7
Identity = 90/389 (23.14%), Postives = 149/389 (38.30%), Query Frame = 2
Query: 1685 CKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            CK CG    +K+ +  HM+ H     + C  CG+         +H+++H   K   C +C  +F+   +L +H+ + H   +P  + C  C K       ++ H+  H    P  C +C    S  S+ K H+R H                  +  + F+C  C K+F + + F++H   H   +   C  C  +   S    R      H   H G   +  C +  T  S+  ++ +        K + C  C   F     L +H       KP K           + L + +  +R +    K  SC  C +   +      H KSH +  Q Y C KC+K +     L LHE+ H      +CS C + F+    L +H K+
Sbjct:   12 CKLCGKTFKHKSHLNQHMRIHTGERPFSCTQCGKSFRDSSTFNKHMTIHTDEKPFTCTQCGKNFRDSSQLKQHM-RIHTGEKP--FTCTQCGKSFSQSSQLNQHMMIHTGAKPFICSQCGASFSQQSSLKQHMRIH------------------TGEKPFTCPQCGKSFRHLSNFSKHKMIHTGEKPYACSQCGKSFSHSSHRNR------HMRTHTGEKPHT-CTQCGTSFSEPSSLNQHMMIHTGEKPFTCSQCGKSFSLSSRLTQHMKIHTGEKPHKCDHCSKTFLRPSKLKVHLALHRSE----KPYSCPVCEKSYTLESKLKRHQKSHTAVRQ-YMCFKCKKTYITATQLKLHERNHTGEKPFKCSHCDKRFSLLGSLKSHEKV 367          
BLAST of SMED30027578 vs. Ensembl Zebrafish
Match: si:ch73-367f21.5 (si:ch73-367f21.5 [Source:ZFIN;Acc:ZDB-GENE-120214-29])

HSP 1 Score: 85.5001 bits (210), Expect = 9.143e-17
Identity = 119/431 (27.61%), Postives = 176/431 (40.84%), Query Frame = 2
Query: 1604 FFCVTCNK--TVRKRNEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN---------ILSSKGRDRTITPRHLISKSE-CFSCQICQKTFNYKAMFTQHYKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTD------VSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            F C  C+K  TV++  E  H   H G +   C  CG     K+ +  HM+ H     Y C+VCG+    K++ E+H+++H   K   CPEC  SF+    L  HI K H   +P  Y C  C K       +  H+R H  E P  C  C +        K H+R H             S   ++ +T    I   E  F C  C K F  K     H + H    ++T CP C   S     +L  HI +     H G   +  CD+          +  +I I+   K + C  C   F  K +L +H       KP            K SL I M+ +  +KL     +C  C +        ISHMK H +  + Y C++C K F    SL +H ++H   +   CS C + F    +L++H+++
Sbjct:   90 FTCPECDKCFTVKQSLET-HLKIHTGEKPFICPYCGKNFRIKHSLEGHMRIHTGEKPYPCQVCGKSFREKQSLEKHLTIHTGEKPYSCPECGKSFRVKNCLENHI-KIHTGEKP--YTCQECGKSFTEKQNLKRHMRIHTGEKPFTCSHCGKSFRVSKDLKIHVRIHTGEKPFSCQQCGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHTGEKRYT-CPQCG-KSYNEQKSLENHIRS-----HTGEKPFA-CDQCGKSFRQQRILKGHIRIHTGEKPFTCPQCGKSFIEKTKLERHKKIHSGEKPYTCHHCKKSFTMKQSLDIHMRIHTGEKL----YTCQQCGKSFALKQRLISHMKVH-TGEKPYTCLQCGKGFREKQSLDIHNRIHTGQNPFTCSQCGKSFRVKQKLVSHMRV 503          

HSP 2 Score: 66.2402 bits (160), Expect = 1.073e-10
Identity = 103/400 (25.75%), Postives = 158/400 (39.50%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPR-------------HLISKS--ECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEG-------HTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH 2674
            K + C  C K+ R K++ ++H   H G +   C +CG     KN + +H+K H     Y C+ CG+    K+N +RH+ +H   K   C  C  SF+   +L  H+ + H   +P  + C  C K       ++ H+R H  E P  C  C +        ++HIR H      G  R   P+             H+ S +  + F+C  C K+F  + +   H + H     FTC P C  + +E     R      H  +H G       H K  F  +   D+   I+  + K Y C+ C   F               LK R    LI  MK +  +K      +C  C +  R       H + H +    + C +C K F     LV H +VH
Sbjct:  144 KPYPCQVCGKSFREKQSLEKHLTIHTGEKPYSCPECGKSFRVKNCLENHIKIHTGEKPYTCQECGKSFTEKQNLKRHMRIHTGEKPFTCSHCGKSFRVSKDLKIHV-RIHTGEKP--FSCQQCGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHT-----GEKRYTCPQCGKSYNEQKSLENHIRSHTGEKPFACDQCGKSFRQQRILKGHIRIHTGEKPFTC-PQCGKSFIEKTKLER------HKKIHSGEKPYTCHHCKKSFTMKQSLDIHMRIHTGE-KLYTCQQCGKSFA--------------LKQR----LISHMKVHTGEK----PYTCLQCGKGFREKQSLDIHNRIH-TGQNPFTCSQCGKSFRVKQKLVSHMRVH 504          

HSP 3 Score: 57.3806 bits (137), Expect = 7.174e-8
Identity = 62/226 (27.43%), Postives = 99/226 (43.81%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVR-KRNEKRHALTHLGNEK--CKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-------ILSSKG-RDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2212
            K F C  C K  R K+N + H   H G ++  C  CG   N+ K + +H++SH     + C+ CG+    +   + HI +H   K   CP+C  SF    +L RH  K H   +P  Y C  CKK      ++  H+R H  E    C++C +  +      +H++ H        +   KG R++     H  + +    F+C  C K+F  K     H + H +
Sbjct:  284 KPFVCSHCGKRFRGKQNLESHIRLHTGEKRYTCPQCGKSYNEQKSLENHIRSHTGEKPFACDQCGKSFRQQRILKGHIRIHTGEKPFTCPQCGKSFIEKTKLERH-KKIHSGEKP--YTCHHCKKSFTMKQSLDIHMRIHTGEKLYTCQQCGKSFALKQRLISHMKVHTGEKPYTCLQCGKGFREKQSLDIHNRIHTGQNPFTCSQCGKSFRVKQKLVSHMRVHTE 506          

HSP 4 Score: 55.4546 bits (132), Expect = 2.336e-7
Identity = 85/372 (22.85%), Postives = 142/372 (38.17%), Query Frame = 2
Query: 1751 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN--------ILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSR-----KIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            + C+ CG I    ++HE H  +H   +   C EC  SF  +  L  H+ K H    P  + CP C K   +  ++  HL+ H  E P  C  C +      + + H+R H         +     R++    +HL   +  + +SC  C K+F  K     H K H   +   C  C  +  E     R      H  +H G   +     G    +  D+  ++ I+   K + C+ C   F    +L  H       KP          R K +L   ++ +  +    K+ +C  C +     K   +H++SH +  + + C +C K F     L  H ++H       C  C + F    +L  H K+
Sbjct:   34 FTCKQCGEIFTTNQSHECHTMIHNGEQTFICSECGKSFTQMRYLKNHM-KIHSGDHP--FTCPECDKCFTVKQSLETHLKIHTGEKPFICPYCGKNFRIKHSLEGHMRIHTGEKPYPCQVCGKSFREKQSLEKHLTIHTGEKPYSCPECGKSFRVKNCLENHIKIHTGEKPYTCQECGKSFTEKQNLKR------HMRIHTGEKPFTCSHCGKSFRVSKDLKIHVRIHTGEKPFSCQQCGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHTGE----KRYTCPQCGKSYNEQKSLENHIRSH-TGEKPFACDQCGKSFRQQRILKGHIRIHTGEKPFTCPQCGKSFIEKTKLERHKKI 391          
BLAST of SMED30027578 vs. Ensembl Zebrafish
Match: znf1057 (zinc finger protein 1057 [Source:ZFIN;Acc:ZDB-GENE-131120-158])

HSP 1 Score: 85.1149 bits (209), Expect = 1.214e-16
Identity = 105/411 (25.55%), Postives = 158/411 (38.44%), Query Frame = 2
Query: 1598 KTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSHQ---IYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            + F C  C K+     N   H   H G +   C  CG     K  +  HM+ H     Y CE CG+  + K+  + H+ +H   ++  C +C  SF +   LA H+ + H   +P  + C  C K  C    +  H+R H  E P  CE+C +  S   + K H+R H      G  +             F CQ C K+  +      H + H     F+C   C   S    P L       H  +H     Y  C++    +    ++Y         K Y C  C   FP+K  L KHH R H                        K  +C  C +     + +K+H++ H    ++ C +C K     +S+  H ++H EK   RCS C + F     L AHLK+
Sbjct:  136 RKFTCQECGKSFYHAGNLAAHMRIHTGEKPFSCNQCGKSFCQKPNLDVHMRVHTGEKPYTCEQCGKSFSQKQGFKAHMRIHTGERKFTCQQCGKSFYHAGNLAAHM-RIHTGEKP--FSCKQCGKSFCQKPNLEDHMRVHTGEKPYTCEQCGKSFSQKQSLKTHMRIHT-----GERK-------------FPCQQCGKSVYHAGNLAAHMRTHTGEKPFSC-KQC-RKSFSKKPNL-----IAHMRVHTREKLY-TCEQCGKSLGKKQDLYIHMRIHTGEKPYSCTECGKSFPHKSSL-KHHMRTH---------------------TGEKPFTCDQCGKSFSTKASLKNHMNGHTGTIVFTCDQCGKSLTRKDSIKNHMKIHSEKDHFRCSECGKGFKCKRSLSAHLKL 495          

HSP 2 Score: 61.2326 bits (147), Expect = 3.919e-9
Identity = 61/226 (26.99%), Postives = 103/226 (45.58%), Query Frame = 2
Query: 1598 KTFFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN---ILSSKGRDRTITPRHLI-------SKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2212
            K + C  C K+  +K++ K H   H G  K  C+ CG  V +   + +HM++H     + C+ C +  + K N   H+ VH + K   C +C  S     +L  H+ + H   +P  Y C  C K      ++ HH+RTH  E P  C++C +  S  ++ K H+  H    + +     +++T +  I       S+ + F C  C K F  K   + H K H++
Sbjct:  276 KPYTCEQCGKSFSQKQSLKTHMRIHTGERKFPCQQCGKSVYHAGNLAAHMRTHTGEKPFSCKQCRKSFSKKPNLIAHMRVHTREKLYTCEQCGKSLGKKQDLYIHM-RIHTGEKP--YSCTECGKSFPHKSSLKHHMRTHTGEKPFTCDQCGKSFSTKASLKNHMNGHTGTIVFTCDQCGKSLTRKDSIKNHMKIHSEKDHFRCSECGKGFKCKRSLSAHLKLHSR 498          
BLAST of SMED30027578 vs. Ensembl Zebrafish
Match: znf1028 (zinc finger protein 1028 [Source:ZFIN;Acc:ZDB-GENE-131125-19])

HSP 1 Score: 84.3445 bits (207), Expect = 2.360e-16
Identity = 99/410 (24.15%), Postives = 162/410 (39.51%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPR-----KKTSLIIF-MKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            + F C  C K+ R+ ++  +H + H   +   C  CG        +  HM  H     +IC  CG+      +  +H+ VH   K   CP+C  SF+Y+    +     H+ I  G+  Y C  C K     SH   H+RTH  E P  C +C    S  S+   H+R H                  +  + F+C  C K+F+  +  TQH K H                 P   EH S    S               + +  ++++++S K Y C +C   +  + +L +H      ++       KKT +    +K +       K   C  C ++   +  +KSH   H   ++Y+C +C K+F +  +L  HE++H       C  C Q FT   RL  H+ +
Sbjct:  189 RPFTCTQCGKSFRETSQLNKHMMIHTDEKPFTCTKCGKSFKHELSVIKHMMIHTGAKPFICSQCGKSFRLSSSLNQHMRVHTGEKPFTCPQCGKSFRYVSNFTK-----HKMIHTGEKPYACSQCGKSFSHSSHRNRHMRTHTGEKPHTCTQCGTSFSEPSSLNQHMRIH------------------TGEKPFTCSQCGKSFSLSSRLTQHMKIHTG-------------EKPHKCEHCSKTFLS--------------ASQLKMHLSVHRSEKPYSCPVCEKSYTVESKLKRHQKSHTAVRQYMCFKCKKTYITATQLKLHERNHTGEKPFKCSHCDKRFSLLGSLKSHEKVHTGEKLYKCSQCSKRFSHLGTLKRHERIHTGEKPYTCDQCSQSFTYLERLKKHMNI 548          

HSP 2 Score: 60.4622 bits (145), Expect = 7.529e-9
Identity = 102/427 (23.89%), Postives = 167/427 (39.11%), Query Frame = 2
Query: 1610 CVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKI---VCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP---RHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            C  C K+ R K++ K H   H   +  KC  CG      + +  HM+ H     + C  CG+      +  +H+ +H   +   C +C+ SFQY   L +H+   H    P  + C  C K       ++ H+  H +E P  C +C +   +  +   H+  H      I S  G+   ++    +H+   +  + F+C  C K+F Y + FT+H   H   +   C  C  +   S    R      H   H G   +  C +  T  S+  ++ +        K + C  C   F     L +H       KP K           + L + +  +R +    K  SC  C +   +      H KSH +  Q Y C KC+K +     L LHE+ H      +CS C + F+    L +H K+
Sbjct:   81 CTQCGKSFRTKKSLKLHMRIHTRKKPFKCTQCGKSFQYSSSLNLHMRIHTGERPFTCTQCGKSFKHSSHLNQHMRIHTGERPFTCTQCEKSFQYTSNLNKHMM-IHTGERP--FTCTQCGKSFRETSQLNKHMMIHTDEKPFTCTKCGKSFKHELSVIKHMMIHTGAKPFICSQCGKSFRLSSSLNQHMRVHTGEKPFTCPQCGKSFRYVSNFTKHKMIHTGEKPYACSQCGKSFSHSSHRNR------HMRTHTGEKPHT-CTQCGTSFSEPSSLNQHMRIHTGEKPFTCSQCGKSFSLSSRLTQHMKIHTGEKPHKCEHCSKTFLSASQLKMHLSVHRSE----KPYSCPVCEKSYTVESKLKRHQKSHTAVRQ-YMCFKCKKTYITATQLKLHERNHTGEKPFKCSHCDKRFSLLGSLKSHEKV 492          

HSP 3 Score: 56.6102 bits (135), Expect = 1.309e-7
Identity = 78/352 (22.16%), Postives = 130/352 (36.93%), Query Frame = 2
Query: 1748 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-----RISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            +  C  CG+    K++ + H+ +H + K   C +C  SFQY   L  H+ + H    P  + C  C K     SH   H+R H  E P  C +C +       Y +++  H ++ +  R               F+C  C K+F   +   +H   H         P    +   + +  +S + H  +H G                      +K + C  C   F     LN+H       KP       K    +    K++      K  +C  C +       R  HM++H +  + + C +C   F  P+SL  H ++H       CS C + F+   RL  H+K+
Sbjct:   78 RLTCTQCGKSFRTKKSLKLHMRIHTRKKPFKCTQCGKSFQYSSSLNLHM-RIHTGERP--FTCTQCGKSFKHSSHLNQHMRIHTGERPFTCTQCEKSF----QYTSNLNKHMMIHTGERP--------------FTCTQCGKSFRETSQLNKHMMIHTDEK-----PFTCTKCGKSFKHELSVIKHMMIHTG----------------------AKPFICSQCGKSFRLSSSLNQHMRVHTGEKPFTCPQCGKSFRYVSNFTKHKMIHTGEKPYACSQCGKSFSHSSHRNRHMRTH-TGEKPHTCTQCGTSFSEPSSLNQHMRIHTGEKPFTCSQCGKSFSLSSRLTQHMKI 380          
BLAST of SMED30027578 vs. Ensembl Xenopus
Match: ENSXETT00000031570.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:100498644])

HSP 1 Score: 83.5741 bits (205), Expect = 6.836e-16
Identity = 95/381 (24.93%), Postives = 150/381 (39.37%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKSKT----YYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2674
            + F C  C KT   + N   H   H G +   C++CG   + K  +C H + H +   +IC  CG+  A K N + HI  H   K   C EC   F +   L RH+ + H+  +P  Y C  C +I    CA+  H + H  E+P  C  C ++ S   +  +H++ H     KG                F+C  C K F+ K+    HY+ H+        P   +E   A  +  +   H+ +H G   +    C    +  S  ++ YK  T    + C  C   F +K +L  H       KP                       +C  C ++    S +K H   H   + + C  C KKF   ++L  H+++H
Sbjct:  252 RPFMCTECGKTFSDQSNLSAHHKIHRGEKPFSCRECGKSFSHKGNLCRHQEVHIQAKQFICTECGKTFAHKSNFKTHIKTHSAEKLFSCTECGKMFAHKAVLGRHL-EIHKPRKP--YPCAVCGRIFTGKCALLTHQKLHNGESPFSCIECGKIFSAKHSLLSHLKSHT--GEKG----------------FTCTQCGKEFSRKSTLQSHYRIHSGEK-----PFTCMECGKAFSQKSNLQTHYKIHTGEKPFTCMECGRTFSQKSTLLSHYKMHTGERPFSCTECGKSFSHKNKLTLHQKIHTGEKP----------------------FACTECGKRFPEKSKLKIHWKIHTREKPFSCTDCGKKFSRESNLYFHQKMH 584          

HSP 2 Score: 67.0106 bits (162), Expect = 9.333e-11
Identity = 100/410 (24.39%), Postives = 144/410 (35.12%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            L+   K F C  C K   +K N  RH   H G     C +CG    +++ + +H K H     + C  CG+  + K N  RH  VH +AK+  C EC  +F +      HI K H   +   + C  C K+      +  HL  H+   P  C  C ++ +   A   H + HN  S                   FSC  C K F+ K     H K H     FTC       S       R+     H+ +H G                       K + C  C   F  K  L  H+      KP                       +C  C R        +SH K H +  + + C +C K F + N L LH+++H       C+ C + F    +L  H K+
Sbjct:  219 LHTGEKPFTCTECGKRFSQKGNLYRHQTMHTGERPFMCTECGKTFSDQSNLSAHHKIHRGEKPFSCRECGKSFSHKGNLCRHQEVHIQAKQFICTECGKTFAHKSNFKTHI-KTHSAEK--LFSCTECGKMFAHKAVLGRHLEIHKPRKPYPCAVCGRIFTGKCALLTHQKLHNGESP------------------FSCIECGKIFSAKHSLLSHLKSHTGEKGFTCTQCGKEFS-------RKSTLQSHYRIHSG----------------------EKPFTCMECGKAFSQKSNLQTHYKIHTGEKP----------------------FTCMECGRTFSQKSTLLSHYKMH-TGERPFSCTECGKSFSHKNKLTLHQKIHTGEKPFACTECGKRFPEKSKLKIHWKI 555          

HSP 3 Score: 56.9954 bits (136), Expect = 1.346e-7
Identity = 78/309 (25.24%), Postives = 115/309 (37.22%), Query Frame = 2
Query: 1580 ELNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVS--DNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKP 2467
            E++I  K F C  C KT   K N K H  TH             +  K+         + C  CG++ A K    RH+ +H+  K  PC  C   F     L  H  K H    P  + C  C KI  A   +  HL++H  E    C +C +  S  S  ++H R H                  S  + F+C  C K F+ K+    HYK H         P   +E      +  + + H+ +H G   +  C E     S  + + +++      K + C  C   FP K +L  H     + KP
Sbjct:  302 EVHIQAKQFICTECGKTFAHKSNFKTHIKTH-------------SAEKL---------FSCTECGKMFAHKAVLGRHLEIHKPRKPYPCAVCGRIFTGKCALLTH-QKLHNGESP--FSCIECGKIFSAKHSLLSHLKSHTGEKGFTCTQCGKEFSRKSTLQSHYRIH------------------SGEKPFTCMECGKAFSQKSNLQTHYKIHTGEK-----PFTCMECGRTFSQKSTLLSHYKMHTGERPFS-CTECGKSFSHKNKLTLHQKIHTGEKPFACTECGKRFPEKSKLKIHWKIHTREKP 561          

HSP 4 Score: 56.6102 bits (135), Expect = 1.741e-7
Identity = 91/378 (24.07%), Postives = 143/378 (37.83%), Query Frame = 2
Query: 1712 KNKICSHMKSHFKY---ICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAIS----HHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCH---AQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTD---VSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            K+++CS   SH      +    G+  +    H  H+ +H  AK  PC EC   F     L  H  K H   +P  + C  C K          H      E P  C  C +  S+ S   AH + H         R   P         FSC+ C K+F++K    +H + H    QF C  C     +       ++ H +   FS  E       C ++      +  ++ I+K  K Y C +C   F  K  L  H    +   P            K SL+  +K +  +    K  +C  C ++  R S ++SH    S  + + C++C K F   ++L  H ++H       C  C + F+    L++H KM
Sbjct:  154 KSRLCSQWGSHTGTNHSLAWKVGKKISKSNFHRLHVKIHSGAKLFPCTECGKQFSLRSNLLVH-HKLHTGEKP--FTCTECGKRFSQKGNLYRHQTMHTGERPFMCTECGKTFSDQSNLSAHHKIH---------RGEKP---------FSCRECGKSFSHKGNLCRHQEVHIQAKQFICTECGKTFAHKSNFKTHIKTHSAEKLFSCTE-------CGKMFAHKAVLGRHLEIHKPRKPYPCAVCGRIFTGKCALLTHQKLHNGESPFSCIECGKIFSAKHSLLSHLKSHTGE----KGFTCTQCGKEFSRKSTLQSHYRIHSGEKPFTCMECGKAFSQKSNLQTHYKIHTGEKPFTCMECGRTFSQKSTLLSHYKM 499          
BLAST of SMED30027578 vs. Ensembl Xenopus
Match: abraxas1 (abraxas 1, BRCA1 A complex subunit [Source:Xenbase;Acc:XB-GENE-5730310])

HSP 1 Score: 82.0333 bits (201), Expect = 1.873e-15
Identity = 116/438 (26.48%), Postives = 167/438 (38.13%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKR-NEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYC-PINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVS--DNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKL-KP----------RKKTSLIIFMKKYRHQKLNFKKVSCFAC--SRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRC 2797
            K F C  C K+   R N  RH  TH G +   C +CG   + ++ +  H ++H     Y C  CG+  +++ + + H   H   K   C EC  SF  L     H  + H   +P  Y C  C K   A S    H RTH  E P  C  C +  S  S  K H R H                  S  + FSC  C K F+Y++    H++ H     F+C  C  C P  S      L+E     H+  H G   Y     G C  I+  +S     +    K + C  C   F    +L  H  R H   KP             + L +  + +  +K  F    C  C   R     H ++H      Y C +C K F   +   +HE++H    Q  CS C ++F S    ++H + +H        SC+ C
Sbjct:   77 KPFSCSECGKSFPCRSNLDRHHRTHTGEKPFFCSECGKCFSCRSDLKKHCRTHTGEKPYSCSECGKCFSYRSHLKEHYRTHTGEKPFSCSECGKSFSSLYMCNVHQRRTHTGEKP--YSCSECGKCFAASSDLTVHHRTHTGERPFPCPDCGKCFSYRSHLKEHYRTH------------------SGEKPFSCSECGKCFSYRSHLNNHHRTHTGEKPFSCSECGKCFPYRSY-----LKE-----HYRTHTGEKPYSCSECGKCFAILYSLSVHQRRSHTGEKPFSCSDCEKCFAASSDLTSHRRRNHTGEKPFSCSICGKSFASSSELTVHGRTHTREKP-FSCSECGKCFSDRSCLKDHHRTHTGEKPFY-CSECGKCFATSSQRTVHERIHTGEKQFPCSECGKYFGSSSERISHQRRYHTEKPFKCYSCTDC 482          

HSP 2 Score: 51.9878 bits (123), Expect = 3.783e-6
Identity = 86/363 (23.69%), Postives = 136/363 (37.47%), Query Frame = 2
Query: 1751 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRT------ITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTS----LIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSH--------QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            ++C  C +    K   ++H  VH++ K   C EC  SF     L RH  + H   +P    EC  C      +  H RTH  E P  C  C +  S  S  K H R H        S  G+  +      +  R   +  + +SC  C K F   +  T H++ H      P+ P        + R H+   H+  H G   +     G C    + ++++   +   K + C  C   FP +  L +H+      KP   +       I      HQ+ +      F+CS   +     S L+SH        + + C  C K F + + L +H + H +     CS C + F+    L  H
Sbjct:   51 HLCNECHKHFTDKRKFDKHQRVHKREKPFSCSECGKSFPCRSNLDRHH-RTHTGEKPFFCSECGKCFSCRSDLKKHCRTHTGEKPYSCSECGKCFSYRSHLKEHYRTHTGEKPFSCSECGKSFSSLYMCNVHQRRTHTGEKPYSCSECGKCFAASSDLTVHHRTHTGER--PF-PCPDCGKCFSYRSHLKE-HYRTHSGEKPFSCSECGKCFSYRSHLNNHHRTHTGEKPFSCSECGKCFPYRSYLKEHYRTHTGEKPYSCSECGKCFAILYSLSVHQRRSHTGEKPFSCSDCEKCFAASSDLTSHRRRNHTGEKPFSCSICGKSFASSSELTVHGRTHTREKPFSCSECGKCFSDRSCLKDH 408          
BLAST of SMED30027578 vs. Ensembl Xenopus
Match: stk31 (serine/threonine kinase 31 [Source:Xenbase;Acc:XB-GENE-983236])

HSP 1 Score: 82.0333 bits (201), Expect = 3.607e-15
Identity = 113/431 (26.22%), Postives = 162/431 (37.59%), Query Frame = 2
Query: 1604 FFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN---------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSR 2794
             FC  C K VR ++    H   H G     C +CG     KN + +HMK H     + C  CG+    K++ E H+ +H   K   C EC   F     +  H+ K H   +P  + C  C K      +   HL+TH  E P  C  C +   +  A  AH + H            S +G+      RH+ +  + FSC+ C K FN K +   H   H   +   CP C   +L S  +L  H+                  +I T V         K + C  C I F  K  L  H       KP   T    S  +     RH ++    K  SC  C    R     + H+K H +    + C +C K F   +SL+ H  +H       C+ C + F     L+AH K   K   + S  C +
Sbjct:  421 LFCTECGKGVRSKSHLASHMKKHTGERPYTCSECGKGFAQKNNLDTHMKIHTGEKPFTCTECGKCFTQKKHLESHMKIHTGEKPFTCTECGKDFAQKSSILSHM-KTHTGEKP--FTCTECGKNFAHKNSFQSHLQTHTGEKPFTCTECGKGYFSRIALLAHQKCHTHGPFICTKCGKSFRGKSSLFHHRHVHNIHKTFSCKECGKCFNQKRLLIGHQNTHTGERNVTCPECG-KTLSSRRSLNTHL------------------KIHTGV---------KPFTCTECGIGFAEKNNLVSHMKTHTGEKPFTCTECGKSFTLKDSLTRHLRIHTGEKPYSCTECGANFRYKSSLLDHLKIH-TGEAPFICTECGKIFQQKSSLITHFNMHTGEKPFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGK 819          

HSP 2 Score: 78.9518 bits (193), Expect = 2.921e-14
Identity = 104/418 (24.88%), Postives = 151/418 (36.12%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCH---AQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNF------KKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            K F C  C K   +K   K H   H G +   C +CG     K  + SHMK H     Y C  CG+  A   N   H+ +H   K   C EC   F   + L  H+ K H   +P  + C  C K     C +  H++ H  E P  C  C +   +  +   H+  H  +                    F+C  C K F  ++    H K H    +F+C         E      +    A H  +H G     FC E    V    ++          + Y C  C   F  K  L+ H       KP   T       + +H + +       K  +C  C +        +SHMK+H +  + + C +C K F + NS   H Q H       C+ C + + S I L+AH K
Sbjct:  196 KPFTCTECGKGFTQKCYLKSHIKVHTGEKPFTCTECGKGFTQKCYLKSHMKKHTGERPYTCSECGKSFAHSNNLVTHMKIHTGEKPFTCTECGKGFAQKISLLSHM-KMHTGEKP--FSCTECGKGFTQKCYLKSHIKVHTGEKPLTCTECGKQFEHKESLLGHLNLHTGVKP------------------FTCSECGKGFARRSSLVSHMKLHKVEKEFSC--------TECGKKFAQQGGLAYHLKIHTGEKL--FCTECGKGVRSKSHLASHMKKHTGERPYTCSECGKGFAQKNNLDTHMKIHTGEKPFTCTECGKCFTQKKHLESHMKIHTGEKPFTCTECGKDFAQKSSILSHMKTH-TGEKPFTCTECGKNFAHKNSFQSHLQTHTGEKPFTCTECGKGYFSRIALLAHQK 581          

HSP 3 Score: 64.3142 bits (155), Expect = 8.231e-10
Identity = 75/276 (27.17%), Postives = 111/276 (40.22%), Query Frame = 2
Query: 1610 CVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH----NILSSKGRDRTITPRHLISKSEC----FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSK 2380
            C  C KT+  +R+   H   H G +   C +CG+    KN + SHMK+H     + C  CG+    K++  RH+ +H   K   C EC A+F+Y   L  H+ K H    P  + C  C KI     ++  H   H  E P  C  C +     S   AH + H       S++          +IS+       F C  C K    K   + H K H + T  PY      +S   L E    +H  +H G   +  C E     + ++ + K K
Sbjct:  646 CPECGKTLSSRRSLNTHLKIHTGVKPFTCTECGIGFAEKNNLVSHMKTHTGEKPFTCTECGKSFTLKDSLTRHLRIHTGEKPYSCTECGANFRYKSSLLDHL-KIHTGEAP--FICTECGKIFQQKSSLITHFNMHTGEKPFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSVDQETQIISQQNIRVKPFICTECGKHLTSKRSLSAHQKIHIRGT--PYTCTECGKSY--LIERSLLIHQRIHTGEKPF-TCTECGKGFTQSVGLQKHK 913          

HSP 4 Score: 62.7734 bits (151), Expect = 2.598e-9
Identity = 95/384 (24.74%), Postives = 141/384 (36.72%), Query Frame = 2
Query: 1682 KCKDCG-LVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQK-----LNF----KKVSCFACSRKI-RISHMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLK 2749
            +C  CG   V++  + +H KSH     + C+ CG+    K N   H  VH K K   C EC   F     L  H  K H         CP C K +    ++  HL+ H  E P  C  C +  +     K+HI+ H                  +  + F+C  C K F  K     H K H      PY      +S       ++  H  +H G   +  C E     +  I++          K + C  C   F  K  L  H       KP   T      K++ H++     LN     K  +C  C +   R S + SH+  H++   + C +C KKF     L  H ++H      C+ C +   S   L +H+K
Sbjct:   87 ECTKCGKGYVSRIALLTHQKSHTVGKPFTCKKCGKSFHRKANLLCHQRVHSKKKPFTCNECGKRFSQKSLLVNH-QKTHTGER--NVTCPECGKTLSSSGSLHTHLKIHTGEKPFTCTECGKGFTQKCYLKSHIKVH------------------TGEKPFTCTECGKGFTQKCYLKSHMKKHTGER--PYTCSECGKSFAHSNNLVT--HMKIHTGEKPF-TCTECGKGFAQKISLLSHMKMHTGEKPFSCTECGKGFTQKCYLKSHIKVHTGEKPLTCTEC---GKQFEHKESLLGHLNLHTGVKPFTCSECGKGFARRSSLVSHMKLHKVEKEFSCTECGKKFAQQGGLAYHLKIHTGEKLFCTECGKGVRSKSHLASHMK 441          

HSP 5 Score: 62.3882 bits (150), Expect = 4.045e-9
Identity = 96/413 (23.24%), Postives = 152/413 (36.80%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMK--SHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCA---ISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIY----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            K F C  C K    +N  + H  TH G +   C +CG    ++  + +H K  +H  +IC  CG+    K +   H  VH   K   C EC   F       + +   H+    G+    CP C K + +   ++ HL+ H    P  C  C    +  +   +H++ H                  +  + F+C  C K+F  K   T+H + H         P +  E     R   S + H  +H G   +    C +I    S  I  +      K + C  C   F  K  L  H     K +    T    S+    +    Q +  K   C  C + +     K  LS+HQ        Y C +C K +    SL++H+++H       C+ C + FT  + L  H
Sbjct:  531 KPFTCTECGKNFAHKNSFQSHLQTHTGEKPFTCTECGKGYFSRIALLAHQKCHTHGPFICTKCGKSFRGKSSLFHHRHVHNIHKTFSCKECGKCFN-----QKRLLIGHQNTHTGERNVTCPECGKTLSSRRSLNTHLKIHTGVKPFTCTECGIGFAEKNNLVSHMKTH------------------TGEKPFTCTECGKSFTLKDSLTRHLRIHTGEK-----PYSCTECGANFRYKSSLLDHLKIHTGEAPFICTECGKIFQQKSSLITHFNMHTGEKPFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSVDQETQIISQQNIRVKPFICTECGKHLT---SKRSLSAHQKIHIRGTPYTCTECGKSYLIERSLLIHQRIHTGEKPFTCTECGKGFTQSVGLQKH 912          
BLAST of SMED30027578 vs. Ensembl Xenopus
Match: ENSXETT00000024787.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:105945142])

HSP 1 Score: 79.337 bits (194), Expect = 1.454e-14
Identity = 109/430 (25.35%), Postives = 162/430 (37.67%), Query Frame = 2
Query: 1565 KYTIT---ELNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            KYT+    +++   K + C  C K   +K     H   H G++   C  CG    +KN + SH+K H     Y C  CG+  A K N   H+ +H   KR  C EC   F    +L  H+ K H   +P  + C  C K     S    H++ H  E P  C  C +  +      +H+  H                  +  + F+C  C K F YK     H K H         P    E      +  + V H  +H G   +  C E     +   N+          K + C  C   F  K  L  H       KP   K     F +KY    H K+    K  +C  C +        +SHMK H +  + + C +C K F   N+LV H ++H       C+ C + F    +L++H+K+
Sbjct:  140 KYTLVSHMKIHTGEKPYTCSECGKGFAQKYTLVSHMKIHTGDKPYTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMKLHTGEKRFTCTECGKGFARKSDLVSHM-KLHTGEKP--FTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIH------------------TGEKPFTCTECDKGFAYKNNLVSHMKIHTGEN-----PFTCTECGKGFTKKNNLVSHMKIHTGEKPF-TCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIH-TGEKPFTCTECGKGFALKNNLVSHIRIHTGEKPFTCTECGKGFAKKNQLVSHMKI 541          

HSP 2 Score: 76.6406 bits (187), Expect = 1.078e-13
Identity = 108/433 (24.94%), Postives = 159/433 (36.72%), Query Frame = 2
Query: 1562 AKYTITELNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPAL-REHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
             K +    N   +   C  C +T   R  +  H + H G +   C +CG     K  + SHMK H     Y C  CG+  A K     H+ +H   K   C EC   F     L  H+ K H   +P  Y C  C K      ++  HL+ H  E P  C  C +  +  +   +H++ H      G  R             F+C  C K F  K+    H K H         P    E   A  R+     H  LH G   +       GF  + V  +  +++I+   K + C  C   F  K  L  H        P           KK +L+  MK +  +    K  +C  C +        +SHMK H +  + + C +C K F     LV H ++H       C  C + FT    L++H+K+
Sbjct:   58 GKTSPQNANTGERNITCAQCKETQSFRISRLTHFVIHTGEKPFTCTECGKGFTQKKSLVSHMKKHAGERPYTCSECGKGFAQKYTLVSHMKIHTGEKPYTCSECGKGFAQKYTLVSHM-KIHTGDKP--YTCSGCGKGFAHKNSLVSHLKIHTGEKPYTCSECGKGFARKNNLLSHMKLHT-----GEKR-------------FTCTECGKGFARKSDLVSHMKLHTGEK-----PFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKV--LVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHMKIHTGENPFTCTECGKGFTKKNNLVSHMKIHTGE----KPFTCTECGKGFAQKNNLLSHMKIH-TGEKPFTCTECGKDFTQKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKI 457          

HSP 3 Score: 75.8702 bits (185), Expect = 1.794e-13
Identity = 98/397 (24.69%), Postives = 153/397 (38.54%), Query Frame = 2
Query: 1580 ELNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITPRHLIS------KSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH 2674
            +L+   K F C  C K   RK +   H   H G +   C +CG     K+ + SHMK H     + C  CG+    K+    H+S+H   K   C ECD  F Y   L  H+ K H    P  + C  C K       +  H++ H  E P  C  C +  +  +   +H++ H        +  G+D T   +HL+S        + F+C+ C K F  K +   H K H     FTC  C          +  ++ H     F+  E    +   + +V+ +  +      K + C  C   F                   KK  L+  MK +  +K      +C  C +        +SH+K H +  + + C +C K F   N LV H ++H
Sbjct:  232 KLHTGEKRFTCTECGKGFARKSDLVSHMKLHTGEKPFTCTECGKAFARKSDLVSHMKLHTGEKPFTCTECGKGFTQKKVLVSHMSIHTGEKPFTCTECDKGFAYKNNLVSHM-KIHTGENP--FTCTECGKGFTKKNNLVSHMKIHTGEKPFTCTECGKGFAQKNNLLSHMKIHTGEKPFTCTECGKDFT-QKKHLVSHIKIHTGEKPFTCKECGKGFTQKYVLVSHIKIHTGEKPFTCSECGKGFTQKNHLVSHMKIHTGEKPFTCTECGKGFALKNNLVSHIRIHTG---EKPFTCTECGKGFA------------------KKNQLVSHMKIHTGEK----PFTCTECGKGFAHKNDLVSHLKIH-TGEKPFTCTECGKGFAKKNQLVSHMKIH 598          
BLAST of SMED30027578 vs. Ensembl Xenopus
Match: stk31 (serine/threonine kinase 31 [Source:Xenbase;Acc:XB-GENE-983236])

HSP 1 Score: 78.9518 bits (193), Expect = 2.770e-14
Identity = 103/415 (24.82%), Postives = 162/415 (39.04%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN----------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHL 2746
            K F C+ C K   RK++ + H   H G +   C +CG    +KN + SHMK+H     + C  CG+    K     H+ +H   +   C EC A+F+Y   L  H+ K H    P  + C  C KI     ++  H + H  E    C  C +     S   AH + H             S    ++ I+ ++++ K   F C  C K    K   + H K H + T  PY      +S   LRE    +H  +H G                       K + C  C   F  K    +H N+    KP       K+ + + ++  +    +  K   C  C +   ++  ++SH   H   + + C +C K F + NSLV H  +H       C+ C + F     L++HL
Sbjct:  533 KPFTCIECGKDFARKKHLESHMKIHTGEKPFTCTECGKGFAHKNNLVSHMKTHTGEKPFTCTECGKSFTHKHGFTIHLRIHTGERPYSCTECGANFRYKSSLLDHL-KIHTGEAP--FICTECGKIFQQKSSLITHFKMHTGEKQFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSIDQENQIISQQNILVKP--FICTECGKHLTSKKTLSAHQKIHIRGT--PYTCTECGKSY--LRERSLLIHQRIHTG----------------------EKPFTCTECGEGFHEKATFLRHQNKHTGEKPFSCTECGKRFAFLRYLTVHLRVHIGEKPFECKECGKGFTQLKFLRSHSRIHTGEKPFTCTECGKGFAHKNSLVSHLYIHTGEKPFTCTECGKGFAHKNNLVSHL 916          

HSP 2 Score: 72.0182 bits (175), Expect = 4.084e-12
Identity = 101/414 (24.40%), Postives = 156/414 (37.68%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNEKRHAL---THLGNEKCKDCGL-VVNKNKICSHMKSHF--KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYK----SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKLNFKKVSCFAC-----SRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            L+  +K F C  C K   KR+     +   T   N  C +CG     K+ + +H+K H   K IC  CG+    K     H+ +H   K   C EC  SF   + L  H+ K H   +P  + C  C K      H   H++ H  E P  C  C +  ++ +   +H++ H                  +  + F+C  C K+F +K  FT H + H         P +  E     R   S + H  +H G   +    C +I    S  I  +K     K + C  C   F  K  L  H     K +    T    S+    +    Q +  K   C  C     S+K   +H K H+     Y C +C K +    SL++H+++H       C+ C + F      + H
Sbjct:  417 LHTGVKPFTCSECGKGFAKRSSLVSHMKLHTEGKNFSCAECGKKFARKDCLVNHLKIHTGEKNICTECGKGICSKSQLASHMKIHTGEKPFTCSECGKSFAQRINLVTHM-KIHTGEKP--FTCIECGKDFARKKHLESHMKIHTGEKPFTCTECGKGFAHKNNLVSHMKTH------------------TGEKPFTCTECGKSFTHKHGFTIHLRIHTGER-----PYSCTECGANFRYKSSLLDHLKIHTGEAPFICTECGKIFQQKSSLITHFKMHTGEKQFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSIDQENQIISQQNILVKPFICTECGKHLTSKKTLSAHQKIHIRG-TPYTCTECGKSYLRERSLLIHQRIHTGEKPFTCTECGEGFHEKATFLRH 803          

HSP 3 Score: 68.5514 bits (166), Expect = 4.547e-11
Identity = 99/422 (23.46%), Postives = 154/422 (36.49%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSR 2794
            K F C  C K   ++   K H   H G +   C +CG    +KN + SHMK H     + C  CG+  A KE+   H+++H   K   C EC   F     L  H+ K H   E   + C  C K       + +HL+ H      C  C + + + S   +H++ H                  +  + F+C  C K+F  +     H K H      P+  I   +   A ++H+ + H  +H G   +  C E     +   N+          K + C  C   F +K     H       +P                       SC  C    R     + H+K H +    + C +C K F   +SL+ H ++H    Q  C+ C + F     L+AH K   K   + S  C +
Sbjct:  338 KPFTCTECGKGFTQKCYLKYHMKIHTGEKPFTCTECGKGYAHKNSLVSHMKIHTGEKPFTCTECGKQFARKESLLGHLNLHTGVKPFTCSECGKGFAKRSSLVSHM-KLH--TEGKNFSCAECGKKFARKDCLVNHLKIHTGEKNICTECGKGICSKSQLASHMKIH------------------TGEKPFTCSECGKSFAQRINLVTHMKIHTGEK--PFTCIECGKDF-ARKKHLES-HMKIHTGEKPF-TCTECGKGFAHKNNLVSHMKTHTGEKPFTCTECGKSFTHKHGFTIHLRIHTGERP----------------------YSCTECGANFRYKSSLLDHLKIH-TGEAPFICTECGKIFQQKSSLITHFKMHTGEKQFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGK 710          

HSP 4 Score: 60.8474 bits (146), Expect = 1.045e-8
Identity = 99/388 (25.52%), Postives = 140/388 (36.08%), Query Frame = 2
Query: 1682 KCKDCG-LVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCC----PYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            +C  CG   V++  + +H KSH     + C  CG+    K N   H  VH K K   C EC   F     L +H  K+H         CP C K +    ++  HL+ H  E P  C  C +  +  +   +H+  H                  +  + F+C  C K F  K     H K H     FTC      Y   NSL S           H  +H G                       K + C  C   F  K  L  H N    +KP           K++SL+  MK +   K NF   SC  C +K       ++H+K H     I  C +C K   + + L  H ++H       CS C + F   I L+ H+K+
Sbjct:  201 ECTKCGKGYVSRIALLTHQKSHTVGKPFTCTKCGKSFHRKANLLCHQRVHSKKKPFICNECGKRFSQKSFLVKH-QKSHTGER--NVTCPECGKTLSSSGSLHTHLKIHTGEKPFTCTECGKGFTQKNNLVSHMYIH------------------TGEKPFTCTECGKGFTQKCYLKYHMKIHTGEKPFTCTECGKGYAHKNSLVS-----------HMKIHTG----------------------EKPFTCTECGKQFARKESLLGHLNLHTGVKPFTCSECGKGFAKRSSLVSHMKLHTEGK-NF---SCAECGKKFARKDCLVNHLKIHTGEKNI--CTECGKGICSKSQLASHMKIHTGEKPFTCSECGKSFAQRINLVTHMKI 528          
BLAST of SMED30027578 vs. Ensembl Mouse
Match: Zfp28 (zinc finger protein 28 [Source:MGI Symbol;Acc:MGI:99175])

HSP 1 Score: 82.8037 bits (203), Expect = 1.429e-15
Identity = 89/357 (24.93%), Postives = 142/357 (39.78%), Query Frame = 2
Query: 1751 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDE---IVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            Y C  CG+  +   +  RH   H   K   CPEC  +F     L RH    H   +P  ++C  C K       ++ H R H  E P  CE C++     S+   H R H                  +  + + C+IC+K F++ A  TQH + H+        P    E   A R++I  A H+ +H G   +  G C +   I + ++ +  I+   K Y C++CR  F  K  L +H       KP       K  S    + +++      K   C  C +          H + H +  + Y+C++C K F   +SL+ H + H       CS C + F+    L  H ++
Sbjct:  405 YKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQNTSLVRHWRYYHTGEKP--FDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLTVHQRIH------------------TGEKPYECEICRKAFSHHASLTQHQRVHSGEK-----PFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCLECGKAFGDNSSCTQHRRLH-TGQRPYECVECGKTFKTKSSLICHRRCHTGEKPYECSACGKAFSHRQSLSVHQRI 735          

HSP 2 Score: 51.9878 bits (123), Expect = 4.491e-6
Identity = 99/420 (23.57%), Postives = 158/420 (37.62%), Query Frame = 2
Query: 1544 RTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFKYI--------CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNIL-----SSKGRDRTI-----TPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH 2674
            +T+   +  T+ + ++   K + C  C K     +   RH   H G +  +C +CG    +N   + +  H++Y         C  CG+  +      +H  +H   K   C  C  SF+Y   L       H++I  G+  YEC  C+K      +++ H R H  E P +C+ C +         +H R H           G+  +I     T + + +  + + C++C+K F  KA   QH K H         P    E   A  +    + H  +H G   Y  C E      DN +  +        + Y C  C   F                  + K+SLI     +R      K   C AC +    SH +S LS HQ        Y+C +C+K F     L  H++VH
Sbjct:  384 KTFTQSSSLTVHQRIHTGEKPYKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQN---TSLVRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLT-----VHQRIHTGEKPYECEICRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEK-----PYECKECGKAFSQTTHLIQHQRVHTGEKPYK-CLECGKAFGDNSSCTQHRRLHTGQRPYECVECGKTF------------------KTKSSLIC----HRRCHTGEKPYECSACGKAF--SHRQS-LSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVH 764          
BLAST of SMED30027578 vs. Ensembl Mouse
Match: Zfp26 (zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:99173])

HSP 1 Score: 81.2629 bits (199), Expect = 4.727e-15
Identity = 110/429 (25.64%), Postives = 169/429 (39.39%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLISK-------SECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDEIVTDVSDNI----NIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSC---FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLK 2749
            + + C  C K      +   H  TH G +  +CK C     +N  C  +K+HF+       Y C  CG+    +    +H+ +H   K   C EC  +F     L  HI + H   +P  +EC  C K +    ++  HLRTH  E P +C +C++  +  S  + H+R H        K   +T   R  ++K          + C+ C K F   A  T H K H+        P        + R   S   HF +H G   Y   +C +  T  S       N    K+Y C+ C   F     L  H       KP             + L + +K +  +K  F+   C   F CS  + + HM++H +  + +QCI C K F   + L +H ++H       C  C + FT H  L  HL+
Sbjct:  510 RPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTF-RNSSC--LKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHI-RIHTGEKP--FECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER-----PFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEK-PFQCTVCGKTFTCSSYLPV-HMRTH-TGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLR 924          

HSP 2 Score: 74.7146 bits (182), Expect = 4.569e-13
Identity = 93/386 (24.09%), Postives = 153/386 (39.64%), Query Frame = 2
Query: 1655 HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEK-SSQRCSICYQFFTSHIRLMAHLK 2749
            H  TH G +  +C  CG    ++  +  H+++H     Y C+VCG+  + +     H+  H   +  PC EC+ +F    +L  HI K H   +P  + C  C +       +  H R H    P +C  C +  +  S    H+  HN                    + + C+ C K F+  +   +H + H     F C  C     +S   +  LR H     F  ++       CD+  T  S  + I+       K Y C+ C   FP +  L KH       +P +        K+     ++F +++           H+K+H SS + +QC  C K F N +SL  H ++H      +CS C + FT+   L  HL+
Sbjct:  446 HLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHI-KTHTGEKP--FRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHN------------------GEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQ-------CDKTFTR-SSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYE-------CKECGKGFISFAQLTV----------HIKTH-SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLR 784          

HSP 3 Score: 65.855 bits (159), Expect = 2.673e-10
Identity = 93/380 (24.47%), Postives = 151/380 (39.74%), Query Frame = 2
Query: 1730 HMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN--------ILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            HM+SH     Y C+ CG+    + +   H+  H + K   C EC  +F     L  H+ ++H   +P  Y+C  C     + S+   HLRTH  E P +C  C +  +  S    HIR H         +       R+    HL   +    + C  C+K F   A  T+H K H       C  C   +  +   L+      HF +H G   Y   +C +  T    ++ ++ I+   K Y C+ C   F     L +H       KP +           +SL+  ++ +  +    K   C  C +   R S+++ H+ +H   + Y+C +C K F   + L  H + H       C  C + F S  +L  H+K
Sbjct:  362 HMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHM-RSHTGEKP--YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVC-ARTFRNSSCLK-----THFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGE----KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIK 728          

HSP 4 Score: 61.6178 bits (148), Expect = 4.434e-9
Identity = 84/320 (26.25%), Postives = 113/320 (35.31%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK------------CHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP 2467
            K F C  C+KT  + +  R H  TH G +  +CK+CG    +   +  H+++H     Y C+ CG+          HI  H   +   C  C  SF+    L  H  + H  ++P  Y+C +C K   A   ++ HLR H  E    C+ C +  S  S   AHIR H     KG                F C  C K F   +    H K            C   FTC  Y P                VH   H G   +        F       V   I+    K Y C+ C   F     LNKH  +    KP
Sbjct:  650 KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHF-RIHTGVKP--YKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSH-----KGEKP-------------FECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTFTCSSYLP----------------VHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHT-GEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKP 931          
BLAST of SMED30027578 vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 76.6406 bits (187), Expect = 6.713e-14
Identity = 109/442 (24.66%), Postives = 177/442 (40.05%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKNKICS-HMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV-CAIS--HHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRT-----ITPRHLISKSECFSCQICQKTFNYKAMFTQH---------YKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQI-------YQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            +++  K   C  C K+  + +   +H   H G    KC++CG+      I S H + H     Y C+ CG+  +   N  +H  +H + K   C +C  +F     L +H  + H  ++P  Y+C  C K   C+ +  +H R H  E P +C  C +  + YS +  H R H+          G+  T     I  + + +  + ++C+ C K+FNY +   QH         YKC      F C  Y                   H  +H G   Y  C+      S +  ++K        K Y CE C   F N   L  H       KP K      +  +     +HQ+++ ++   + C    +   + S  S HQI       Y+C  C K F  P+ LV HE++H  +   +C +C + FTS   L  H ++
Sbjct:   41 IHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKH-QRIHTGMKP--YKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYL----------------VKHQRIHTGEKPYK-CEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQP-YKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRL 461          

HSP 2 Score: 63.1586 bits (152), Expect = 1.107e-9
Identity = 71/273 (26.01%), Postives = 113/273 (41.39%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKK---IVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPY-CPI--NSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI 2368
            K + C  C K+    +  K+H   H G +  KC+ CG   N  + +  H + H     Y CEVCG+  +F     +H  +H   KR  C EC  +F     L       HR++  G+  Y+C  C K   +  ++S H R H  E P +C+ C +  S +S +  H   H                  ++ + + C+ C KTF Y +   QH + H      PY C +   +  S   L+      H+ LH G   Y  C++      ++ N+
Sbjct:  242 KPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLI-----VHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMH------------------TREKPYKCKHCDKTFKYPSPLVQHERIHTGER--PYKCEVCGKAFTSSSNLK-----YHWRLHTGEKPYK-CEQCGKAFKNSSNV 483          

HSP 3 Score: 50.8322 bits (120), Expect = 8.151e-6
Identity = 80/346 (23.12%), Postives = 130/346 (37.57%), Query Frame = 2
Query: 1778 DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            D +    +  +++H  +K + C EC  SF     L +H  + H    P K  EC       C +S H R H  E P +C+ C +  S  S    H + H         R   P         + C  C K F+  +   +H + H         P    E   A     + + H  +H G   Y  G C +  T  S  +N  ++    K Y C+ C   F N + L +H       KP       K  +    +K+++      K   C  C +        + H + H +  + Y+C  C K F     L  H+++H    + RC  C + FT++  L+ H ++
Sbjct:   29 DLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQH-QRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIH---------REEKP---------YKCDDCGKAFSCSSYLYKHQRIHTGMK-----PYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIH-TGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV 349          
BLAST of SMED30027578 vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 76.6406 bits (187), Expect = 7.884e-14
Identity = 108/442 (24.43%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKNKICS-HMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRT-----ITPRHLISKSECFSCQICQKTFNYKAMFTQH---------YKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQI-------YQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            +++  K   C  C K+  + +   +H   H G    KC++CG+      I S H + H     Y C+ CG+  +   N  +H  +H + K   C +C  +F     L +H  + H  ++P  Y+C  C K       + +H R H  E P +C  C +  + YS +  H R H+          G+  T     I  + + +  + ++C+ C K+FNY +   QH         YKC      F C  Y                   H  +H G   Y  C+      S +  ++K        K Y CE C   F N   L  H       KP K      +  +     +HQ+++ ++   + C    +   + S  S HQI       Y+C  C K F  P+ LV HE++H  +   +C +C + FTS   L  H ++
Sbjct:   86 IHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKH-QRIHTGMKP--YKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYL----------------VKHQRIHTGEKPYK-CEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQP-YKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRL 506          

HSP 2 Score: 50.8322 bits (120), Expect = 8.444e-6
Identity = 80/346 (23.12%), Postives = 130/346 (37.57%), Query Frame = 2
Query: 1778 DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            D +    +  +++H  +K + C EC  SF     L +H  + H    P K  EC       C +S H R H  E P +C+ C +  S  S    H + H         R   P         + C  C K F+  +   +H + H         P    E   A     + + H  +H G   Y  G C +  T  S  +N  ++    K Y C+ C   F N + L +H       KP       K  +    +K+++      K   C  C +        + H + H +  + Y+C  C K F     L  H+++H    + RC  C + FT++  L+ H ++
Sbjct:   74 DLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQH-QRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIH---------REEKP---------YKCDDCGKAFSCSSYLYKHQRIHTGMK-----PYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIH-TGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV 394          
BLAST of SMED30027578 vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 76.2554 bits (186), Expect = 8.256e-14
Identity = 108/442 (24.43%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKNKICS-HMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRT-----ITPRHLISKSECFSCQICQKTFNYKAMFTQH---------YKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQI-------YQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            +++  K   C  C K+  + +   +H   H G    KC++CG+      I S H + H     Y C+ CG+  +   N  +H  +H + K   C +C  +F     L +H  + H  ++P  Y+C  C K       + +H R H  E P +C  C +  + YS +  H R H+          G+  T     I  + + +  + ++C+ C K+FNY +   QH         YKC      F C  Y                   H  +H G   Y  C+      S +  ++K        K Y CE C   F N   L  H       KP K      +  +     +HQ+++ ++   + C    +   + S  S HQI       Y+C  C K F  P+ LV HE++H  +   +C +C + FTS   L  H ++
Sbjct:   74 IHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKH-QRIHTGMKP--YKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYL----------------VKHQRIHTGEKPYK-CEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQP-YKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRL 494          

HSP 2 Score: 50.8322 bits (120), Expect = 8.265e-6
Identity = 80/346 (23.12%), Postives = 130/346 (37.57%), Query Frame = 2
Query: 1778 DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            D +    +  +++H  +K + C EC  SF     L +H  + H    P K  EC       C +S H R H  E P +C+ C +  S  S    H + H         R   P         + C  C K F+  +   +H + H         P    E   A     + + H  +H G   Y  G C +  T  S  +N  ++    K Y C+ C   F N + L +H       KP       K  +    +K+++      K   C  C +        + H + H +  + Y+C  C K F     L  H+++H    + RC  C + FT++  L+ H ++
Sbjct:   62 DLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQH-QRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIH---------REEKP---------YKCDDCGKAFSCSSYLYKHQRIHTGMK-----PYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIH-TGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV 382          
BLAST of SMED30027578 vs. UniProt/SwissProt
Match: sp|P10078|ZFP28_MOUSE (Zinc finger protein 28 OS=Mus musculus OX=10090 GN=Zfp28 PE=2 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 9.994e-15
Identity = 89/357 (24.93%), Postives = 142/357 (39.78%), Query Frame = 2
Query: 1751 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDE---IVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            Y C  CG+  +   +  RH   H   K   CPEC  +F     L RH    H   +P  ++C  C K       ++ H R H  E P  CE C++     S+   H R H                  +  + + C+IC+K F++ A  TQH + H+        P    E   A R++I  A H+ +H G   +  G C +   I + ++ +  I+   K Y C++CR  F  K  L +H       KP       K  S    + +++      K   C  C +          H + H +  + Y+C++C K F   +SL+ H + H       CS C + F+    L  H ++
Sbjct:  405 YKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQNTSLVRHWRYYHTGEKP--FDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLTVHQRIH------------------TGEKPYECEICRKAFSHHASLTQHQRVHSGEK-----PFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCLECGKAFGDNSSCTQHRRLH-TGQRPYECVECGKTFKTKSSLICHRRCHTGEKPYECSACGKAFSHRQSLSVHQRI 735          
BLAST of SMED30027578 vs. UniProt/SwissProt
Match: sp|Q86UE3|ZN546_HUMAN (Zinc finger protein 546 OS=Homo sapiens OX=9606 GN=ZNF546 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 1.187e-14
Identity = 112/432 (25.93%), Postives = 174/432 (40.28%), Query Frame = 2
Query: 1559 RAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2752
            R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  339 RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 742          

HSP 2 Score: 66.2402 bits (160), Expect = 1.076e-9
Identity = 66/225 (29.33%), Postives = 100/225 (44.44%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHA 2209
            K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H 
Sbjct:  523 KPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHT 744          

HSP 3 Score: 55.0694 bits (131), Expect = 3.690e-6
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  215 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 602          
BLAST of SMED30027578 vs. UniProt/SwissProt
Match: sp|P10076|ZFP26_MOUSE (Zinc finger protein 26 OS=Mus musculus OX=10090 GN=Zfp26 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.922e-14
Identity = 110/429 (25.64%), Postives = 169/429 (39.39%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLISK-------SECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDEIVTDVSDNI----NIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSC---FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLK 2749
            + + C  C K      +   H  TH G +  +CK C     +N  C  +K+HF+       Y C  CG+    +    +H+ +H   K   C EC  +F     L  HI + H   +P  +EC  C K +    ++  HLRTH  E P +C +C++  +  S  + H+R H        K   +T   R  ++K          + C+ C K F   A  T H K H+        P        + R   S   HF +H G   Y   +C +  T  S       N    K+Y C+ C   F     L  H       KP             + L + +K +  +K  F+   C   F CS  + + HM++H +  + +QCI C K F   + L +H ++H       C  C + FT H  L  HL+
Sbjct:  412 RPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTF-RNSSC--LKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHI-RIHTGEKP--FECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER-----PFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEK-PFQCTVCGKTFTCSSYLPV-HMRTH-TGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLR 826          

HSP 2 Score: 75.485 bits (184), Expect = 1.923e-12
Identity = 93/386 (24.09%), Postives = 153/386 (39.64%), Query Frame = 2
Query: 1655 HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEK-SSQRCSICYQFFTSHIRLMAHLK 2749
            H  TH G +  +C  CG    ++  +  H+++H     Y C+VCG+  + +     H+  H   +  PC EC+ +F    +L  HI K H   +P  + C  C +       +  H R H    P +C  C +  +  S    H+  HN                    + + C+ C K F+  +   +H + H     F C  C     +S   +  LR H     F  ++       CD+  T  S  + I+       K Y C+ C   FP +  L KH       +P +        K+     ++F +++           H+K+H SS + +QC  C K F N +SL  H ++H      +CS C + FT+   L  HL+
Sbjct:  348 HLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHI-KTHTGEKP--FRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHN------------------GEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQ-------CDKTFTR-SSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYE-------CKECGKGFISFAQLTV----------HIKTH-SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLR 686          

HSP 3 Score: 66.2402 bits (160), Expect = 1.327e-9
Identity = 93/380 (24.47%), Postives = 151/380 (39.74%), Query Frame = 2
Query: 1730 HMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN--------ILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            HM+SH     Y C+ CG+    + +   H+  H + K   C EC  +F     L  H+ ++H   +P  Y+C  C     + S+   HLRTH  E P +C  C +  +  S    HIR H         +       R+    HL   +    + C  C+K F   A  T+H K H       C  C   +  +   L+      HF +H G   Y   +C +  T    ++ ++ I+   K Y C+ C   F     L +H       KP +           +SL+  ++ +  +    K   C  C +   R S+++ H+ +H   + Y+C +C K F   + L  H + H       C  C + F S  +L  H+K
Sbjct:  264 HMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHM-RSHTGEKP--YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVC-ARTFRNSSCLK-----THFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGE----KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIK 630          

HSP 4 Score: 62.003 bits (149), Expect = 2.666e-8
Identity = 85/320 (26.56%), Postives = 112/320 (35.00%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK------------CHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP 2467
            K F C  C+KT  + +  R H  TH G +  +CK+CG    +   +  H+++H     Y C+ CG+          HI  H   +   C  C  SF+    L  H  + H  ++P  Y+C +C K   A S    HLR H  E    C+ C +  S  S   AHIR H     KG                F C  C K F   +    H K            C   FTC  Y P                VH   H G   +        F       V   I+    K Y C+ C   F     LNKH  +    KP
Sbjct:  552 KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHF-RIHTGVKP--YKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSH-----KGEKP-------------FECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTFTCSSYLP----------------VHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHT-GEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKP 833          
BLAST of SMED30027578 vs. UniProt/SwissProt
Match: sp|Q9N003|ZN425_MACFA (Zinc finger protein 425 (Fragment) OS=Macaca fascicularis OX=9541 GN=ZNF425 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 2.825e-14
Identity = 110/415 (26.51%), Postives = 164/415 (39.52%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVR-KRNEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHL 2746
            K F C  C++  R KR  K H   H G     C +CG   + K  + +H ++H +   + C+ CGR   +K   + HI VH   K   CPEC+ SF+    L     KAH     GK  ++CP C +      A+  H R H E+ P  C  C +  +  S    H R H+                  + + F C  C+KTF+ ++  TQH K H   T  P+       S    R H++  H  LH G   +  C E     S   ++          K + C  C   + ++ +L +H       KP      +K   L   +K +  Q    K  SC  C +          H++ H S  + +QC +C K +    SL +H   H      +C  C + F     L AHL
Sbjct:  317 KPFQCPQCDRCFRLKRGMKVHLSQHSGKRPFHCPECGRSFSRKAALKTHQRTHSEEKPFSCDECGRKFIYKIKLDEHIRVHTGEKPFSCPECNKSFRLKRSL-----KAHGLQHSGKRPFQCPECSRGFFWRNAMRAHQRLHSEQKPFPCAECGKRFTRPSKLACHTRVHD------------------RQKEFPCGECKKTFSQQSRLTQHLKVHN--TEKPFSCAECGRSF-RRRAHLTE-HTRLHSGEEPFQ-CPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRLHSGEKPYQCPECQKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHIRVH-SGEKPFQCPECDKSYCIRGSLKVHLYTHSGERPFQCPECGKGFLQKRSLKAHL 702          

HSP 2 Score: 68.5514 bits (166), Expect = 1.906e-10
Identity = 93/371 (25.07%), Postives = 147/371 (39.62%), Query Frame = 2
Query: 1748 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN------------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELC--RIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNF----KKVSCFACSRKI-RISHMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            ++ C  C +    K +   H  VH   +  PCPECD +F+Y   L +H+   HR   P  + C  C +     C ++ HLR H  E P QC +C++        K H+  H+              S K   +T    H  S+ + FSC  C + F YK    +H + H   +   CP C  +       L+  + A H   H G   +       GF           ++  + K + C  C  R   P+K   +   + R K  P  +       +    Q L      K  SC  C R   R +H+  H    S  + +QC +C K F    S+  H+++H ++    CS C + +T   +L  HL++
Sbjct:  234 RFQCSECEKSYFLKGSLVTHQVVHTGQRPYPCPECDKTFRYRANLKKHLC-LHRGERP--FCCGECGRAFVQQCELTEHLRLHSGEKPFQCPQCDRCFRLKRGMKVHLSQHSGKRPFHCPECGRSFSRKAALKTHQRTH--SEEKPFSCDECGRKFIYKIKLDEHIRVHTGEKPFSCPECNKSF-----RLKRSLKA-HGLQHSGKRPFQCPECSRGFFWRNAMRAHQRLHS-EQKPFPCAECGKRFTRPSKLACHTRVHDRQKEFPCGECKKTFSQQSRLTQHLKVHNTEKPFSCAECGRSFRRRAHLTEHTRLHSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRL 592          

HSP 3 Score: 59.3066 bits (142), Expect = 1.646e-7
Identity = 64/236 (27.12%), Postives = 95/236 (40.25%), Query Frame = 2
Query: 1541 SRTYDNRAKYTI-TELNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNEK--CKDCGLV-VNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2212
             R++  RA  T  T L+   + F C  C+K+   K + K H   H   +   C +CG    +++++  H++ H     Y C  C +    K N + H+  H   K   C  C  SF     L  HI + H   +P  ++CP C K  C   ++  HL TH  E P QC  C +      + KAH+  H                  S    FSC  C ++F Y      H   HA+
Sbjct:  521 GRSFRRRAHLTEHTRLHSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRLHSGEKPYQCPECQKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHI-RVHSGEKP--FQCPECDKSYCIRGSLKVHLYTHSGERPFQCPECGKGFLQKRSLKAHLCLH------------------SGERPFSCDECGRSFTYVGALKTHIAVHAK 735          
BLAST of SMED30027578 vs. UniProt/SwissProt
Match: sp|Q9P2J8|ZN624_HUMAN (Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3)

HSP 1 Score: 79.7221 bits (195), Expect = 8.173e-14
Identity = 110/423 (26.00%), Postives = 171/423 (40.43%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHI-SAVHFSLHEGHTKYGFCDEIVTDV--SDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT------SLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            K + C  C KT  + +   +H   H G +  KC +CG   +  + +  H + H K   Y C VCG+  +      +H  +    K   C EC  +F    +LARH  + H   +P  Y+C  C K       +S H +TH EE P QC  C +   N + +  H R H        N      R  +    H+   +  + + C  C K FN  A FT+H + H         P    E   A   +    VH  +H G   Y  C E       S ++ I++      K Y C  C   F  K  L  H       KP K T      + ++ +K+++      K   C+ C +  R     I H ++H +  + Y+C +C+K F N + L +H++ H      +C+ C + FTS+     H
Sbjct:  302 KPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPYQCNVCGKSFSQCARLNQHQRIQTGEKPYKCSECGKAFSDKSKLARH-QETHNGEKP--YKCDDCGKAFRNKSYLSVHQKTHTEEKPYQCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKAYRSNSSLIVHIRTHTGEKPYECNECGKAFNRIANFTEHQRIHTGEK-----PYKCNECGKAFINYSCLTVHHRMHTGEKPYK-CTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTVHQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYKCYDCGKSFRTKSYLIVHQRTH-TGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTH 714          

HSP 2 Score: 62.003 bits (149), Expect = 2.412e-8
Identity = 85/369 (23.04%), Postives = 138/369 (37.40%), Query Frame = 2
Query: 1655 HALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKL--NFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ 2689
            H   H G +  KC +CG   +  + +  H + H +   Y+C  CG     K +   H  +H   K   C +C+ +F  +V L  H  K H  ++P  Y+C  C K     S+   H RTH  E P +C  C +  +N S    H R H                  +  + + C  C K F   + F  H + H     F C      N      +   H++  H  +H G                       K Y C++C   F     L  H       KP          I   +   HQ++    +   C  C +  R +     H++ H +  + Y+C +C K F + +SL +H+++H++ +Q
Sbjct:  546 HHRMHTGEKPYKCTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTVHQRIHTGEKPYKCTDCERAFTKMVNLKEH-QKIHTGVKP--YKCYDCGKSFRTKSYLIVHQRTHTGEKPYKCNECEKAFTNTSQLTVHQRRH------------------TGEKPYKCNECGKVFTSNSGFNTHQRTHTGEKPFKC------NDCGKAFSQMVHVTE-HQKIHSG----------------------EKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPYTCKECGKGCITLSQLTLHQRIHTGERPYKCEECGKAFRTNSDFTVHLRMH-TGEKPYKCNECGKAFRSSSSLTVHQRIHQRETQ 863          
BLAST of SMED30027578 vs. TrEMBL
Match: A0A3Q2CME3 (Uncharacterized protein OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.370e-17
Identity = 108/425 (25.41%), Postives = 168/425 (39.53%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCP---INSLESIPALREHIS-------------------AVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSI 2701
            K F C TC K+ R++ E  +H  TH G +  +C  CG   + K  +  HM++H     Y C  CG+    + +   H+ +H   K   C  C  SF++  +L RH  + H   +P  + CP C +     C +S H R H+ E    CE C++     S Y+ H+R H                  +  + F C++C+K+F  +   T+H + H   + + C  C     NS   +  +R H                      VH   H G  K   C       SD+ ++ +        KTY CELC   F   ++L +H       KP           +KT+L   M+ +  +    K   C  C +  R       HM++H +  + Y+C  C K F   N L  H + H      CS 
Sbjct:  203 KPFSCPTCGKSFRRQPELTQHMRTHTGEKPFRCPICGKGFIQKTTLNYHMRTHTGEKPYGCGFCGKSFIQRSDLTCHLRIHTDEKPYCCELCSKSFRHSSDLTRH-RRTHTTGKP--FSCPTCGRAFSKQCKLSRHERIHDSEKTYSCESCDKSFRRRSDYERHLRTH------------------TGEKPFDCELCEKSFRQRGDLTRHMRTHTGEKTSVCKVCGKSFSNSSSMLRHMRTHTGEKPYICKVCGKLFGFGGHLTVHLRTHTGE-KPCSCKVCGRSFSDSSSMARHMRTHTGEKTYPCELCEKSFRQSWDLARHRRTHTGEKPFQCLACGKGFVQKTTLSYHMRTHTGE----KPFPCEICDKSFRQRNDLTRHMRTH-TGEKPYRCEMCDKSFRQSNELTRHVKTHTGEDLSCSA 600          

HSP 2 Score: 67.781 bits (164), Expect = 8.544e-8
Identity = 88/363 (24.24%), Postives = 144/363 (39.67%), Query Frame = 2
Query: 1712 KNKICSHMKSHFKYICEVCGRIDAFKENH--ERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCH--AQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKV--SCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            K KICS         CEVCG+   FK++     H+  H   K   CP C  SF+   EL +H+ + H   +P  + CP C K       +++H+RTH  E P  C  C +     S    H+R H                  +  + + C++C K+F + +  T+H + H   +   CP C     +     R      H  +H+    Y    CD+     SD     ++    K + CELC   F  + +L +H                  M+ +  +K +  KV    F+ S  + + HM++H +  + Y C  C K F     L +H + H       C +C + F+    +  H++
Sbjct:  173 KTKICS---------CEVCGK--CFKQHRYLNAHMMTHTAEKPFSCPTCGKSFRRQPELTQHM-RTHTGEKP--FRCPICGKGFIQKTTLNYHMRTHTGEKPYGCGFCGKSFIQRSDLTCHLRIH------------------TDEKPYCCELCSKSFRHSSDLTRHRRTHTTGKPFSCPTCGRAFSKQCKLSR------HERIHDSEKTYSCESCDKSFRRRSDYERHLRTHTGEKPFDCELCEKSFRQRGDLTRH------------------MRTHTGEKTSVCKVCGKSFSNSSSM-LRHMRTH-TGEKPYICKVCGKLFGFGGHLTVHLRTHTGEKPCSCKVCGRSFSDSSSMARHMR 477          
BLAST of SMED30027578 vs. TrEMBL
Match: A0A3B4U132 (Uncharacterized protein OS=Seriola dumerili OX=41447 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.615e-17
Identity = 111/415 (26.75%), Postives = 163/415 (39.28%), Query Frame = 2
Query: 1604 FFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            + C TC K   R    K H  TH G +   C+ CG  +  +K +  HM++H     Y C  CG+  + K +  +H   H   K   C  C   F     L  H+ + H   +P  Y C  C K     S    H+RTH  E P  C  C +  SN S    H R H                  +  + + C+ C K F   ++   H + H   +   C  C  +   S  +L      VH   H G   Y  C+      S+  ++ K        K Y C+ C   F NK +L+KH       KP       +K S I  +K +     N K   C  C + +R S     HMK+H +  + Y C  C KKF N ++L  H + H ++    C  C + FT+   L+ H++ 
Sbjct:  156 YSCDTCGKKFSRTSRLKNHLRTHTGEKPYFCETCGKSLRSSKGLVVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYSCEICGKGFTTRTVLLVHV-RIHTGEKP--YFCETCGKDFRTCSESLVHMRTHTGEKPYTCNTCGKKFSNKSDLSTHKRTH------------------TDEKPYCCEACGKGFRTSSVLLVHKRIHTGEKPYSCETCGKDFRTSYESL------VHMRTHTGEKPY-TCNTCGKKFSNKSDLSKHTRTHTGEKPYTCKTCGKKFTNKSDLSKHTRTHTGEKPYPCTTCGEKFSQISILKNHLRTHTNEKPYFCETCGKSLRSSKGLLIHMKTH-TREKPYTCTTCWKKFSNKSTLSKHTKTHIDQKLYFCETCGKGFTTRTLLLVHMRT 541          

HSP 2 Score: 71.2478 bits (173), Expect = 8.716e-9
Identity = 102/404 (25.25%), Postives = 160/404 (39.60%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRK-RNEKRHALTHLGNE--KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITPRHLI-----SKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFAC-----SRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH 2674
            K +FC TC K++R  +    H  TH G +   C  CG    NK+ +  H ++H     Y CE+CG+    +     H+ +H   K   C  C   F+   E   H+ + H   +P  Y C  C K       +S H RTH +E P  CE C +     S    H R H         + G+D   +   L+     +  + ++C  C K F+ K+  ++H + H     +TC       +       +  +S  H   H G   Y    C E  + +S   N  ++    K Y+CE C     +   L  H     + KP            K++L    K +  QKL F    C  C     +R + + HM++H +  + Y C  C K+F    +L  H  +H
Sbjct:  182 KPYFCETCGKSLRSSKGLVVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYSCEICGKGFTTRTVLLVHVRIHTGEKPYFCETCGKDFRTCSESLVHM-RTHTGEKP--YTCNTCGKKFSNKSDLSTHKRTHTDEKPYCCEACGKGFRTSSVLLVHKRIHTGEKPYSCETCGKDFRTSYESLVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYTC------KTCGKKFTNKSDLSK-HTRTHTGEKPYPCTTCGEKFSQISILKNHLRTHTNEKPYFCETCGKSLRSSKGLLIHMKTHTREKPYTCTTCWKKFSNKSTLSKHTKTHIDQKLYF----CETCGKGFTTRTLLLVHMRTH-TGEKPYPCDICGKRFSQKTNLARHVTIH 570          

HSP 3 Score: 61.6178 bits (148), Expect = 8.449e-6
Identity = 61/225 (27.11%), Postives = 91/225 (40.44%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH---NILSSKGRDRTITPRHLI-------SKSECFSCQICQKTFNYKAMFTQHYKCHA 2209
            K + C TC K  R   E   H  TH G +   C  CG    NK+ +  H ++H     Y C+ CG+    K +  +H   H   K  PC  C   F  +  L  H+ + H   +P  Y C  C K + +      H++TH  E P  C  C +  SN S    H + H    +   +   +  T R L+       +  + + C IC K F+ K    +H   H+
Sbjct:  350 KPYSCETCGKDFRTSYESLVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYTCKTCGKKFTNKSDLSKHTRTHTGEKPYPCTTCGEKFSQISILKNHL-RTHTNEKP--YFCETCGKSLRSSKGLLIHMKTHTREKPYTCTTCWKKFSNKSTLSKHTKTHIDQKLYFCETCGKGFTTRTLLLVHMRTHTGEKPYPCDICGKRFSQKTNLARHVTIHS 571          
BLAST of SMED30027578 vs. TrEMBL
Match: A0A5F9C3R0 (Uncharacterized protein OS=Oryctolagus cuniculus OX=9986 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.759e-17
Identity = 113/414 (27.29%), Postives = 174/414 (42.03%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTK----YGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSC--------FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            K + C  C K  R+R + K H   H G +   C+DCG V  + + + +H + H     + C+ CG+      + + H  VH   K   C  C   F++ + LA H  + H   +P  Y C  C K     S  L+ H+     E P +C  C +V S  S  ++H R H                  +  + +SC +C KTF++K+  T H++ HA   C  Y    +L ++P  R     VH +  + HT+     GF       V    +  + K Y CE C   F     L   H R H  KP        S         HQ+++  +  C        F CS  + I H + H +  ++Y+C +C K F  P+SL  H+ VH  + S  C +C + FT    L AH ++
Sbjct:  319 KPYKCDECGKGFRRRADLKIHCRIHTGEKPYHCEDCGQVFRQASNLLAHQRVHSGEKPFKCDACGKGFGRSSHLQAHQKVHTGEKPYRCEACGKGFKWSLNLAMH-QRVHTGEKP--YRCGECGKSFSQASS-LQLHQSVHTGEKPYRCGECGKVFSRSSQLRSHQRVH------------------TGEKPYSCAVCGKTFSWKSNLTIHHRIHAGDAC--YERGENLRALPVER----GVH-ATKKPHTREQCGQGFRRRSALSVHCKAHTAE-KPYPCEQCGRAFSQPAHLQD-HRRVHGEKPFTCDACGKSFGRNSHLQSHQRVHTGEKPCKCEDCGKGFTCSSNLYI-HQRVH-TGEKLYKCEECGKGFSRPSSLQAHQGVHTGEKSYMCIVCGKGFTLSSNLQAHQRV 699          
BLAST of SMED30027578 vs. TrEMBL
Match: A0A096MF06 (Uncharacterized protein OS=Poecilia formosa OX=48698 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.040e-17
Identity = 111/442 (25.11%), Postives = 173/442 (39.14%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCP--INSLESIPALREHIS-------------------AVHFSLHEGHTKY--GFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            KTF C TC KT  +K N   H   H G +   C  CG    NK+ + SHM+ H     + C  CG+      +   H+  H   K   C  C   F+    L  HI ++H   +P  + C  C+K       +S+H+R H+ E P  C+ C +  ++ S   +H+R H                  +  + FSC  C K+ + ++ FT H K H     FTCC      I        +++H                      +H   H G   +  G C +  +   D +N +       K + C+ C   F NK  L  H       KP          R ++SL I M+ +  +K      SC  C +          HM++H +  + + C+KC+K F    +L  H ++H       C IC + FT+   L  H++
Sbjct:  206 KTFSCPTCQKTFTQKSNLTTHLRIHTGKKPFSCVTCGKKFRNKSHLISHMRIHTGEKPFTCMTCGKSFTQIGHLGTHMKSHTGEKAFACTTCGKQFREKRGLTSHI-RSHTGDKP--FSCGTCRKGFFTKDGLSYHMRIHKGEKPFSCKSCEKTFTSRSCLASHMRTH------------------TDEKPFSCGTCGKSLSSRSHFTYHMKTHTGEKPFTCCTCGKRFIQKSHLATHMKDHTGEKLFTCGICGKGFSLKSCLTIHMRTHTGEKPFTCGTCGKCFS-TKDGLNSHMRIHTGEKPFSCKCCEKNFTNKTNLTFHMRSHTGEKPYACMTCGKSFRVRSSLTIHMRTHTGEK----PFSCMTCGKSFSARNCLTIHMRTH-TGERPFSCVKCEKSFREKGALTTHMKIHTGEKPFSCEICGKNFTNRKSLPVHMR 620          
BLAST of SMED30027578 vs. TrEMBL
Match: A0A3B3VYT7 (Uncharacterized protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 9.239e-17
Identity = 113/420 (26.90%), Postives = 176/420 (41.90%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRHLISKSE-CFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKL---NFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHL 2746
            K F C+TC K   +K N   H  TH G +   C+ CG     +  + SHM++H     + C VCG+    + N   H+  H   K   C  C  ++     L  HI ++H   +P  Y C  C K       +++H+RTH  E P  C+ C +  S+ S    H+R H        N+      D +   +H+ + ++  F C+ C K+F       +H   H     F+C   C   S  S  +L+ H S VH  +H+                        K + CELC   F N+  L +H       KP            K++LI  ++ +  +K    NF +VS    S+  R  H+++H +  + + C+ C KKF  P SL +H Q H       C  C + FT+  +L AH+
Sbjct:   84 KPFSCLTCGKGFTQKTNLIVHMRTHTGEKPHTCQLCGKSFRASGHLASHMRTHTGEKPFSCLVCGKGFTQQSNLTVHMRTHSGEKPYSCDVCGKAYSDKTYLNDHI-RSHTGEKP--YSCKVCGKSFSNRSPLTNHMRTHTGEKPYHCKTCGKAFSDCSNLAKHMRTHTGEKPYYCNVCGKASSDSSSMAKHMRTHTKKPFPCRSCDKSFRNSRDLVRHSTLHTGEKPFSC-GLC-GKSYPSRGSLKTH-SKVH--MHQ------------------------KPFVCELCAKTFTNRTNLVRHRRTHTGEKPFSCTACGKFFSDKSTLIRHVRSHTGEKPFSCNFCEVSFTDNSQLTR--HLRTH-TGEKPFSCVTCGKKFSKPYSLTMHFQTHTGEKPFSCQQCGKLFTARCKLTAHI 468          
BLAST of SMED30027578 vs. Ensembl Cavefish
Match: ENSAMXT00000011094.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000150.1:841156:842598:-1 gene:ENSAMXG00000010805.2 transcript:ENSAMXT00000011094.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.118e-14
Identity = 111/426 (26.06%), Postives = 169/426 (39.67%), Query Frame = 2
Query: 1598 KTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH---NILSSKGRDRT-ITPRHLI------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALR--EHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLK-----PRKKTSLIIFMKKYRHQKL--NFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            K F C  C K+  R+ N + H   H G +  +C DCG   N+ + +  H++ H     Y C  CG+   ++ N ++H  VH   K + C EC  SF+ L  L  H    HR   P  Y+C  C K       +  H R H  + P QC  C +  ++    + H R H   N+       +T     HL       +  + + C +C K+F  +     H + H         P +  E     R   H+  VH  +H G   Y     G     V ++ ++  I+   K + C +C   F     L K H R H  +     P  + S I       HQ++    K   C  C +  R + H+K H   H   + Y C +C K F +   L  H+ VH      +CS C + FT    L  H ++
Sbjct:   56 KQFQCSECGKSFNRQSNLQAHQRIHTGEKPFQCPDCGKTFNRQSNLQLHLRVHTGEKPYQCPDCGKSFTYQSNFQQHQRVHTGEKPHQCSECGKSFRSLGNLKGHQL-VHRGETP--YQCSVCGKSFNRQSNLQQHQRIHTGDKPHQCLECGKSFTHKCKLQEHQRIHTGENLYQCSDCGKTCFKKSHLEDHQRIHTGEKPYQCSVCGKSFALQTTLQIHQRVHTGEK-----PYHCSECGKGFRYAGHL-KVHQRVHTGEKPYHCPECGKSFNYVGNLKEHQRIHSGEKPFPCTVCGKSFRYLGHL-KEHRRVHTGEKPFQCPECEKSFIAKHSLQIHQRIHTGEKPYQCSECGKFFRCLDHLKGHQRVHTGEKPYYCSECGKSFSDLRVLTAHQHVHTGDKPYQCSTCGKSFTLKRSLQIHQRV 471          

HSP 2 Score: 66.2402 bits (160), Expect = 8.248e-11
Identity = 99/400 (24.75%), Postives = 153/400 (38.25%), Query Frame = 2
Query: 1757 CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKGRD----RTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPA------LREHIS-----------------------AVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH--EKSSQRCSICYQFFTSHIRLMAHLKMFHKM 2764
            C  CG     K + + H  VH   K+  C EC  SF     L     +AH++I  G+  ++CP C K     S+   HLR H  E P QC  C +  +  S ++ H R H        S  G+       +    L+ + E  + C +C K+FN ++   QH + H         P   LE   +      L+EH                           H  +H G   Y        F  +    +   ++    K Y+C  C   F     L  H       KP       K  + +  +K+++      K   C  C +  R + H+K H   H   + +QC +C+K F   +SL +H+++H  EK  Q CS C +FF    R + HLK   ++
Sbjct:   32 CSECGVSFITKSHLQVHQRVHTGEKQFQCSECGKSFNRQSNL-----QAHQRIHTGEKPFQCPDCGKTFNRQSNLQLHLRVHTGEKPYQCPDCGKSFTYQSNFQQHQRVHTGEKPHQCSECGKSFRSLGNLKGHQLVHRGETPYQCSVCGKSFNRQSNLQQHQRIHTGDK-----PHQCLECGKSFTHKCKLQEHQRIHTGENLYQCSDCGKTCFKKSHLEDHQRIHTGEKPYQCSVCGKSFALQTTLQIHQRVHT-GEKPYHCSECGKGFRYAGHLKVHQRVHTGEKPYHCPECGKSFNYVGNLKEHQRIHSGEKPFPCTVCGKSFRYLGHLKEHRRVHTGEKPFQCPECEKSFIAKHSLQIHQRIHTGEKPYQ-CSECGKFF----RCLDHLKGHQRV 415          

HSP 3 Score: 57.7658 bits (138), Expect = 3.546e-8
Identity = 62/231 (26.84%), Postives = 94/231 (40.69%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEKR-HALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRD----RTITP-RHLISKSECFSCQICQKTFNYKAMFTQHYKCHA 2209
            K + C  C K+   +   + H   H G +   C +CG      +   H+K H +       Y C  CG+   +  N + H  +H   K  PC  C  SF+YL  L     K HR++  G+  ++CP C+K   A  H L+ H+     E P QC  C +        K H R H        S  G+     R +T  +H+ +  + + C  C K+F  K     H + H 
Sbjct:  252 KPYQCSVCGKSFALQTTLQIHQRVHTGEKPYHCSECGKGF---RYAGHLKVHQRVHTGEKPYHCPECGKSFNYVGNLKEHQRIHSGEKPFPCTVCGKSFRYLGHL-----KEHRRVHTGEKPFQCPECEKSFIA-KHSLQIHQRIHTGEKPYQCSECGKFFRCLDHLKGHQRVHTGEKPYYCSECGKSFSDLRVLTAHQHVHTGDKPYQCSTCGKSFTLKRSLQIHQRVHT 473          
BLAST of SMED30027578 vs. Ensembl Cavefish
Match: ENSAMXT00000040057.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:111191523])

HSP 1 Score: 78.1814 bits (191), Expect = 1.753e-14
Identity = 109/427 (25.53%), Postives = 170/427 (39.81%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPG--KYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSD-------NINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLKM 2752
            ++   K + C  C KT R +N  + H   H G +   C DCG   N ++ + +H++ H     Y C VCG+  A   + + H  +H   K   C EC  SF     L RH     + I  G  +Y+C  C K    +S+   H R H  E P  C  C +  +  S  + H+R H                  +  + +SC  C K+F  +     H + H     F C P C           R+++   H   H G  +Y    C    TD+S+       +I +   K Y C  C   F  + +L KH +     KP       K  +  + ++ +       K  SC  C R        + H + H  S + Y CI+C + F  P++L  H+++H       CS C + F  H +L+AH + 
Sbjct:   83 VHTGAKPYTCSECGKTFRHQNHFQAHQRLHAGEKPFSCLDCGKTFNTQSNLQTHLRVHTGEKPYSCSVCGKSFAQHSSLKTHQLLHTGEKPFSCTECGKSFTQKSVLERH-----KLIHSGEKRYDCSECGKSFTDVSNFQTHQRLHTGEKPYSCLECGKRFNAQSHLQTHLRVH------------------TGEKPYSCSECGKSFAQQINLRNHQRIHTGEKPFPC-PDC------GKSFTRKYVLERHRLGHTGEKRYDCSECGMSFTDLSEFQSHRRLHIGL---KPYSCLECGKRFNTEDDLQKHLHVHTGEKPYPCTVCGKTFAQPVNLRNHLRIHTGEKPFSCSDCGRCFTSQSNLLQHQRVH--SGERYICIECGRSFTLPSNLRKHQRLHTGDKPFCCSECGKSFRQHCQLLAHQRT 474          

HSP 2 Score: 73.559 bits (179), Expect = 4.268e-13
Identity = 99/397 (24.94%), Postives = 156/397 (39.29%), Query Frame = 2
Query: 1682 KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI--------LSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKK--------TSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            +C DCG     ++ + +H   H     Y C  CG+  A   + +RH  VH  AK   C EC  +F++         +AH+++  G+  + C  C K     S+   HLR H  E P  C  C +  + +S+ K H   H                 +++  RH +  S  + + C  C K+F   + F  H + H      PY  +   +   A + H+   H  +H G   Y  C E     +  IN+          K + C  C   F  K+ L + H   H  + R          T L  F + +R   +  K  SC  C ++      ++ HL  H   + Y C  C K F  P +L  H ++H       CS C + FTS   L+ H ++
Sbjct:   35 QCSDCGKGFTTESGLKNHQLIHTGEKPYSCTECGKSFADNTSFKRHQLVHTGAKPYTCSECGKTFRHQNHF-----QAHQRLHAGEKPFSCLDCGKTFNTQSNLQTHLRVHTGEKPYSCSVCGKSFAQHSSLKTHQLLHTGEKPFSCTECGKSFTQKSVLERHKLIHSGEKRYDCSECGKSFTDVSNFQTHQRLHTGEK--PYSCLECGKRFNA-QSHLQ-THLRVHTGEKPYS-CSECGKSFAQQINLRNHQRIHTGEKPFPCPDCGKSFTRKYVLER-HRLGHTGEKRYDCSECGMSFTDLSEF-QSHRRLHIGLKPYSCLECGKRFNTEDDLQKHLHVHTGEKPYPCTVCGKTFAQPVNLRNHLRIHTGEKPFSCSDCGRCFTSQSNLLQHQRV 419          

HSP 3 Score: 53.9138 bits (128), Expect = 5.839e-7
Identity = 63/247 (25.51%), Postives = 99/247 (40.08%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFT-CCPYCP--INSLESIPALREHISAVHFSL 2299
            K F C  C K+  RK   +RH L H G ++  C +CG+   + ++  SH + H     Y C  CG+    +++ ++H+ VH   K  PC  C  +F   V L  H+ + H   +P  + C  C +   + S+   H R H      C  C +  +  S  + H R H                  +  + F C  C K+F        H + H +    CP C      L SI   +   + V F+L
Sbjct:  284 KPFPCPDCGKSFTRKYVLERHRLGHTGEKRYDCSECGMSFTDLSEFQSHRRLHIGLKPYSCLECGKRFNTEDDLQKHLHVHTGEKPYPCTVCGKTFAQPVNLRNHL-RIHTGEKP--FSCSDCGRCFTSQSNLLQHQRVHSGERYICIECGRSFTLPSNLRKHQRLH------------------TGDKPFCCSECGKSFRQHCQLLAHQRTHTEEKYICPVCGKSFKQLSSIETHKCTSNPVDFTL 509          
BLAST of SMED30027578 vs. Ensembl Cavefish
Match: ENSAMXT00000039103.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000052.1:2092417:2202492:1 gene:ENSAMXG00000040630.1 transcript:ENSAMXT00000039103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 4.549e-14
Identity = 100/431 (23.20%), Postives = 162/431 (37.59%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI------------LSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            ++   K + C  C K+  ++   + H   H G +  +C DCG   N+   + SH + H     Y C  CG+  + K N + H+ +H + K  PC EC  +F+    L +H  + H   +P  Y+C  C K      ++  H R H  E P QC  C +  +   + ++H R H               + +G  ++    H   K   + C  C K+FN +     H + H         P +  E     R      H  +H G   Y  C E      ++  + K        K Y+C +C+  F  +  L  H       KP        S         HQ++    K   C  C +      + ++H   H   + YQC+ C K F    +L  H ++H       C  C + FT    L  H ++
Sbjct:  206 IHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKH-QRVHTGEKP--YQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKP--YQCSDCGKSFNQQGSLQSHQRIHTGEK-----PYHCSECGLRFRHSFKLFHQRIHTGEKPYQ-CSECGRSFRESGALRKHDCVFLGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKPYQCLDCGKSFTQQGNLQKHLRIHTGEKPFHCEECGKSFTQQGNLQIHQRV 625          

HSP 2 Score: 67.3958 bits (163), Expect = 6.450e-11
Identity = 97/429 (22.61%), Postives = 165/429 (38.46%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRI--DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI------------LSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDEIVTDVSDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            K + C  C K+  ++   + H   H G +  +C DCG   N+   + SH + H     Y C  CG     +FK  H+R   +H   K   C EC  SF+    L +H       +    Y CP C+K   +   +  HLR H  E P  C  C +  + ++ ++AH R H               + +G  R     H   K   + C  C K+F  +    +H + H         P +  E   +  +  +  +H  +H G   Y    C +  T  + ++ +++      K Y+C  C   F +      H       KP       K+ +   + + ++      +   C  C +   + ++++ H   H   + YQC  C K F    +L +H++VH       CS C + FT    L  H ++
Sbjct:  379 KPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSECGLRFRHSFKLFHQR---IHTGEKPYQCSECGRSFRESGALRKHDCVF---LGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKP--YQCLDCGKSFTQQGNLQKHLRIHTGEK-----PFHCEECGKSFTQQGNLQIHQRVHTGEKPYECSECGKSFTFQTSSLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIHTGEKPYKCSECGKRFNERGYFRAHQRVHTGERPFPCLDCGKSFTQQANLQKHQRIHTGEKPYQCSDCGKSFTQQGNLTMHQRVHTGEKPYECSECGKSFTFQTALRRHQRL 794          

HSP 3 Score: 61.6178 bits (148), Expect = 3.385e-9
Identity = 103/417 (24.70%), Postives = 146/417 (35.01%), Query Frame = 2
Query: 1703 VVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSA----------------------------YKAHIRYHNILSSK-----GRDRTITP---RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-----------KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH--EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            V +K+K  +  K   +Y C  CG+  + +   + H   H   K   CP+C  SF  L  L RH  + H   +P  ++C  C K      ++  HLR H EE P  C  C +     SA                             K H RYH           G+  +IT    RH   K + + C  C K+FN +     H + H         P    +   +  +  S   H  +H G   Y       +D   + N   S           K Y+C  C   F  K  L  H     + KP       K       +KK++      K   C  C +     + +  L SHQ        YQC  C K F    SL  H++VH  EK  Q CS C + F     L +H ++
Sbjct:    4 VSDKSKQENSSKEKKEYHCSDCGKCFSAESQLKTHQRYHTGEKPYECPDCGKSFTILGHLQRH-RRVHTGEKP--FQCSDCGKSFYQQSSLKIHLRIHTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKPYECLECGKSFSITGHLLRHQREKKD-YHCLDCGKSFNQQGSLQSHQRIHTGEK-----PYQCSDCGKSFNQQGSLQSHQRIHTGEKPY-----QCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSF---NQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQ-CSDCGKSFNQQGSLQSHQRV 402          

HSP 4 Score: 55.0694 bits (131), Expect = 3.382e-7
Identity = 57/222 (25.68%), Postives = 89/222 (40.09%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA 2209
            ++   K + C+ C K+  ++   R H   H G +  +C DCG     +  +  H++ H     + CE CG+    + N + H  VH   K   C EC  SF +         K H++I  G+  Y C  C K    +SH   H R H  E P +C  C +  +    ++AH R H                  +    F C  C K+F  +A   +H + H 
Sbjct:  541 IHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKPYQCLDCGKSFTQQGNLQKHLRIHTGEKPFHCEECGKSFTQQGNLQIHQRVHTGEKPYECSECGKSFTFQTS----SLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIHTGEKPYKCSECGKRFNERGYFRAHQRVH------------------TGERPFPCLDCGKSFTQQANLQKHQRIHT 740          
BLAST of SMED30027578 vs. Ensembl Cavefish
Match: ENSAMXT00000022193.2 (zinc finger protein 501-like [Source:NCBI gene;Acc:103045258])

HSP 1 Score: 73.9442 bits (180), Expect = 2.736e-13
Identity = 107/412 (25.97%), Postives = 151/412 (36.65%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ--FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAH 2743
            K F C  C +   RK N + H   H G +   C DCG    + N +  H + H     Y C  CG+    + + + H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K       +  H R H  E P QC  C    S+  + + H R H                  +  + F C  C K+F  ++   +H + H++     CP C   S   I AL++H       +H G   Y  C E     +  I++ K        K Y+C  C   F     L KH       KP                         + CS        +SHL  HQ        YQC+KC K F    +L  H+ +H E+ +  CS C Q FT+   L  H
Sbjct:   51 KPFHCTECGQRFTRKNNLQMHQSIHTGEKPFHCSDCGRKFRRQNNLLIHQRIHTGERPYQCSECGKRFGHQISLQTHQRIHTGEKPYQCSDCGRSFSRQNNL-----KTHQRIHTGEKPYHCSECGKCFNQQATLQQHQRVHTGEKPYQCFICGHRFSHQISLQMHQRIH------------------TGEKPFRCLECGKSFIQQSNLQKHQRIHSEEKLYLCPECG-KSFREIGALKKHQR-----IHTGEKPYQ-CSECGKSFNHQISLQKHQRIHTGEKPYFCSDCGKSFRESCTLTKHQRIHTGEKP-------------------------YCCSECGASFTQQSHLQQHQRVHTGQKPYQCLKCGKSFRKSGALETHQCIHTEEKTYCCSDCGQSFTTSSVLDKH 407          
BLAST of SMED30027578 vs. Ensembl Cavefish
Match: ENSAMXT00000039744.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001833.1:34030:37575:-1 gene:ENSAMXG00000036628.1 transcript:ENSAMXT00000039744.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 4.182e-13
Identity = 108/438 (24.66%), Postives = 170/438 (38.81%), Query Frame = 2
Query: 1574 ITELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNILS----SKGRDRTITPRHLI------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
             +E++   K ++C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + N ++H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K     S HL+ H+     E P  C  C +  +  S  K H R H        S    R     HL       +  + + C  C K+F  ++   +H   H      PY   +  +S    + H+   H  +H G   Y +C +     +   ++ K        K YYC  C   F  + +L KH       KP       K  +    +KK++      K   C  C +   + SH+K H   H   + Y C  C K F   + L  H+++H  +    CS C + FT    L  H ++
Sbjct:   14 FSEIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLKKHQHIHTGEKPYYCSDCGKSFTQQSHL-----KKHQRIHTGEKPYYCSDCGKRFTQQS-HLKKHQSIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKRFTQQSHLKIHQRIHTGEKPYYCSDCGKSFTEQSHLKKHQHIHTGEK--PYYCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-YCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKRFTQQSDLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRI 437          

HSP 2 Score: 72.7886 bits (177), Expect = 1.422e-12
Identity = 104/435 (23.91%), Postives = 172/435 (39.54%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLKM 2752
            ++   K ++C  C K   ++ N ++H   H G +   C DCG    +    SH+K H +       Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K     SH L+ H+     E P  C  C +  +  S  K H   H        S  G+  T        +H+ +  + + C  C K+F  ++   +H   H      PY   +  +S    + H+   H  +H G   Y +C +     +   ++ K        K YYC  C   F  +  L KH       KP       K+ +    ++K++H     K   C  C +   + S++K H   H   + Y C+ C K+F   + L +H+++H       CS C + FT    L  H ++
Sbjct:  605 IHTGEKPYYCSDCGKRFTQQSNLRKHQHIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYHCSDCGKSFTQQSHL-----KKHQRIHTGEKPYYCSDCGKSFTQQSH-LKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSALKKHQHIHTGEK--PYHCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-YCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYCCSDCGKRFTQQSNLRKHQHIHTGEKPYCCSDCGKSFTQQSNLKKHQRIHTGEKPYHCLDCGKRFTAESHLKIHQRIHTGEKPYCCSDCGKSFTEQSTLKKHQRI 1025          

HSP 3 Score: 71.633 bits (174), Expect = 3.472e-12
Identity = 110/457 (24.07%), Postives = 171/457 (37.42%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-----------------------ITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            ++   K + C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + N ++H  +H   K   C +C  SF     L +H                         K H+ I  G+  Y C  C K     SH   H R H  E P  C  C +  +  S  K H R H        S  G+  T        +H+ +  + + C  C K+F  ++   +H + H      PY   +  +S    + H+   H  +H G   Y  C +     +   ++ K        K YYC  C   F  +  L KH +     KP       K  +    +KK++H     K   C  C +   + SH+K H   H   + Y C  C K F   ++L  H+ +H  +    CS C + FT    L  H ++
Sbjct:  409 IHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKTFTEKSALKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLRKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEK--PYYCSDCGKSF-TQQSHLKK-HQHIHTGEKPY-HCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSALKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRI 857          

HSP 4 Score: 69.3218 bits (168), Expect = 1.868e-11
Identity = 113/451 (25.06%), Postives = 175/451 (38.80%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFT--SHIRLMAHLKMFHKMAFSISKSCSRC 2797
            ++   K + C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K     SH   H R H  E P  C  C +  +  S  K H R H        S  G+  T        + + +  + + C  C KTF  K+   +H   H      PY   +  +S    + H+   H  +H G   Y +C +     +   ++ K        K YYC  C   F  +  L KH +     KP       K  +    +KK++      K   C  C +   + SH+K H   H   + Y C  C K F   + L  H+++H  +    CS C + FT  SH++   H+    K  +     CS C
Sbjct:  325 IHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTQQSHL-----KKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKTFTEKSALKKHQHIHTGEK--PYHCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-YCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLRKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYY-----CSDC 757          

HSP 5 Score: 60.4622 bits (145), Expect = 9.198e-9
Identity = 104/435 (23.91%), Postives = 166/435 (38.16%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2752
            ++   K ++C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H+ I  G+  Y C  C K     SH L+ H+     E P  C  C +  +  SA K H   H        S  G+  T        + + +  + + C  C K+F  ++   +H + H      PY   +  +S    + H+   H  +H G   Y  C +     +   N+ K        K Y C  C   F  +  L KH       KP       K+ +    +K ++      K   C  C +     S +K H   H   + Y C  C K F   +SL  H+++H  +    CS C + FT    L  H ++
Sbjct:  661 IHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYHCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHL-----KKHQHIHTGEKPYYCSDCGKSFTQQSH-LKKHQHIHTGEKPYYCSDCGKSFTQQSALKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEK--PYYCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-CCSDCGKRFTQQSNLRKHQHIHTGEKPYCCSDCGKSFTQQSNLKKHQRIHTGEKPYHCLDCGKRFTAESHLKIHQRIHTGEKPYCCSDCGKSFTEQSTLKKHQRIHTGEKPYYCSDCGKSFTEQSSLKNHQRIHTGEKPYYCSDCGKSFTEQSTLKKHQRI 1081          

HSP 6 Score: 56.225 bits (134), Expect = 1.593e-7
Identity = 95/399 (23.81%), Postives = 147/399 (36.84%), Query Frame = 2
Query: 1583 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHF-------KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2674
            ++   K ++C  C K+  +++  K+H   H G +   C DCG    +    SH+K H         Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H+ I  G+  Y C  C K     SH   H R H  E P  C  C +  +  S  K H R H                  +  + + C  C K+F  ++   +H + H   +  CC  C          LR+H       +H G   Y  C +     +   N+ K        K Y+C  C   F  +  L  H       KP       K  +    +KK++      K   C  C +     S +K+H   H   + Y C  C K F   ++L  H+++H
Sbjct:  717 IHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQ---SHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSAL-----KKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIH------------------TGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYCCSDCG-KRFTQQSNLRKHQH-----IHTGEKPY-CCSDCGKSFTQQSNLKKHQRIHTGEKPYHCLDCGKRFTAESHLKIHQRIHTGEKPYCCSDCGKSFTEQSTLKKHQRIHTGEKPYYCSDCGKSFTEQSSLKNHQRIHTGEKPYYCSDCGKSFTEQSTLKKHQRIH 1082          
BLAST of SMED30027578 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003208.1 (pep scaffold:Pmarinus_7.0:GL477029:150127:219242:1 gene:ENSPMAG00000002911.1 transcript:ENSPMAT00000003208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 3.691e-10
Identity = 53/175 (30.29%), Postives = 78/175 (44.57%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEKR-HALTHLGNEK---CKDCGLVVNKNKIC-----SHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCK---KIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHN 2071
            K + C  C K        R H L+H  N +   C+ CG    K         +H +S   Y C +CG+    + +  +H+ VH  A    C EC+ +F     L RH+ ++H   E   YEC FC    +   ++ H L TH      E P +C+ C+Q   +YSA   H+R HN
Sbjct:  424 KGYACDLCGKRFLDSLRLRMHLLSHSANGQSYSCEQCGAAFTKESSLEHHREAHRESGMAYFCLLCGKRLQTQSSLLQHMEVHAGAHEYVCGECNRTFPSHSTLKRHL-RSHTSGE-HPYECEFCGSCFRDEASLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHN 596          
BLAST of SMED30027578 vs. Ensembl Sea Lamprey
Match: prdm5 (PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040708-1])

HSP 1 Score: 60.8474 bits (146), Expect = 5.472e-10
Identity = 58/232 (25.00%), Postives = 97/232 (41.81%), Query Frame = 2
Query: 1604 FFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-----------------ITKAHRQIEPGKYE--CPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA 2209
            F C  C+K     N+ +RH +TH       C+ CG    + +++ SH   H     Y C++CG+  A +  ++ H   H + +   C EC A F+    L RH                 + K+H++   G+ E  CP+C +   +   +  H+R+H  E P QC+ C++  S     K HIR H                  ++ + + C  C K F+ K    +H + H 
Sbjct:  155 FDCQDCDKKFISANQLRRHMITHSEKRPFSCEVCGKSFKRLDQVASHKVIHSVDKPYTCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRHHKKYKCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGERPYQCQYCDKAFSKNDGLKMHIRTH------------------TREKPYQCSECNKAFSQKRGLDEHMRTHT 368          

HSP 2 Score: 51.9878 bits (123), Expect = 3.684e-7
Identity = 71/287 (24.74%), Postives = 109/287 (37.98%), Query Frame = 2
Query: 1664 THLGNEKCKDCGLVVNK-----NKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVL-SNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKP 2467
             HLG+ + +    + NK     + +  H K H  + C+ C +         RH+  H + +   C  C  SF+ L ++A H    H   +P  Y C  C K         +H +TH EE P QCE C  +  + +S  + H +Y                          C +C K F   ++   H K H   +   CPYC      S   LR HI +     H G   Y   +CD+  +  +D + ++     + K Y C  C   F  K  L++H       KP
Sbjct:  121 VHLGSSRKRPACNICNKKFSSSDILMEHRKVHEIFDCQDCDKKFISANQLRRHMITHSEKRPFSCEVCGKSFKRLDQVASHKV-IHSVDKP--YTCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRHHKKY-------------------------KCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCG-QKFASNGTLRVHIRS-----HTGERPYQCQYCDKAFSK-NDGLKMHIRTHTREKPYQCSECNKAFSQKRGLDEHMRTHTGEKP 372          
BLAST of SMED30027578 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000782.1 (pep scaffold:Pmarinus_7.0:GL478091:36496:71460:1 gene:ENSPMAG00000000706.1 transcript:ENSPMAT00000000782.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.334e-9
Identity = 79/354 (22.32%), Postives = 135/354 (38.14%), Query Frame = 2
Query: 1751 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLR-----THEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLH---EGHTKYGFCDEIVTDVSDNINIYK----------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            Y CE+C R     +  ++H+  H   K   C  C   F+      RH  + H   +P  Y C  C +     S++ R     +  E P  C  C Q  S  S+ K H                  RH+ +  + + C++C   F+++++   H + HA+    PY  +  L     +R      H  +H      T Y  C++     S + ++ +           K Y CE C   F   F L  H                + +K+++      +   C  C+R   R + +KSH   H   + ++C  C + F +P +L  H+ VH +  Q +C +C + F+    L  H
Sbjct:    3 YACELCRRRFTRHDYLQKHMRSHTGEKPYCCEVCGHGFKRCGNFKRH-QRMHTGEKP--YRCDLCGRRFSQCSNYKRHQCHHSAGEEPLSCSSCPQAFSQCSSLKDH------------------RHMHTGEKPYRCEVCDLHFSHRSILWSHRRTHAELQ--PY--VCELCQRRFVRSDYLQKHMCIHTYKRTVTPY-RCEQCGRGFSQSGSLERHRLREHLHTGEKPYRCEACGQAFMRAFSLKNH----------------LTLKRHQGIHTGERPYVCEVCNRSFARDTTLKSHRRVHTGEKPFRCEVCDRAFSHPTTLKNHQYVHMQGKQHQCDVCGKAFSRATTLRKH 314          
BLAST of SMED30027578 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.945e-8
Identity = 101/403 (25.06%), Postives = 149/403 (36.97%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHN------------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSL-HEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELC--RIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHE 2677
            + F C  C K  ++    K H   H G     CK+CG   +  + +  H K+H     +IC+ CGR  A K + + H  +H   K   C  C  SF     L  H  K H +  P  Y C  C K       +  H+RTH    P  C  C    S     KAH R H               + K   +T    H + K   F C+ C K ++ K+    H   H+        P    E      +  S  +  L H+G   +  C E     S   ++          KT+ C  C  R  FP+   L +H       +P       K  S    +K ++      K  +C  C R   +  H+KSH  +H   + Y+C  C K F    +L +H++ H+
Sbjct:  128 RPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAH-QKTHLKERP--YMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKP--FICKHCGKGYSLKSTLKNHEIVHSGEK-----PFLCKECGKGFSQGSSLKNHKLTHDGEQPF-ICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPS--SLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTHK 517          

HSP 2 Score: 53.5286 bits (127), Expect = 1.764e-7
Identity = 90/386 (23.32%), Postives = 142/386 (36.79%), Query Frame = 2
Query: 1685 CKDCGLVVNKNK-ICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2743
            C+ CG   +  + +  H+K+H +       +IC+ CG+  + K   + H   H   K   C +C   F     +     K HR    G+  Y C  C +     S  L+TH+     E P  C  C +     S  K H + H                  +    + C+ C K+F+Y +  T H K H      P+   +      A + H+   H  +H G   Y  C+      S N N+        K + Y CELC   F +K  L  H      +KP        K S    +K ++      +   C  C +   + S +K+H  +H +   + C  C K +   ++L  HE VH       C  C + F+    L  H
Sbjct:   16 CEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYM-----KVHRLTHTGERPYACQDCGQRFSQPS-SLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIH------------------TGERPYVCKECGKSFSYSSAMTVHQKTHTGEK--PFICKDCGRGF-AQKPHL-KTHQRIHTGEKPYA-CNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNH 372          
BLAST of SMED30027578 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008822.1 (pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 gene:ENSPMAG00000007983.1 transcript:ENSPMAT00000008822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.535e-8
Identity = 89/383 (23.24%), Postives = 135/383 (35.25%), Query Frame = 2
Query: 1745 FKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYE-CPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKC--HAQFTCCP------------------YCPINSLE--------SIPAL---REHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKS-HLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSS-QRCSICYQFFTSHIRLMAHLK 2749
             K+ C  CG+    + +   H  +H   K   C +CDASF     L  H+ K H   +P   E C  C +    ++ H R H +E P  C  C        + K H+R H        N+      +R   P H  L +    F C+ C K F  K    +H     + Q    P                  YC + +          S  AL   R+    VH + H G        C ++           K+  + CE+C   F +   L +H N    ++P K +   + F   +R+  L                SH+K+ H      YQC  C K+F  P+ L  H + H       C +C + F +   L  H +
Sbjct:    3 MKFECTTCGKTMTTRHSFNEHQRLHTGEKPYKCSQCDASFTIQTNLRTHMRK-HSGEKPFVCESCGQCFRNRSTLTVHRRRHTQERPYACTVCGARFRQSDSCKTHMRIHTGEKPFECNVCGKTFANRGNLPSHMRLHTGERLFQCEYCGKKFTLKGTMQKHVNSIHNPQNVVKPSSSSLGRRLVKVETVQEEYCGVTTSTLAGGCFECSACALQFSRQTEFVVHMAGHNGLEVLSCTVCKKLCVGQEALERHTKAHKHVCEICGKNFTSSNNLTQHMNLHLDVRPYKCQYCDVAF---HRNNSL---------------WSHIKARHNYGLPAYQCTHCNKRFATPSQLTHHLRYHTGERFHACELCGRMFVNRSGLQRHTR 366          

HSP 2 Score: 55.4546 bits (132), Expect = 3.213e-8
Identity = 50/171 (29.24%), Postives = 73/171 (42.69%), Query Frame = 2
Query: 1574 ITELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIR 2062
            +T   +    F C  C     ++ E   H   H G E   C  C  L V +  +  H K+H K++CE+CG+      N  +H+++H   +   C  CD +F     L  HI   H    P  Y+C  C K       ++HHLR H  E    CE C ++  N S  + H R
Sbjct:  198 VTTSTLAGGCFECSACALQFSRQTEFVVHMAGHNGLEVLSCTVCKKLCVGQEALERHTKAH-KHVCEICGKNFTSSNNLTQHMNLHLDVRPYKCQYCDVAFHRNNSLWSHIKARHNYGLPA-YQCTHCNKRFATPSQLTHHLRYHTGERFHACELCGRMFVNRSGLQRHTR 366          
BLAST of SMED30027578 vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 76.2554 bits (186), Expect = 3.032e-14
Identity = 105/447 (23.49%), Postives = 165/447 (36.91%), Query Frame = 2
Query: 1589 ILIKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCGLVVNKN------------------KICS--------------HMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2752
            + +K F C  CNK    K +  +H  TH G +   CK CG +  ++                  K+C               H      Y CE+CGR  +   N  RH+  H+  K   C +C+ SF    +L RH+ K H   +P  Y C  C K     C +S H + H    P  C  C++  +      +H+R H                  +  + F C  C K F+ K   T H + H      PY      +S   + + +        E   K   C +        ++I+K      K + C  C   F  K +L++H       KP          R K SL I M+ +     N K+ SC  C +     + ++ H+  H   + Y+C  C K F    +  +H + H K    +C+ C + F+    L  H++ 
Sbjct:  100 LKVKPFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHL-KTHTGEKP--YRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTH------------------TGEQPFKCTYCDKAFSIKGNLTVHIRRHTNER--PYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQ-QGGLSIHKKIHTEEKPHECTQCEKAFITKAKLDRHFRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHN----NDKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRT 518          

HSP 2 Score: 60.077 bits (144), Expect = 2.814e-9
Identity = 48/176 (27.27%), Postives = 76/176 (43.18%), Query Frame = 2
Query: 1706 VNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2212
            + K K+  H ++H     Y CE+C +    K++   H+ +H   KR+ C  C   F    EL +H+ + H   +P  Y+CP+C K      +   H RTH +E P +C  C +  S  S  + H+R H  +                    F C IC+K F  +    +H K H +
Sbjct:  395 ITKAKLDRHFRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHV-RIHTGEKP--YKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKE------------------FICSICEKAFLRRGCLKKHEKLHVK 549          
BLAST of SMED30027578 vs. Ensembl Nematostella
Match: EDO35006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP5])

HSP 1 Score: 74.3294 bits (181), Expect = 7.111e-14
Identity = 82/307 (26.71%), Postives = 132/307 (43.00%), Query Frame = 2
Query: 1610 CVTCNKTVRK-RNEKRHALTHLGNEKCKDCG-LVVNKNKICSHMKSHFK-YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN---ILSSKGRDRTITP---------RHLISKSEC--FSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKH 2440
            C  C K+ +  R    H LTH+ ++KC  C  +  + +++  H   H   Y C  C +  A +   + H+ +H+      CP+CD +F +   L  H+ + H   +P  + C  C K       ++ HLRTH  E P QCE C+Q  ++ S  K H+R H        +  DRT +           H + K+E     C++C K+F    + T+H K H       C +C      ++P+      AVH   H G   Y   +C    +  S N+ ++       K Y C  C+I F    +L +H
Sbjct:  115 CNYCKKSFKGIRELSVHILTHMDSQKCNKCDKIFSSSSELVRHFHHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLTCPKCDKTFIHSHGLNLHL-RVHTGEKP--FTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFC--GKAFTVPSGL----AVHLRTHTGEKPYRCEYCSRAFSH-SSNLKVHVRTHTGEKPYNCPTCKITFARSSDLRRH 411          

HSP 2 Score: 53.1434 bits (126), Expect = 3.256e-7
Identity = 58/240 (24.17%), Postives = 94/240 (39.17%), Query Frame = 2
Query: 1601 TFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-ITKAHRQIEPGKYECPFCKKI---VCAISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHI 2278
            T  C  C+KT +       H   H G +   CK CG    +   +  H+++H     Y CE C +      N + H+ +H   K   C  CD +F     L  H I+ +  + E   + C  C K    +  ++ HL+TH +  P QC  C +  +  S    H+R H                  +  + + C+ C + F++ +    H + H   +   CP C I    S   LR H+
Sbjct:  192 TLTCPKCDKTFIHSHGLNLHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTH------------------TGEKPYRCEYCSRAFSHSSNLKVHVRTHTGEKPYNCPTCKITFARS-SDLRRHV 412          

HSP 3 Score: 51.6026 bits (122), Expect = 1.149e-6
Identity = 93/398 (23.37%), Postives = 142/398 (35.68%), Query Frame = 2
Query: 1682 KCKDCGLVV-NKNKICSHMKSH---FKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH----------NILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ--FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRH----------QKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            +C+ C  V  NK +   H++ H   FK+ C  C        +   H++ H K+K   C +C+  F    +LA H+ + H  I+P  + C FC+       A+S H+  H  E   +C  C +          HI  H           I SS         RH     + + C  C KTF  +     H   H       CP C    + S      H   +H  +H G   +    C +     S N+ ++       K Y CE C   F +   L  H       KP K  +      +  H           K       C  C +    +  +  HL +H   + +QC  C K F  P+ L +H + H      RC  C + F+    L  H++
Sbjct:    2 QCQHCDKVCSNKRQYVKHLRYHQKSFKHKCPCCPEKFNDPSSLALHVACHVKSKGFLCGQCNKCFTSDRQLAEHMVQ-HSGIKP--FICHFCRSGFTHSLALSRHVILHLNEQSCRCNYCKKSFKGIRELSVHILTHMDSQKCNKCDKIFSSSSE----LVRHFHHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLTCPKCDKTFIHS------HGLNLHLRVHTGEKPFTCKHCGKAFAH-SGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTHTGEKPYRCEYCSRAFSHSSNLKVHVR 385          
BLAST of SMED30027578 vs. Ensembl Nematostella
Match: EDO41082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5G4])

HSP 1 Score: 73.9442 bits (180), Expect = 1.190e-13
Identity = 99/423 (23.40%), Postives = 159/423 (37.59%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNEKR-HALTHLGNEKCKDCGLVVNKNKICSHMKSH-FKY------ICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN----------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-----RISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFH 2758
            K + C TC+K   +R+    H   H G E+  +C     +    SH   H FK+      +C++C +  +      RH+  H   K   C +C+ +F Y   L +H    HR ++P  YEC  C +       +  H RTH  E P +C  C+ + S       H+R H             +    D   +   L +    + C+IC K F   +  + H   H+        P   L      R   + + H   H G   +    C ++    SDN++ +       K Y C++C   F     L  H  R   +KP K                      C  C ++      R  HM++H +  + Y C  C++ F    SL  H+ +H  +   +C  C + F S   L  H+K+ H
Sbjct:   25 KPYSCRTCDKEFTRRDALTCHIRIHTG-ERPYECRYCDKRFSQPSHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKP--YECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGERPYKCEICNKGFVQSSALSSHLLTHSGKR-----PYECLTCGQTFRSRSNLLYHERRHRGEAPFECQTCGKVFVR-SDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYK----------------------CERCDKRFTSSNERTRHMRTH-TGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVH 415          

HSP 2 Score: 50.447 bits (119), Expect = 2.291e-6
Identity = 96/401 (23.94%), Postives = 141/401 (35.16%), Query Frame = 2
Query: 1757 CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHL---------RTH-----------------------EENPKQCERCNQVLSNYSAYKAHIR-YH--------NILSSKGRDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSK-TYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKYRHQK-----LNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMA 2767
            C  C R    K +  +H  VH   K   C  CD  F     L  HI + H    P  YEC +C K     SH +         R+H                       ++ P  C +CN+  +  ++   H R YH        +I      DR+   +H    +    F C  C   F+ K + T+H + H       C YC   +      L+ H+      LH G   Y       GF     + +S ++  +  K  Y C  C   F ++  L  H  R     P + +T   +F++     K        K   C  C R     S +KSH   H   + Y+C +C K+F + N    H + H       C IC + F     L  H K+ H  A
Sbjct:    1 CSECSRAFKNKSDLVKHKRVHCDDKPYSCRTCDKEFTRRDALTCHI-RIHTGERP--YECRYCDKRFSQPSHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKPYECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSA-AFSVSDTLKSHL-----RLHTGERPYKCEICNKGFVQS--SALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERRHRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARH-KLIHSGA 389          
BLAST of SMED30027578 vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 70.0922 bits (170), Expect = 1.834e-12
Identity = 105/429 (24.48%), Postives = 165/429 (38.46%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDR--------TITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-HMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFH 2758
            K + C  C K   R    K H + H G +  KC +CG    ++   +H++ H     Y C+ CG+  +     +RH+ +H   K + C +C   F    +L  H+ + H   +P  YEC  C K   +   +  HLR H  + P +C+ C +  +     K H+  H+       D             RHL   +  + + C  C K F       +H K H+        P    E   +  EH     H  +H G   Y     G C   +  +  ++ I+   K Y C+ C   F     L +H       KP K            +L   +  +  QK  +K   C  C +    S H+K HL  H   + Y+C +C K F     L  H ++H  +   +C +C + F+    L  HL M H
Sbjct:    7 KRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCFTQHAN-THLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHL-RIHTGEKP--YECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKK-----PYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQK-PYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHL-MIH 424          

HSP 2 Score: 60.077 bits (144), Expect = 3.062e-9
Identity = 92/385 (23.90%), Postives = 141/385 (36.62%), Query Frame = 2
Query: 1598 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALRE--HISAVHFSLHEGHTKY--GFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-HMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVHEK 2680
            K + C  C K      N K H + H G +  KC +CG        +  H++ H     Y C+ CG+      N ++H+ +H   K   C EC  SF     L  H+   H   +P  Y+C  C K    +   L+TH      E P +C+ C +  +     K H+  H                  S  + + C +C K F      T H   H+     PY P    E      +  H+   H  +H G   Y  G C +  T    +  ++ I+   K Y C++C   F     L +H              L+I   +        K   C  C +    S ++K HL   S  + Y+C +C K F    +L  H  +H +
Sbjct:  145 KPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLI-IHSGKKP--YKCDECGKCFTELE-TLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIH------------------SGQKPYKCDVCGKCFTRSGALTTHLMIHSGQK--PYKPHKCDECGKCFNQSGHLKR-HLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRH--------------LMIHSGQ--------KPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSIHSR 482          
BLAST of SMED30027578 vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 69.707 bits (169), Expect = 1.941e-12
Identity = 95/377 (25.20%), Postives = 143/377 (37.93%), Query Frame = 2
Query: 1682 KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-HMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHL 2746
            KC +CG        + +H++ H K   Y CEVCG+    K + + H+ VH   K   C EC   F     L     KAH  I  GK  Y+C  C K    +S  L+TH      E P +C+ C +  +   A K H+R H                  +  + + C  C   F+  A    H   H+     PY   +       L   +   H  +H G   Y     G C      +  ++ I+   K Y C+ C   F    +L +H              L+I   +  H+        C  C ++   S  +K+HL  H   + Y+C  C K+F    ++  H ++H  K   +C  C + FT H  L  HL
Sbjct:   60 KCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHL-----KAHLVIHSGKKPYKCDECGKCF-TLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIH------------------TGKKPYKCDECGNCFSESAHLKAHLVIHSGEK--PY-KCDDCGKCFTLSGDLK-THLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRH--------------LVIHTGEKPHK--------CDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHL 386          
BLAST of SMED30027578 vs. Ensembl Medaka
Match: ENSORLT00000000322.2 (pep primary_assembly:ASM223467v1:2:5774736:5929187:1 gene:ENSORLG00000000262.2 transcript:ENSORLT00000000322.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 5.213e-17
Identity = 112/418 (26.79%), Postives = 169/418 (40.43%), Query Frame = 2
Query: 1598 KTFFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSHQIYQ---CIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSI 2776
            K F C  C+ +  R  + KRH  TH G +   CK+C     + + +  HM++H     + C+ C +      N +RH+  H   K   C ECD +F+YL  L RH+ K H + +P    EC  C   +  +  H+RTH  E P  C+ C++  S  S+ K H+R H            TP         FSC+ C K F Y      H + H     F+C  C     N  +    +R H     FS  E    +     + T +  +      K + C+ C   F     L  H       KP       K+ S +  +KK+       K  SC  C +   + S +K+H+  H+I +   C KC K F   +SL  H + H       C  C + F        H++   + AFS+
Sbjct:  195 KPFSCKECDNSFNRITHLKRHMRTHTGKKPFPCKECDKGFRDVSDLKRHMRTHTGEKPFYCKECDKSFCDGSNLKRHMRTHTGEKPFSCKECDKNFRYLSHLKRHM-KIHTREKPFSCEECDKCFIQIYDLKTHMRTHTGEKPFSCKECDKSFSYLSSLKTHMRTHT---------GETP---------FSCKECDKGFTYIYDLKVHMRTHTGEKPFSCGECGKRCSNLSDLKIHMRTHTGEKPFSCKECDKSFSCASNLTTHMRTHTG---EKPFSCKECDKSFTCLSNLTTHMRTHTGEKPFYCVECDKRFSHVSDLKKHMRTHTGEKPFSCKECKKYFNQTSSLKTHMRIHKIGKPLSCKKCDKSFSCVSSLKTHMRTHTGDKPFSCKECEKSFRFLSHFKRHMRTHRREAFSV 590          

HSP 2 Score: 75.8702 bits (185), Expect = 1.058e-13
Identity = 86/358 (24.02%), Postives = 142/358 (39.66%), Query Frame = 2
Query: 1748 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI--------LSSKGRDRTITPRHLISKS--ECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            ++ C+ C +  +F  N ++HI  H + K   C ECD SF     L RH+ + H   +P  + C  C      I+H   H+RTH  + P  C+ C++   + S  K H+R H                D +   RH+ + +  + FSC+ C K F Y +   +H K H +   F+C  C  C I   +    +R H     FS  E    + +   + T +  +        + C+ C   F   ++L  H       KP                       SC  C ++   +S +K H+ +H   + + C +C K F   ++L  H + H       C  C + FT    L  H++
Sbjct:  140 RFSCKGCDKGFSFLSNLKKHIRTHTREKPFSCKECDKSFSQASNLQRHM-RTHTGEKP--FSCKECDNSFNRITHLKRHMRTHTGKKPFPCKECDKGFRDVSDLKRHMRTHTGEKPFYCKECDKSFCDGSNLKRHMRTHTGEKPFSCKECDKNFRYLSHLKRHMKIHTREKPFSCEECDKCFIQIYDLKTHMRTHTGEKPFSCKECDKSFSYLSSLKTHMRTHTG---ETPFSCKECDKGFTYIYDLKVHMRTHTGEKP----------------------FSCGECGKRCSNLSDLKIHMRTHTGEKPFSCKECDKSFSCASNLTTHMRTHTGEKPFSCKECDKSFTCLSNLTTHMR 469          
BLAST of SMED30027578 vs. Ensembl Medaka
Match: ENSORLT00000042635.1 (pep primary_assembly:ASM223467v1:2:11817338:11931414:1 gene:ENSORLG00000027982.1 transcript:ENSORLT00000042635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 4.832e-16
Identity = 103/395 (26.08%), Postives = 153/395 (38.73%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGN-----EKCKDCGLVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHI-TKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLI-------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFT--CCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2674
            K F C+ C+K+    +  K H  TH G      E+C  C   V+  KI  HM++H     + C+ C R  +   + + H+  H   +   C ECD  F  L  L  HI T     +    Y+C  C K     SH   H+RTH   NP  CE C+   S  S  KAH+R H      S K  D + +  H +       +  + FSC+ C+  F   +    H + H       C  C   S   I  LR H+       H G                       K + C++C I F + + L  H       KP          S +  +K +       K  SC  C +   + SH+K H+ +H   +++ C +C + F   +SL  H + H
Sbjct:  190 KPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKI--HMRTHTGEKPFSCKECDRSFSHVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTHIGNNPFSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECD-KSFGQIFGLRRHMRT-----HTG----------------------EKPFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSHLKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHMKAH 554          

HSP 2 Score: 70.0922 bits (170), Expect = 7.145e-12
Identity = 95/391 (24.30%), Postives = 145/391 (37.08%), Query Frame = 2
Query: 1685 CKDCGLVVNKNKICSHMKSHFK------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKI---VCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLIS---------KSECFSCQICQKTFNYKAMFTQHYKCHAQFTCC--PYCPINSLESIPA-------LREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2749
            C++CG      +  +H+K+H +      + C  C +    K   ERH+  H   K   C ECD  F  +  L RH+ + H   +P  + C  C K       + +H+ TH  E P  CE C+   S  S  K H+R H      S K  DR+ +  H+ S             FSC+ C K F+  +    H + H        PY      +S          +R HI    FS  E  T +     +   +  +      K + C+ C   F +   L  H       KP                       SC  C  +  R+SH+K+H+ +H   + + C +C K F     L  H + H       C +C   F+    L AH++
Sbjct:  111 CEECGESF---RWWTHLKTHMRTHSGELFSCTECDKSFCAKSYLERHMRSHTGEKLFSCKECDKGFGQISHLKRHM-RTHTGEKP--FACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKIHMRTHTGEKPFSCKECDRSFS--HVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTHIGNNPFSCEECDTSFSRLSHLKAHMRTHTG---EKPFSCKECDTSFSDMHNLKAHMRIHTGEKP----------------------FSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDLYNLKAHMR 468          

HSP 3 Score: 52.7582 bits (125), Expect = 1.380e-6
Identity = 61/223 (27.35%), Postives = 96/223 (43.05%), Query Frame = 2
Query: 1604 FFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCK---KIVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTI-----TPRHLISKS--ECFSCQICQKTFNYKAMFTQHYKCHA 2209
            F C  C+ +  R  + K H  TH G +   CK+C     + + + +HM+ H     + CE C        + + H+  H   K   C ECD SF  +  L RH+ + H   +P  + C  C      +  +  H+RTH  E P  CE C+   S     K H+R H      S K  D++        RH+ + +  + FSC+ C + F+  +   +H K H 
Sbjct:  336 FSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHM-RTHTGEKP--FSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSHLKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHMKAHT 555          
BLAST of SMED30027578 vs. Ensembl Medaka
Match: ENSORLT00000028583.1 (pep primary_assembly:ASM223467v1:2:6354181:6394595:-1 gene:ENSORLG00000027186.1 transcript:ENSORLT00000028583.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 4.851e-16
Identity = 113/436 (25.92%), Postives = 174/436 (39.91%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGF--------CDEIVTDVSDNINIY-KSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRC 2797
            K F CV CNK     ++ K+H  TH G +   CK+C    +  + + +HM+ H     + C  CG+I +   N   H+ +H   K   C ECD  F ++ +L +HI + H    P  + C  CKK      ++  H+R H  E P  C+ C++  S  S  K H+R H                  +  + FSC+ C K F+  +   +H + H     F+C  C  C      S+  L++H+          H++           CD+     SD   I  + K   C+ C   F +   L  H       KP       K  S I  +K +       +  SC  C R    IS +KSH+ +H   + + C  C K F   +SL  H + H       C  C++ F+    L AH +          K C +C
Sbjct:  100 KHFSCVECNKGFSHVSDLKKHIRTHTGEKPFSCKECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKIFSCLSNLITHMRIHTGEKPFSCKECDRRFSHVSDLKKHI-RTHTGERP--FSCKECKKQFSQTSSLQRHMRIHTGEKPFSCKECDKSFSCLSTLKKHVRTH------------------TGEKPFSCKECVKRFSSVSNLKKHMRTHTGEKPFSCKECVKC----FSSVSNLKKHMRT--------HSRKSLMTIFLCKVCDKSFILSSDMEKIMDRKKRLSCKECDKSFSHISNLKTHMRTHTGEKPFSCKECDKGFSHISNLKTHMRTHTGERPFSCKECDRSFSHISDLKSHMRTHTGEKPFSCSVCDKSFGQISSLQKHRRTHTGEKPFSCIYCHKSFSDISNLKAHARTHTGEKPFSCKECDKC 502          

HSP 2 Score: 61.6178 bits (148), Expect = 2.532e-9
Identity = 56/217 (25.81%), Postives = 94/217 (43.32%), Query Frame = 2
Query: 1592 LIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFT 2218
            L+  F C  C+K+    ++    +       CK+C    +  + + +HM++H     + C+ C +  +   N + H+  H   +   C ECD SF ++ +L  H+ + H   +P  + C  C K    IS    H RTH  E P  C  C++  S+ S  KAH R H                  +  + FSC+ C K FN+ +   +H + H + T
Sbjct:  325 LMTIFLCKVCDKSFILSSDMEKIMDRKKRLSCKECDKSFSHISNLKTHMRTHTGEKPFSCKECDKGFSHISNLKTHMRTHTGERPFSCKECDRSFSHISDLKSHM-RTHTGEKP--FSCSVCDKSFGQISSLQKHRRTHTGEKPFSCIYCHKSFSDISNLKAHARTH------------------TGEKPFSCKECDKCFNHMSHLRRHMRTHTRTT 520          

HSP 3 Score: 58.5362 bits (140), Expect = 2.227e-8
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1805 HISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFC-KKIVCA--ISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTIT-----PRHLISKS--ECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIF--------------MKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2749
            H+  H   K   C EC+  F ++ +L +HI + H   +P  + C  C K+  C   ++ H+R H  E P  C  C ++ S  S    H+R H      S K  DR  +      +H+ + +    FSC+ C+K F+  +   +H + H     F+ C  C   S   +  L++H+       H G   +  C E V   S   N+ K        K + C+ C   F +   L K H R H     +K+ + IF              M+K   +K   K++SC  C +    IS++K+H+ +H   + + C +C K F + ++L  H + H  + +R   C  C + F+    L +H++
Sbjct:   92 HLRSHTGEKHFSCVECNKGFSHVSDLKKHI-RTHTGEKP--FSCKECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKIFSCLSNLITHMRIHTGEKPFSCKECDRRFSHVSDLKKHIRTHTGERPFSCKECKKQFSQTSSLQRHMRIHTGEKPFS-CKECD-KSFSCLSTLKKHVRT-----HTGEKPFS-CKECVKRFSSVSNLKKHMRTHTGEKPFSCKECVKCFSSVSNLKK-HMRTHS----RKSLMTIFLCKVCDKSFILSSDMEKIMDRK---KRLSCKECDKSFSHISNLKTHMRTHTGEKPFSCKECDKGFSHISNLKTHMRTH--TGERPFSCKECDRSFSHISDLKSHMR 430          
BLAST of SMED30027578 vs. Ensembl Medaka
Match: ENSORLT00000017686.2 (pep primary_assembly:ASM223467v1:3:9540654:9578150:1 gene:ENSORLG00000023806.1 transcript:ENSORLT00000017686.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.030e-15
Identity = 91/341 (26.69%), Postives = 149/341 (43.70%), Query Frame = 2
Query: 1574 ITELNILIKT------FFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHI-----------------------TKAHRQIEPGK--YECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--C--PYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHN 2446
            ++++ IL++T      + C  C+K   R  N KRH  TH G +   CK+C    N+ + +  HM++H     YIC+ CG+    K     H  +H + +R  C EC+ SF Y+  L +H+                        K H +I  G+  + C  CKK    +SH   H+RTH  E P  C+ C +  S  S  + H+R H                  +  + FSC+ C K+F   +   +H + H     F+C  C   +C +++L+S   +R H     FS  E +    FCD  V+++  ++  +   K + C+ C+  F  K    +H N
Sbjct:   81 LSQVKILMRTHTENKPYSCKECDKGFSRISNLKRHMRTHTGEKPFSCKECEKSFNQISDLNRHMRTHTGERCYICKECGKSFCDKSLFRIHTRIHAEDERFSCKECEKSFNYISHLKQHMRTHTGEKPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSHVSHLKTHMRTHTGEKPFSCKECKKSFSRVSHLQTHMRTH------------------TGEKPFSCKECDKSFRDVSTLKKHMRTHTGEKPFSCKECNKSFCDVSNLKS--HMRTHTGEKPFSCKECN--KSFCD--VSNLKTHMRTHTGEKPFSCKECKKSFKGKMFTPRHTN 397          

HSP 2 Score: 63.1586 bits (152), Expect = 6.027e-10
Identity = 76/308 (24.68%), Postives = 125/308 (40.58%), Query Frame = 2
Query: 1808 ISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2674
            +  H + K   C ECD  F  +  L RH+ + H   +P  + C  C+K    IS    H+RTH  E    C+ C +   + S ++ H R H                  ++ E FSC+ C+K+FNY +   QH + H     F+C  C     ++      +R H     FS  E    +     + T +  +      K + C+ C+  F     L  H       KP       K    +  +KK+       K  SC  C++    +S++KSH+ +H   + + C +C K F + ++L  H + H
Sbjct:   88 MRTHTENKPYSCKECDKGFSRISNLKRHM-RTHTGEKP--FSCKECEKSFNQISDLNRHMRTHTGERCYICKECGKSFCDKSLFRIHTRIH------------------AEDERFSCKECEKSFNYISHLKQHMRTHTGEKPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSHVSHLKTHMRTHTG---EKPFSCKECKKSFSRVSHLQTHMRTHTGEKPFSCKECDKSFRDVSTLKKHMRTHTGEKPFSCKECNKSFCDVSNLKSHMRTHTGEKPFSCKECNKSFCDVSNLKTHMRTH 371          

HSP 3 Score: 62.3882 bits (150), Expect = 1.040e-9
Identity = 60/219 (27.40%), Postives = 96/219 (43.84%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2212
            K F C  CNK+    +  K H   H G +   CK+C    +     SH+K+H +       + C+ C +  +   + + H+  H   K   C ECD SF+ +  L +H+ + H   +P  + C  C K  C +S+   H+RTH  E P  C+ CN+   + S  K H+R H                  +  + FSC+ C+K+F  K    +H   H +
Sbjct:  207 KPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSH---VSHLKTHMRTHTGEKPFSCKECKKSFSRVSHLQTHMRTHTGEKPFSCKECDKSFRDVSTLKKHM-RTHTGEKP--FSCKECNKSFCDVSNLKSHMRTHTGEKPFSCKECNKSFCDVSNLKTHMRTH------------------TGEKPFSCKECKKSFKGKMFTPRHTNTHCE 401          
BLAST of SMED30027578 vs. Ensembl Medaka
Match: ENSORLT00000040026.1 (pep primary_assembly:ASM223467v1:2:6351994:6397251:-1 gene:ENSORLG00000027186.1 transcript:ENSORLT00000040026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 1.042e-15
Identity = 75/253 (29.64%), Postives = 116/253 (45.85%), Query Frame = 2
Query: 1598 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYC--PINSLESIPA-LREHISAVHFSLHE 2305
            K F CV CNK     ++ K+H  TH G +   CK+C    +  + + +HM+ H     + C  CG+I  F  N   H+ +H   KR  C ECD SF ++  L  H+ + H   +P  + C  C K    IS+   H+RTH  E P  C+ C++  S+ S  K+H+R H                  +  + FSC +C K+F   +   +H + H     F+C  YC    + + ++ A  R H     FS H+
Sbjct:   93 KHFSCVECNKGFSHVSDLKKHIRTHTGEKPFSCKECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKI--FSSNKLFHVKLHTGKKRLSCKECDKSFSHISNLKTHM-RTHTGEKP--FSCKECDKGFSHISNLKTHMRTHTGERPFSCKECDRSFSHISDLKSHMRTH------------------TGEKPFSCSVCDKSFGQISSLQKHRRTHTGEKPFSCI-YCHKSFSDISNLKAHARTHTGEKPFSFHQ 321          
BLAST of SMED30027578 vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 429/430 (99.77%), Query Frame = 2
Query: 1523 MRHSFYSRTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2812
            MRHSFYSRTYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:    1 MRHSFYSRTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 430          
BLAST of SMED30027578 vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 419/429 (97.67%), Postives = 423/429 (98.60%), Query Frame = 2
Query: 1523 MRHSFYSRTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEI 2809
            MRHSFYSRTYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISK  +   +E+
Sbjct:    1 MRHSFYSRTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKRPTEAMLEL 429          
BLAST of SMED30027578 vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 423/430 (98.37%), Postives = 427/430 (99.30%), Query Frame = 2
Query: 1523 MRHSFYSRTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2812
            + HSF ++TYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:   25 ISHSF-NKTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 453          
BLAST of SMED30027578 vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 423/430 (98.37%), Postives = 427/430 (99.30%), Query Frame = 2
Query: 1523 MRHSFYSRTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2812
            + HSF ++TYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:   13 ISHSF-NKTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 441          
BLAST of SMED30027578 vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 397/430 (92.33%), Postives = 401/430 (93.26%), Query Frame = 2
Query: 1523 MRHSFYSRTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2812
            + HSF ++TYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYL                          IVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:   23 ISHSF-NKTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYL------------------------NPIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 427          
The following BLAST results are available for this feature:
BLAST of SMED30027578 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF5462.472e-1525.93zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5462.472e-1525.93zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5462.655e-1525.93zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5462.655e-1525.93zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF6241.702e-1426.00zinc finger protein 624 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027578 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crol5.636e-1223.41gene:FBgn0020309 transcript:FBtr0335473[more]
crol1.815e-1023.31gene:FBgn0020309 transcript:FBtr0335474[more]
crol2.655e-1023.71gene:FBgn0020309 transcript:FBtr0080263[more]
crol9.894e-1022.61gene:FBgn0020309 transcript:FBtr0080260[more]
Meics1.340e-924.56gene:FBgn0025874 transcript:FBtr0333030[more]
back to top
BLAST of SMED30027578 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drll.35.231e-1925.79draculin-like, tandem duplicate 3 [Source:ZFIN;Acc... [more]
znf11432.330e-1726.03zinc finger protein 1143 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch73-367f21.59.143e-1727.61si:ch73-367f21.5 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
znf10571.214e-1625.55zinc finger protein 1057 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf10282.360e-1624.15zinc finger protein 1028 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031570.16.836e-1624.93gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
abraxas11.873e-1526.48abraxas 1, BRCA1 A complex subunit [Source:Xenbase... [more]
stk313.607e-1526.22serine/threonine kinase 31 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000024787.11.454e-1425.35gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
stk312.770e-1424.82serine/threonine kinase 31 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp281.429e-1524.93zinc finger protein 28 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp264.727e-1525.64zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp7086.713e-1424.66zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7087.884e-1424.43zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7088.256e-1424.43zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30027578 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10078|ZFP28_MOUSE9.994e-1524.93Zinc finger protein 28 OS=Mus musculus OX=10090 GN... [more]
sp|Q86UE3|ZN546_HUMAN1.187e-1425.93Zinc finger protein 546 OS=Homo sapiens OX=9606 GN... [more]
sp|P10076|ZFP26_MOUSE1.922e-1425.64Zinc finger protein 26 OS=Mus musculus OX=10090 GN... [more]
sp|Q9N003|ZN425_MACFA2.825e-1426.51Zinc finger protein 425 (Fragment) OS=Macaca fasci... [more]
sp|Q9P2J8|ZN624_HUMAN8.173e-1426.00Zinc finger protein 624 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of SMED30027578 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2CME32.370e-1725.41Uncharacterized protein OS=Cyprinodon variegatus O... [more]
A0A3B4U1324.615e-1726.75Uncharacterized protein OS=Seriola dumerili OX=414... [more]
A0A5F9C3R04.759e-1727.29Uncharacterized protein OS=Oryctolagus cuniculus O... [more]
A0A096MF067.040e-1725.11Uncharacterized protein OS=Poecilia formosa OX=486... [more]
A0A3B3VYT79.239e-1726.90Uncharacterized protein OS=Poecilia latipinna OX=4... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011094.21.118e-1426.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040057.11.753e-1425.53gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
ENSAMXT00000039103.14.549e-1423.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000022193.22.736e-1325.97zinc finger protein 501-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000039744.14.182e-1324.66pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003208.13.691e-1030.29pep scaffold:Pmarinus_7.0:GL477029:150127:219242:1... [more]
prdm55.472e-1025.00PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000000782.12.334e-922.32pep scaffold:Pmarinus_7.0:GL478091:36496:71460:1 g... [more]
ENSPMAT00000002487.11.945e-825.06pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
ENSPMAT00000008822.12.535e-823.24pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 ... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027578 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488393.032e-1423.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350067.111e-1426.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410821.190e-1323.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318381.834e-1224.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268791.941e-1225.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027578 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000322.25.213e-1726.79pep primary_assembly:ASM223467v1:2:5774736:5929187... [more]
ENSORLT00000042635.14.832e-1626.08pep primary_assembly:ASM223467v1:2:11817338:119314... [more]
ENSORLT00000028583.14.851e-1625.92pep primary_assembly:ASM223467v1:2:6354181:6394595... [more]
ENSORLT00000017686.21.030e-1526.69pep primary_assembly:ASM223467v1:3:9540654:9578150... [more]
ENSORLT00000040026.11.042e-1529.64pep primary_assembly:ASM223467v1:2:6351994:6397251... [more]
back to top
BLAST of SMED30027578 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072474.10.000e+099.53SMESG000072474.1[more]
SMESG000072474.10.000e+097.67SMESG000072474.1[more]
SMESG000072474.10.000e+098.37SMESG000072474.1[more]
SMESG000072474.10.000e+098.37SMESG000072474.1[more]
SMESG000072474.10.000e+092.33SMESG000072474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027578 ID=SMED30027578|Name=SMED30027578|organism=Schmidtea mediterranea sexual|type=transcript|length=2857bp
TTATCTTTGAACATTTTTAAAATAAACATTCGATGGAAACTGGATTTCAA
GTCAGAAAAAGAAAATTTTCTGTATGCAGTCCTATAAATGTTAATAACAT
GAAACGTTTCAAATCCGAAAAACTTGATAATTTTCCAAAATCTGATATAA
AAAATGAATCAAAAGGTGATTTGGAAATAGTTAAATTTGATATTTCAAAA
TCAATGTTTAAAAAGTCATTTATCCCAACATGATAAAACAGAAAAGTGCG
AGCATTGTTTGAAAACTTTCACGGCTATTGGTATTCAACGACATTCATGT
ACTATTTTCTATTGTGAAACTTGTGGAAAGAAATACACAATTAGAAGTAA
ATTTGAGTCTCATTTAAGGCATCATGCTCGTATCGAAGAAAGAAAATCCT
TGGTTGGTGTCCTAATGCAATTTTTTCATTAATTCTCAAATTTTACTGCA
CTGCGTACTTCTGAAGTGCGCCGATTATGACGTGATGGTTAACATTCAAG
TATAATTTATTGATAATTATAAATAATAGATTAATTTAATTATCGGGTAG
TAAATCATAAAATTAAGAATTACAAAGGGACAATTTGATTTATTAAGTAG
TTAGTTTATAAAATAAATTCAAATTAGAAGTTTTTACCCGCTTCCATAAT
GTAATATGTGAAATTTTATGTTAACAGTCAAAATATGGGAGGGATAGTTA
TCCCATTTCTTTAAATCGGCCTGTTAAAAATAATTGGTGGTTATGATTTC
CATTTGTGATTTAACAAATTAATTTCAAGTATAAAGTGTAAAATTTGACA
TTGGGAAACACAAGCCTGGACAATTTCAATTAAAACTTTACAAGCGAGGA
AGCACCAAGAATATACAAAAAAAGTGAGAATACTTTTATGGGGTCAGCTC
ATGAATTTTATTTTAACTATCACATTGGCTTACTGCATGACGTAAAATAT
TCACACAAATTTAGTTTAGGGCAGCGTTTCTAACCTTTTTGTTGGTGACT
CAAGATAAAAAGAATTAACCTCTTACACCGACCGCGACATGTTTAAAAAG
TGACGCTAAAAAATAACAGATTTTCATTGAATTTTCTCGCCAACCATTTT
TCTTATATTATATTCATTTGAGTACAATTAAAGTTCGAATTCTCGTCCCC
TAATATCAGATAACCTCCTTTACTTATATATAATAAATGATTTAAAATCA
ATATTTATGAAAATATTCGGTGAAAGTATTGCAAACCTTTTGTATAATAT
CCTTTATCTTAATTTCTTATATGTGAATTGTGTAAAAAATCAATATATTT
CACTGATATATTGTTTGAAATTTTCCAAAAAGATGTTATAAATTTATTTA
TTAAATTACTATTAAATTTGGGCCTATAATATAATATTCATTAAAAATTT
TTTATGGATTTCTGATTTCTTGGAAATTGGTTAAGTAATAAAAGTACATG
TTGCATCAGCGATTGTATTAGCCATTCTTGTAACAAGTATGATATATATT
GCATAAAATATCAAGATTTTTAATGCGACATTCATTTTATTCTAGAACTT
ATGACAATAGAGCAAAATATACAATTACGGAGTTAAACATTTTAATCAAA
ACATTTTTCTGTGTAACTTGCAATAAAACCGTCAGGAAAAGGAATGAAAA
ACGGCACGCATTGACACATCTCGGCAATGAAAAATGTAAAGACTGTGGAC
TGGTAGTGAACAAAAACAAAATTTGCTCTCATATGAAAAGTCATTTTAAA
TACATTTGTGAAGTTTGTGGGAGAATCGACGCGTTTAAAGAAAACCACGA
AAGGCATATTTCGGTCCATGAAAAGGCTAAACGGAACCCGTGTCCAGAAT
GTGACGCCTCCTTTCAATATCTAGTTGAGTTAGCCCGACATATTACAAAG
GCACATCGACAAATAGAACCCGGTAAATATGAATGTCCATTCTGTAAAAA
GATCGTGTGTGCTATAAGTCACCATTTGAGAACCCACGAAGAAAATCCTA
AACAATGCGAAAGATGCAATCAAGTTTTATCCAATTATTCAGCATATAAG
GCACATATAAGATATCATAATATTTTATCGAGTAAAGGTCGCGATAGAAC
TATAACTCCAAGGCATTTAATTTCTAAATCAGAATGTTTTTCATGTCAAA
TTTGCCAGAAAACTTTCAATTATAAAGCAATGTTTACCCAGCATTATAAA
TGCCACGCACAATTTACTTGTTGTCCATATTGTCCAATCAATTCGCTCGA
ATCAATTCCAGCGCTCCGGGAGCATATTAGTGCCGTTCATTTCTCATTGC
ATGAAGGTCATACTAAATATGGCTTTTGTGATGAAATTGTCACTGACGTT
TCCGATAATATAAATATTTACAAATCAAAAACCTACTATTGTGAACTGTG
CAGAATTCCATTCCCAAACAAATTTGAACTCAACAAGCATCACAACAGGC
GTCACAAGTTGAAACCAAGAAAAAAGACTAGTTTAATTATATTCATGAAA
AAATATCGTCATCAGAAATTGAATTTCAAAAAAGTTTCATGCTTTGCCTG
CAGCCGGAAAATTCGTATTTCCCACATGAAATCTCATCTCTCTTCTCATC
AAATATATCAGTGCATAAAGTGCCAGAAGAAATTTTTTAATCCAAATTCA
CTTGTATTACACGAGCAAGTCCATGAGAAAAGTTCACAGAGATGTTCTAT
TTGTTATCAATTTTTCACAAGTCACATCAGATTAATGGCACATTTGAAAA
TGTTTCATAAAATGGCTTTTTCAATTTCTAAAAGTTGTTCCAGGTGCAGA
ATTGAAATTTGTTGATATATTTGTTTGAAATAAATTATTTTTTGATTTAA
AAAAAAA
back to top

protein sequence of SMED30027578-orf-1

>SMED30027578-orf-1 ID=SMED30027578-orf-1|Name=SMED30027578-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MRHSFYSRTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHL
GNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHE
KAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH
HLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLI
SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALRE
HISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNK
FELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS
HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTS
HIRLMAHLKMFHKMAFSISKSCSRCRIEIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR007087Znf_C2H2
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 160..182
e-value: 1.1
score: 18.3
coord: 338..359
e-value: 110.0
score: 4.2
coord: 288..311
e-value: 0.2
score: 20.7
coord: 28..49
e-value: 180.0
score: 2.1
coord: 105..128
e-value: 0.37
score: 19.8
coord: 389..412
e-value: 2.9
score: 16.9
coord: 136..155
e-value: 29.0
score: 9.2
coord: 53..74
e-value: 25.0
score: 9.7
coord: 362..384
e-value: 0.0039
score: 26.4
coord: 232..256
e-value: 14.0
score: 11.9
coord: 77..99
e-value: 4.8
score: 16.1
coord: 206..228
e-value: 0.093
score: 21.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 107..128
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 391..412
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 290..311
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 208..228
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 364..384
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 162..182
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 105..133
score: 9.39
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 206..229
score: 10.097
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 77..104
score: 8.704
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 362..389
score: 10.741
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 362..413
e-value: 1.2E-6
score: 30.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 74..132
e-value: 5.8E-9
score: 37.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 133..188
e-value: 2.0E-5
score: 26.4
NoneNo IPR availablePANTHERPTHR24377FAMILY NOT NAMEDcoord: 26..183
coord: 196..425
NoneNo IPR availablePANTHERPTHR24377:SF809SI:DKEY-20I20.8-RELATEDcoord: 149..311
NoneNo IPR availablePANTHERPTHR24377:SF809SI:DKEY-20I20.8-RELATEDcoord: 26..183
coord: 196..425
NoneNo IPR availablePANTHERPTHR24377FAMILY NOT NAMEDcoord: 149..311
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 361..409
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 77..124